Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H020402.283ON39939920020.0
Smik_14.2962.283ON38936412571e-172
Skud_14.2982.283ON38936712501e-171
Suva_14.3112.283ON38935612151e-166
YNL035C2.283ON38936412111e-165
ZYRO0A01804g2.283ON37634212031e-164
KLTH0G10296g2.283ON42637111971e-163
NDAI0G006302.283ON39734811911e-162
Kwal_27.115502.283ON40734411661e-158
SAKL0E07766g2.283ON39834411621e-158
KAFR0H033402.283ON36733611541e-157
NCAS0G038702.283ON38940011461e-156
Kpol_1003.342.283ON38836611421e-155
KLLA0E08449g2.283ON42233811111e-150
TBLA0B059202.283ON40333910961e-148
Ecym_33212.283ON40934310871e-146
TDEL0G021402.283ON39234610811e-146
TPHA0C033702.283ON41335010831e-146
ADL218C2.283ON40333510691e-144
CAGL0G01628g2.283ON37635910151e-136
KLTH0C11550g6.9ON3981341283e-07
KLLA0D00814g6.9ON4081991275e-07
ZYRO0F00462g6.9ON3931811161e-05
CAGL0B03575g6.9ON4191201161e-05
TDEL0G033402.401ON5141891132e-05
TPHA0G026502.401ON5161871133e-05
TBLA0B092502.401ON5261791123e-05
ADR242C2.401ON5211841115e-05
KNAG0E009806.9ON4141831105e-05
TBLA0A071206.9ON4071761105e-05
KAFR0L003206.9ON3911871096e-05
Kpol_1045.786.9ON3921161071e-04
ZYRO0A08690g2.401ON5161861071e-04
KLTH0E12694g8.548ON4181831062e-04
Kpol_1041.202.401ON5151841062e-04
TBLA0H036508.548ON4191841052e-04
Ecym_30126.9ON3971571042e-04
ACR017W6.9ON423581034e-04
Suva_13.3112.401ON5101851034e-04
KLTH0F19294g3.25ON4511271025e-04
NCAS0F019702.401ON5111851026e-04
Kwal_55.220673.25ON4511271008e-04
Sklu_YGOB_Anc_2.4012.401ON5201861000.001
Suva_5.126.9ON401196990.001
Ecym_70428.548ON414189990.001
NDAI0K029006.9ON438188980.002
Skud_5.336.9ON401198980.002
KLTH0E09394g2.401ON522189980.002
KNAG0F038707.534ON46594980.002
YMR131C (RRB1)2.401ON511185980.002
SAKL0E00814g6.9ON398191970.002
Skud_13.2912.401ON509185980.002
Smik_13.3292.401ON509185980.002
Kwal_47.178272.401ON523188970.002
Skud_11.2711.247ON646140970.003
SAKL0C13266g3.25ON459132950.003
KNAG0E021802.401ON517190930.007
CAGL0K03861g2.401ON513188920.008
KLLA0E07085g3.25ON452123920.008
KLLA0F17237g2.401ON523178920.009
SAKL0C13332g3.22ON135364920.011
Kwal_56.223456.9ON396252900.012
TBLA0H030601.247ON73068910.013
NDAI0G053401.247ON718162900.018
Ecym_60672.401ON522188890.021
NCAS0C044503.25ON461127880.023
KAFR0A003802.401ON516186880.027
Kwal_55.220763.22ON128663870.042
Skud_16.326.276ON522138860.045
CAGL0A00561g4.119ON41277850.049
KNAG0C034907.405ON362138850.052
Smik_5.316.9ON427144850.058
NDAI0H027502.401ON512183850.061
TDEL0A068906.276ON447139850.061
Kwal_27.120708.548ON41884840.081
TBLA0B087303.25ON461121830.090
ZYRO0G10406g4.119ON391123830.091
NCAS0F001906.9ON411101830.094
Kpol_1045.337.405ON361105830.10
CAGL0J01287g2.470ON610148830.10
Kpol_1014.193.25ON452124830.11
YEL056W (HAT2)6.9ON401196820.12
KLTH0F19338g3.22ON129063830.14
Ecym_20243.22ON131759820.16
KLLA0F21406g1.247ON705109810.18
KLLA0E04819g7.534ON459153810.18
KLLA0F12694g8.180ON380147810.18
TPHA0G018408.631ON43159810.18
KNAG0D027205.49ON1541179810.20
KNAG0A012503.25ON452118800.23
KLLA0E20967g3.22ON132159810.24
Smik_14.143.25ON466122800.27
SAKL0H09900g8.548ON425113790.27
KNAG0A036708.548ON426110790.28
KAFR0A033801.247ON666137800.29
Suva_11.2681.247ON645120800.29
Smik_6.4516.276ON523135790.30
TPHA0A003803.22ON131082800.32
Kwal_47.173108.133ON553101790.34
Kwal_26.77382.470ON611116790.34
Ecym_71055.201ON484190790.37
YKR036C (CAF4)1.247ON643121790.38
NCAS0G011206.276ON494128780.38
KNAG0D034604.119ON41254780.38
TPHA0P014903.25ON459134780.41
KNAG0D007406.276ON504129780.42
KNAG0I010508.288ON115956790.43
CAGL0M04081g3.25ON455124780.44
TPHA0B011201.247ON719152780.47
ZYRO0D08206g6.340ON51595770.60
Smik_11.2981.247ON662122770.62
NDAI0E015008.631ON42856760.64
KLTH0H02134g7.310ON1299126770.64
CAGL0G04345g1.247ON711192770.69
KAFR0F010606.276ON553128760.74
AFR195W8.150ON45430760.76
Suva_14.223.25ON469122760.77
Skud_14.223.25ON467122760.77
Ecym_62118.150ON54730760.82
KLTH0E13552g8.585ON31686750.82
Smik_16.4287.525ON50091750.86
Suva_16.606.276ON52652750.92
YNL317W (PFS2)3.25ON465121750.93
KAFR0H022608.324ON938117760.94
Smik_15.163.22ON132682760.95
KLTH0D05346g2.469ON507111751.0
AEL250C8.548ON417179751.0
NCAS0A144707.405ON362136741.0
NCAS0I024903.95ON62641751.0
Smik_10.1261.247ON712116751.1
Smik_12.525.201ON48971741.2
Suva_15.223.22ON133654751.2
Skud_10.1021.247ON708116741.2
CAGL0H00781g6.276ON51353741.3
ZYRO0A09636g8.435ON808134741.3
Kwal_26.77362.469ON50750741.3
ZYRO0C03124g3.25ON445124741.4
SAKL0F10384g7.310ON126183741.4
TBLA0G014904.122ON732142741.5
KAFR0I028403.25ON456118731.5
Kpol_1038.203.22ON131354741.5
KAFR0A064804.122ON568161741.5
TPHA0L021305.49ON1508162741.5
ZYRO0D03828g1.247ON726116741.6
ZYRO0F09372g8.721ON44898731.6
ACR097W8.631ON46798731.7
NDAI0C057708.585ON33588731.7
KLTH0G12276g8.324ON93732731.7
CAGL0D05588g5.201ON47756731.7
YPL247C6.276ON523135731.7
NCAS0B044708.150ON50030731.8
NCAS0A151707.534ON47498731.8
NCAS0F033405.429ON44864731.8
ADL186C3.22ON136159731.9
TPHA0D028605.615ON325179721.9
ZYRO0F06314g8.631ON43153721.9
YLL011W (SOF1)5.201ON48975722.0
NCAS0B022008.544ON82276732.0
ZYRO0G03146g2.469ON510113722.0
KAFR0F033404.119ON40930722.1
Skud_15.163.22ON133282732.1
NCAS0C044303.22ON131191732.1
Suva_7.748.150ON52930722.2
Smik_7.838.150ON52630722.2
Skud_7.838.150ON52630722.3
YGL190C (CDC55)8.150ON52630722.3
Suva_4.4528.544ON80076722.4
YOR272W (YTM1)8.721ON460168722.4
KAFR0G027607.163ON112444722.4
ZYRO0B10450g5.201ON48248722.6
TPHA0M001906.9ON39176712.6
Kwal_47.172068.150ON22830702.6
ACR085Cna 1ON954122722.7
SAKL0H08932g8.585ON31486712.7
Skud_2.3248.544ON80276722.7
KLLA0D02530g4.309ON70740722.8
YOL138C (RTC1)3.22ON134154722.8
TBLA0C039904.123ON43798712.8
Ecym_22826.135ON569139712.8
CAGL0J01265g2.469ON517109712.8
Kpol_1013.377.534ON46852712.8
Suva_8.3218.721ON460168712.9
NCAS0A105003.259ON47846713.0
Kwal_27.122398.585ON31686703.1
CAGL0L06182g8.150ON49530713.4
KLLA0F19734g8.288ON113357713.5
TDEL0D013101.247ON709114713.6
NDAI0B019108.150ON50630703.7
TBLA0B035708.721ON458119703.7
KLTH0E06534g8.150ON46030703.7
KLLA0F09053g8.150ON45230704.2
Suva_4.537.310ON127159704.4
SAKL0F15972g7.534ON47095704.4
Skud_16.4687.525ON49891704.5
ZYRO0D06556g8.288ON114751704.5
AEL314W1.247ON715104704.6
AFL014C6.135ON557139704.6
NDAI0H023302.450ON993116704.7
NDAI0F012406.276ON52449694.9
Suva_4.4278.585ON31585694.9
KLTH0A00880g7.534ON47197695.0
KLTH0G13068g8.288ON110145705.1
TDEL0B046108.150ON52130695.1
Skud_16.4827.534ON46555695.2
Skud_12.565.201ON489215695.5
ZYRO0E08184g6.276ON50680695.6
SAKL0H07656g8.631ON426144686.0
TBLA0I022806.325ON927138696.0
ZYRO0A13068g8.548ON397129686.0
CAGL0M05335g8.544ON80651696.0
TPHA0L016908.544ON832107696.0
TDEL0C021307.333ON52652686.6
Suva_2.297.418ON278971696.8
KLLA0A08822g4.122ON582101686.9
KAFR0E031808.544ON81451686.9
KNAG0A037008.544ON81751686.9
TBLA0A023106.276ON53149686.9
Suva_2.2918.288ON115166687.2
ZYRO0G19250g8.150ON53930687.4
Kpol_1060.246.276ON48651687.4
NCAS0E037507.310ON127673687.4
TPHA0B005504.315ON133091687.6
NCAS0B036908.288ON114553687.8
Skud_11.1082.450ON852116687.8
KLLA0E21187g5.429ON42937677.9
TDEL0A077806.363ON657136688.2
TDEL0A004403.25ON451122678.2
TDEL0F041508.288ON113453688.4
Smik_2.3358.548ON422182678.7
Skud_15.4378.721ON461119678.7
CAGL0K09284g6.325ON911138678.9
Kpol_1064.358.721ON45398679.3
NCAS0B016608.631ON42489679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02040
         (399 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   775   0.0  
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   488   e-172
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   486   e-171
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   472   e-166
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   471   e-165
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   468   e-164
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   465   e-163
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   463   e-162
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   453   e-158
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   452   e-158
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   449   e-157
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    446   e-156
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   444   e-155
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   432   e-150
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   426   e-148
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   423   e-146
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   421   e-146
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   421   e-146
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   416   e-144
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   395   e-136
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    54   3e-07
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    54   5e-07
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    49   1e-05
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    49   1e-05
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    48   2e-05
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    48   3e-05
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    48   3e-05
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    47   5e-05
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    47   5e-05
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    47   5e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    47   6e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    46   1e-04
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    46   1e-04
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    45   2e-04
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    45   2e-04
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    45   2e-04
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    45   2e-04
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    44   4e-04
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    44   4e-04
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    44   5e-04
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    44   6e-04
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    43   8e-04
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    43   0.001
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    43   0.001
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    43   0.001
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      42   0.002
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    42   0.002
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    42   0.002
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.002
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    42   0.002
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    42   0.002
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    42   0.002
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    42   0.002
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    42   0.002
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    42   0.003
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    41   0.003
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    40   0.007
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    40   0.008
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    40   0.008
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    40   0.009
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    40   0.011
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    39   0.012
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    40   0.013
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    39   0.018
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    39   0.021
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      39   0.023
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    39   0.027
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    38   0.042
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.045
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    37   0.049
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    37   0.052
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    37   0.058
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    37   0.061
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.061
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    37   0.081
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    37   0.090
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    37   0.091
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    37   0.094
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    37   0.10 
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    37   0.10 
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    37   0.11 
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    36   0.12 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    37   0.14 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    36   0.16 
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    36   0.18 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    36   0.18 
KLLA0F12694g Chr6 complement(1174812..1175954) [1143 bp, 380 aa]...    36   0.18 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    36   0.18 
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    36   0.20 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    35   0.23 
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    36   0.24 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    35   0.27 
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    35   0.27 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    35   0.28 
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    35   0.29 
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    35   0.29 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    35   0.30 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.32 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    35   0.34 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   0.34 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    35   0.37 
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    35   0.38 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    35   0.38 
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    35   0.38 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    35   0.41 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    35   0.42 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    35   0.43 
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    35   0.44 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    35   0.47 
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    34   0.60 
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    34   0.62 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    34   0.64 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    34   0.64 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    34   0.69 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    34   0.74 
AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic ho...    34   0.76 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    34   0.77 
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    34   0.77 
Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}...    34   0.82 
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    33   0.82 
Smik_16.428 Chr16 (739953..741455) [1503 bp, 500 aa] {ON} YPR169...    33   0.86 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    33   0.92 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    33   0.93 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    34   0.94 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    34   0.95 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    33   1.0  
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    33   1.0  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    33   1.0  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   1.0  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    33   1.1  
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    33   1.2  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   1.2  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    33   1.2  
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    33   1.3  
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    33   1.3  
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    33   1.3  
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    33   1.4  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    33   1.4  
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    33   1.5  
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    33   1.5  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    33   1.5  
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    33   1.5  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   1.5  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    33   1.6  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    33   1.6  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    33   1.7  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    33   1.7  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    33   1.7  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   1.7  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    33   1.7  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    33   1.8  
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    33   1.8  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    33   1.8  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   1.9  
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    32   1.9  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    32   1.9  
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    32   2.0  
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    33   2.0  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    32   2.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    32   2.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   2.1  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   2.1  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    32   2.2  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    32   2.2  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    32   2.3  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    32   2.3  
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    32   2.4  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    32   2.4  
KAFR0G02760 Chr7 (571389..574763) [3375 bp, 1124 aa] {ON} Anc_7....    32   2.4  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    32   2.6  
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    32   2.6  
Kwal_47.17206 s47 complement(299680..300366) [687 bp, 228 aa] {O...    32   2.6  
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    32   2.7  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    32   2.7  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    32   2.7  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    32   2.8  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    32   2.8  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    32   2.8  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   2.8  
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    32   2.8  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    32   2.8  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    32   2.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   3.0  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    32   3.1  
CAGL0L06182g Chr12 (702461..703948) [1488 bp, 495 aa] {ON} highl...    32   3.4  
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    32   3.5  
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    32   3.6  
NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {O...    32   3.7  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    32   3.7  
KLTH0E06534g Chr5 complement(600189..601571) [1383 bp, 460 aa] {...    32   3.7  
KLLA0F09053g Chr6 (842591..843949) [1359 bp, 452 aa] {ON} simila...    32   4.2  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    32   4.4  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    32   4.4  
Skud_16.468 Chr16 (821432..822928) [1497 bp, 498 aa] {ON} YPR169...    32   4.5  
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    32   4.5  
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    32   4.6  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    32   4.6  
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    32   4.7  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    31   4.9  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    31   4.9  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    31   5.0  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    32   5.1  
TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {O...    31   5.1  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    31   5.2  
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    31   5.5  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    31   5.6  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    31   6.0  
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    31   6.0  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    31   6.0  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    31   6.0  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    31   6.0  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    31   6.6  
Suva_2.29 Chr2 complement(47586..55955) [8370 bp, 2789 aa] {ON} ...    31   6.8  
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    31   6.9  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    31   6.9  
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    31   6.9  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    31   6.9  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    31   7.2  
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    31   7.4  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    31   7.4  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    31   7.4  
TPHA0B00550 Chr2 (123270..127262) [3993 bp, 1330 aa] {ON} Anc_4....    31   7.6  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    31   7.8  
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    31   7.8  
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    30   7.9  
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    31   8.2  
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    30   8.2  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    31   8.4  
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    30   8.7  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    30   8.7  
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    30   8.9  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    30   9.3  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    30   9.9  

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/399 (94%), Positives = 377/399 (94%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN
Sbjct: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
           ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE
Sbjct: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ
Sbjct: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180

Query: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240
           EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR
Sbjct: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240

Query: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300
           AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF
Sbjct: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300

Query: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPISLQ 360
           IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPISLQ
Sbjct: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPISLQ 360

Query: 361 SEPSAMDTALXXXXXXXXXXXXXXXXXXXXXXSQRYKPY 399
           SEPSAMDTAL                      SQRYKPY
Sbjct: 361 SEPSAMDTALKSETKKHKKKKEKRSKEQKHPKSQRYKPY 399

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  488 bits (1257), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 224/364 (61%), Positives = 288/364 (79%), Gaps = 3/364 (0%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           M+  S + S FFGSENWC ++QP YK G+LT LSNGE+ L+DW + KS+   K+ ETAIN
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            L+++++D+       +AS+ AVK+FD+R+N+CI TI NE  +PFLSLDSR+  +ACGTE
Sbjct: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTE 120

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           L+G+DA +HI+D+RK D P +SL+DSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q
Sbjct: 121 LQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240
           +EE+D+LHQVIN+ SIHSCGW++PKRIYTLSHMETFAIHELN+KSDEL EPQPLDFGD+R
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVR 240

Query: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300
            AW CDYVVDIYPG +ATGK+ +E  GEL+LIP K E +  +    IP AHGDEV+RD+F
Sbjct: 241 KAWDCDYVVDIYPGLIATGKT-QENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIF 299

Query: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL-DESLDSFAG-QPPIS 358
           I    S+++YSCGEDGY+ IW++  GPLN PE FW+Y   MNVL D+S ++F   + P+ 
Sbjct: 300 ISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLI 359

Query: 359 LQSE 362
           +Q +
Sbjct: 360 IQKD 363

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 222/367 (60%), Positives = 288/367 (78%), Gaps = 3/367 (0%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           MS  S + S  FGSENWC ++QP YK G+LT LSNGE+ L+DW S +S+ K K+ ET+IN
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            L+++++D+       +AS+ AVK+FD+R+NAC+  IHNE  +PF+SLDSR+  +ACGTE
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTE 120

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           L+G+DA ++I+D+R+ D P +S++DSHHDD+T IKFHPSD NVLLSGSTDGYTNIYDL Q
Sbjct: 121 LQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

Query: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240
           +EE+D+LHQVIN+ SIHSCGW++ KRIYTLSHMETFAIHELN+KSDE  EP+P DFGDIR
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIR 240

Query: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300
            AW CDYVVD+YPG +ATGK+ +EG GEL+L+P + E V  +N I IP AHGDEV+RDVF
Sbjct: 241 EAWNCDYVVDVYPGLIATGKT-QEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVF 299

Query: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE--SLDSFAGQPPIS 358
           I    S+++YSCGEDG++ IW+NN GPLN PE FW+Y   +NVLDE     S + + PI 
Sbjct: 300 ISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPII 359

Query: 359 LQSEPSA 365
           +Q E + 
Sbjct: 360 IQKESAV 366

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 219/356 (61%), Positives = 285/356 (80%), Gaps = 3/356 (0%)

Query: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71
           FGSENWC ++QP YK G+LT LSNGE+ L+DW + K + K ++ ETAIN ++I+++D+  
Sbjct: 12  FGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDMKIIDSDFVA 71

Query: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131
                +AS+ +VK+FD+RSN C+  I+NE  +PFLSLDSR+  +ACGTEL+G+DA +HI+
Sbjct: 72  GNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQGIDAAIHIY 131

Query: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191
           D+RK D P +SLVDSHHDD+T IKFHPSD NVLLSGSTDGYTNIYDL Q++E+D+LHQVI
Sbjct: 132 DVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDDEEDALHQVI 191

Query: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251
           N+ SIHSCGW++PKRIYTLSHMETF+IHELN+KSDEL EPQPLDFGDIR AW CDYVVD+
Sbjct: 192 NYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKAWNCDYVVDV 251

Query: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVYS 311
           YPG++ATGK+ +EG GEL+L+P K E +   N I IP AHGDEV+RDVF+ EQN++V+YS
Sbjct: 252 YPGFIATGKT-QEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVSEQNTDVLYS 310

Query: 312 CGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL-DESLDSFAG-QPPISLQSEPSA 365
           CGEDG + IW+N+ G LN P  FW+Y   ++VL DE+ ++    + P+ +Q E  A
Sbjct: 311 CGEDGCVKIWKNSLGCLNTPASFWDYSERISVLEDENKEAPTSLEEPLIIQKESVA 366

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  471 bits (1211), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 281/364 (77%), Gaps = 3/364 (0%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           M+  S + S  FGSENWC ++QP YK G+LT LSNGE+ L+DW + KS+ K K+ ETAIN
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            ++++ +D+       +AS+ AVK+FD+R+N  I  I NE  +PF+SLDSR+  +ACGTE
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTE 120

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           L+G+DA ++I+D+RK D P +SL+DSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q
Sbjct: 121 LQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

Query: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240
           +EE+D+LHQVIN+ SIHSCGW++PKRI+TLSHMETFAIHELN+KSDEL EPQPLDFGD+R
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVR 240

Query: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300
             W CDYVVDIYPG +ATGK+ +E  GEL L+P K E V  +N I IP AHGDEV+RD+F
Sbjct: 241 EIWNCDYVVDIYPGLIATGKT-QENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIF 299

Query: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL--DESLDSFAGQPPIS 358
           IP Q+S ++YSCGEDG + IW N  GPL++PE FW+Y   MNVL  D+   S     P+ 
Sbjct: 300 IPAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLI 359

Query: 359 LQSE 362
           +Q E
Sbjct: 360 IQKE 363

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  468 bits (1203), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 212/342 (61%), Positives = 275/342 (80%), Gaps = 1/342 (0%)

Query: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           S + S  FG+ NWC  +QP Y+  +L SLSNG+VH +DW++ KSI   K+ E A+N L++
Sbjct: 4   SLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKL 63

Query: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           +N D  NE+ + TA+M AVK++D+RSN C+ TI N+  APFLSLDSR++ +ACGTEL G 
Sbjct: 64  INNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS 123

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           DA+LHI+D+RK D+P +SLVDSHHDDIT I FHPSD NVL+SGSTDGYTNIYDL Q EE+
Sbjct: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244
           D+LHQVINF SIHSCGW+ P+RI+TLSHMETF+IHELN+KSDE  EP+P++F D+R +WG
Sbjct: 184 DALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRESWG 243

Query: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304
           CDYVVDI+PGYVA G S +EG G+L+++P +GE V  +N I I +AHGDEV+RDVF+P +
Sbjct: 244 CDYVVDIHPGYVACGNS-QEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPAR 302

Query: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE 346
           NS+++YSCGEDG +  W N SGPLNV ++FW+Y   +NVLDE
Sbjct: 303 NSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  465 bits (1197), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/371 (58%), Positives = 285/371 (76%), Gaps = 9/371 (2%)

Query: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           S++ S  FG  NWC ++QP+Y +G+LTSLSNG V L+DW ++KSI + ++  T++N + I
Sbjct: 23  SKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDMVI 82

Query: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           +N D  N +   TA+  AVK++D++SN C+ T+ N   APFLSLDSR+  + CGTEL GV
Sbjct: 83  INNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTELSGV 142

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           DA+LH++D+R    P +SLVDSHHDDITSIKFHPSD NVLLSGSTDGY NIYDL+Q+EED
Sbjct: 143 DAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEED 202

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244
           D+LHQVINF SIHSCGW++PKRIYTLSHMET+ IHELN+K DE TEP+P+DFGD+R  W 
Sbjct: 203 DALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRKPWD 262

Query: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304
           C+YV+D+YPG++ATGKS EEG+GELKLIPL  E   + + I+IPSAH DEV+RDV +P Q
Sbjct: 263 CNYVIDVYPGFIATGKS-EEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVPFQ 321

Query: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLD------ESLDSFAGQPPIS 358
           + +++YSCGEDG L +W++++GPLNVP++FW Y   ++V        E +DS    P I 
Sbjct: 322 HEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVFSGTVAEVEMMDSEV--PDIE 379

Query: 359 LQSEPSAMDTA 369
           L+ EPS +D  
Sbjct: 380 LRQEPSDVDAV 390

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  463 bits (1191), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 284/348 (81%), Gaps = 4/348 (1%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKA-GILTSLSNGEVHLMDWKSNKSINKFKSDETAI 59
           +S  S + S+ FGS NWCF+ QPL KA G+L SLSNGE+H +D+ + +S    +    +I
Sbjct: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62

Query: 60  NALQIVNTDWHNETRFITASMHAVKLFDVRSN-ACIGTIHNEVGAPFLSLDSRYDKIACG 118
           N L+I+N+D+H  + F TA+  +VK+FD+ SN   I T+HN+   PFLSLDSR+  +A G
Sbjct: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122

Query: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           TEL+GVDAQ++I+D+RK D P +SL+DSHHDD+T++KFHPSD  VLLSGSTDGYTN+YDL
Sbjct: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182

Query: 179 SQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGD 238
           +Q++EDD+LHQV+N+ SIHSCGW++P RI+TLSHMETFAIHELN+KS+EL EPQPLDFGD
Sbjct: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242

Query: 239 IRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRD 298
           +R  WGCDYV+D+YPGY+A GKS +EG G+LKLIP  GEN+ + +++ IPSAHGDEVIRD
Sbjct: 243 VREKWGCDYVIDVYPGYIAAGKS-QEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRD 301

Query: 299 VFIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYD-IPMNVLD 345
           VFIP  +SE+VYSCGEDG++N+W+NN+G LNVPE+FW+Y    M+VLD
Sbjct: 302 VFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  453 bits (1166), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 273/344 (79%), Gaps = 1/344 (0%)

Query: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           S++ S  FG++NWC ++QPLY  G+L SLSNG V L+DW  NK I++ ++  T I+ + +
Sbjct: 4   SKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMVV 63

Query: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           +N D +N     TA+  +VK+FD+RS+  + T+ NE  APFLSLDSR+  +ACGTEL GV
Sbjct: 64  LNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTELSGV 123

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           DA+LHI+D++    P +SLVDSHHDDIT+IKFHP+D NVLLSGSTDGY NIYDL+Q EED
Sbjct: 124 DAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPEED 183

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244
           D+LHQVINF SIHS GW  PKRIYTLSHMETF IHELN+K +E TEP P DFGDIR +WG
Sbjct: 184 DALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQSWG 243

Query: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304
           CDYVVD+YPG++ATGKS +EG+GE+KLIP  GE++ +D+ ++IPSAHGDEV+RDV +P Q
Sbjct: 244 CDYVVDVYPGFIATGKS-QEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVPFQ 302

Query: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESL 348
           + +++Y+CGEDG +N W++N GPLNVP++FW+Y   ++V   S+
Sbjct: 303 HEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGSV 346

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 198/344 (57%), Positives = 272/344 (79%), Gaps = 1/344 (0%)

Query: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           S++ +  FG ENWC Q+QPLY  G+LTSLSNG +HL+DW + + I++F +   +I+ L++
Sbjct: 4   SKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNLKV 63

Query: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           +N ++ N   F +AS  +VK+FDVR+++C+ T+HN+  APFLSLDSR+D +ACGTEL GV
Sbjct: 64  LNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTELSGV 123

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           DA+LHI+D++KL  P +S VDSHHDDIT  KFHP D  VL+SGSTDGY NIYDL+  +E+
Sbjct: 124 DAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSDEE 183

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244
           D+LHQVINF S+HSCGW+ P+RIYTLSHMETFAIHELN+KSD+L EP+P++FGD+R  WG
Sbjct: 184 DALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQPWG 243

Query: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304
           CDY+++I PG++A G+S +E +GELKLI    E V   N ++IP AHGDE+IRDV IP+Q
Sbjct: 244 CDYIININPGFIAAGRS-QETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIPDQ 302

Query: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESL 348
            ++++YSCGEDG LNIW++ +GPLN+   FW+Y    NV ++++
Sbjct: 303 TTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTV 346

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 267/336 (79%), Gaps = 1/336 (0%)

Query: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71
           FGS+NWC + QPLY  G+LTSLSNGEV L+DW++   +  FK D+ +IN+++++N D++N
Sbjct: 11  FGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNN 70

Query: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131
            + F TA++++VK++D++SN CI TI N+  +PFLSLDSR+D +ACGTEL+GVDA+L+I+
Sbjct: 71  ASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIY 130

Query: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191
           D+R   +P KS VDSHHDDIT IKFHPSD N LLSGSTDGYTN+YDL+Q+EEDD+L+QVI
Sbjct: 131 DVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVI 190

Query: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251
           N+ SIHSCGW++P+RIYTLSHMETF+I ELN+++DEL EPQPLDFGDIR  W CDYV+DI
Sbjct: 191 NYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQWNCDYVIDI 250

Query: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVYS 311
           YPGY+ATG+S +EG G L++IP+ GE V     I+I  AH DEVIRDVFIP  +  V+YS
Sbjct: 251 YPGYIATGRS-QEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRNHHNVLYS 309

Query: 312 CGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDES 347
           CGEDG +  W++        E+FW+Y    NV ++S
Sbjct: 310 CGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  446 bits (1146), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 286/400 (71%), Gaps = 15/400 (3%)

Query: 2   SQCSQIGSYFFGSENWCFQIQPLYKA--GILTSLSNGEVHLMDWKSNKSINKFKSDETAI 59
           S  S + S  FGS NW  ++QPL     G+LTSLSNGEVH +D  +  +I K+   ET+I
Sbjct: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 60  NALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGT 119
           N LQ++N +  +   F TA+ ++VK+FD+ S   + TIH++   PF SLDSR+  +ACGT
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122

Query: 120 ELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           ELKGVDA ++I+D+RK D P +SLVDSHHDD+T +K+HP+D N+LLSGSTDGYTN+YDLS
Sbjct: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182

Query: 180 QEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDI 239
           + EE+DSLHQVINF SIHSCGW++P+RI+TLSHMETFAIHELN+KSD L EPQP+D GD+
Sbjct: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242

Query: 240 RAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDV 299
           R  WGCDYVVD+YPG++ATGKS E  +GELKLIPL+ E + + N+I IP AH DEVIRDV
Sbjct: 243 REKWGCDYVVDVYPGFIATGKSQER-QGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDV 301

Query: 300 FIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPISL 359
           +IP  +S ++Y+CGEDG + +W+NN+GPLNVPE+ W+Y   +N+L+++L +         
Sbjct: 302 YIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLA--------- 352

Query: 360 QSEPSAMDTALXXXXXXXXXXXXXXXXXXXXXXSQRYKPY 399
              PS + TA                        QRYKPY
Sbjct: 353 ---PSEVVTAGEVKQSQEPDTKEKKHKKKKRDHKQRYKPY 389

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  444 bits (1142), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 275/366 (75%), Gaps = 3/366 (0%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           MS  S + S   G  +WC ++QPLY+ G+L+SLSNG+V+L+DW +   I   K+  T+IN
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVR--SNACIGTIHNEVGAPFLSLDSRYDKIACG 118
            ++++++D+ N + F  A   AVK+ D+R   N+ +  ++NE   PFLSLDSR+  +ACG
Sbjct: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120

Query: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           TEL GVDA++HI+D+R  D P + LVDSHHDD+T IKFHPSD NVLLSGSTDGYTN+YDL
Sbjct: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180

Query: 179 SQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGD 238
           +Q EE+D+LHQVIN+ S+HSCGW++PKRIYTLSHMETFAIHELNNKSDELTEP+PLDFGD
Sbjct: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240

Query: 239 IRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRD 298
           IR  W CDYVVD+YPGY+A GKS EE  G LK+IP   E + I+++ISIP+AHGDEV+RD
Sbjct: 241 IRGTWDCDYVVDVYPGYIAVGKS-EENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299

Query: 299 VFIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPIS 358
           VFI  ++  ++YSCGEDG +  W+  +  L VP  FW+Y   +NVLD+++D    +    
Sbjct: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTR 359

Query: 359 LQSEPS 364
             SEPS
Sbjct: 360 NISEPS 365

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  432 bits (1111), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 262/338 (77%), Gaps = 1/338 (0%)

Query: 11  FFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH 70
           +F   NWC ++QPLY+ G++TS+S+G VHL+DW + K+I+  +   T+IN ++++N+D+ 
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFD 69

Query: 71  NETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
               F TA+   VK++D+R+   + ++ N+  +PF SLDSR++ +ACGTELK  DA+LHI
Sbjct: 70  TGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTELKDYDAELHI 129

Query: 131 FDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQV 190
           +D+R    P +S VDSHHDDIT IKFHP D N+L+SGSTDGY NIYDL+Q++E+D+LHQV
Sbjct: 130 YDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQV 189

Query: 191 INFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVD 250
           INF SIHSCGW+ PKRI++LSHMETF IHELN+KSDE+ EP+PL+FGD+R  WGCDYV+D
Sbjct: 190 INFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDKWGCDYVID 249

Query: 251 IYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVY 310
           IYP ++ATGK+H E +GELK+IP + E V + + + IP AHG+EVIRDV IP+  + ++Y
Sbjct: 250 IYPSFIATGKTH-ESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIPKNQTSLLY 308

Query: 311 SCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESL 348
           SCGEDGY+N+W++ +  LNVP  FW+Y +P    + S+
Sbjct: 309 SCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSV 346

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  426 bits (1096), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 266/339 (78%), Gaps = 5/339 (1%)

Query: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71
           FGS NWC + +PLY  G+LTSLSNGE+ ++DWK+N+  +K K  ET+IN  +IVN +++ 
Sbjct: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70

Query: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131
            +  +TA+  +VK++D++SN CI TI NE  +PFLSLDS ++ +ACGTEL GVDA+L+I+
Sbjct: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130

Query: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191
           D+R  D P +S VDSHHDDIT IKFHP+D  VL+SGSTDGYTNIYDL++ EE+DSLHQVI
Sbjct: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190

Query: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251
           N++SIHSCGW++ +RI+TLSHMETFAIH+LN+KS+ L EP+P++FGDIR  WGC+YV+D+
Sbjct: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250

Query: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVI--DNTISIPSAHGDEVIRDVFIPEQNSEVV 309
           YPGY+ATGK+ EE KG+LK+ P   E + +  DN I IP AHGDEVIRDVFI   +   +
Sbjct: 251 YPGYIATGKT-EESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309

Query: 310 YSCGEDGYLNIWR--NNSGPLNVPEKFWNYDIPMNVLDE 346
           YSCGEDG + +W+    +  L +PE F++Y + +NVLDE
Sbjct: 310 YSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDE 348

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/343 (56%), Positives = 257/343 (74%), Gaps = 5/343 (1%)

Query: 2   SQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINA 61
           ++C  I    FGS+NWC ++QPLY  G+L++LSNG VHL+DW S  SI       T+I+A
Sbjct: 4   TKCDTIS---FGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 62  LQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           L++++ D  +   F+TAS  +VK+FD+R N C+ T+ N   +PF+SLDSR+  +ACGTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 122 KGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
            G DA++H++DL+K+D P +S  DSHHDDIT IKFH SD +VLLSGSTDGY N+YDL Q+
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 182 EEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRA 241
           EE+++LHQVINF SIHSCGW++PKRI+ LSHMETF+IHELN+KSDEL EP+PL+FGDIR 
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 242 AWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFI 301
            W CDYVVDI+PG + TG + E+    L+L+P   E V   N+I IP AHGDEV+RD  I
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQEQSM--LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298

Query: 302 PEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL 344
            +  SE+ YS GEDG + +W++N G LNVP +FWNY   +NVL
Sbjct: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  421 bits (1081), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 256/346 (73%), Gaps = 1/346 (0%)

Query: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60
           M+  S + +  FGS+NWC  +QP Y   +LTSLSNGEVH +DW + KS+   ++  ++IN
Sbjct: 1   MASYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSIN 60

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            L+I++++++  + +  AS  +V + DVRS   + ++ N+  APFLSLDSR+  +ACGTE
Sbjct: 61  KLKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTE 120

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           L GVDA+LHI+D+R    P +S VDSHHDD+T I+FHPSD NVLLSGSTDGYTN+YDL Q
Sbjct: 121 LSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ 180

Query: 181 EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIR 240
           +EEDD+LHQVIN+ SIHSCGW++PKRI+TLSHMET A+HELN+KSDEL EPQPLDFGDIR
Sbjct: 181 QEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIR 240

Query: 241 AAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVF 300
             WGC YVVD+YPGYVA G S E     LKL+ L+ E +  + ++ IPSAHG+EV+RDV 
Sbjct: 241 EKWGCSYVVDLYPGYVAVGSSQERSSF-LKLMALENEQIETEKSLVIPSAHGEEVVRDVL 299

Query: 301 IPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE 346
           IP QN  ++YSCGEDG + IW+      ++   FW+Y   M+V  E
Sbjct: 300 IPPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSE 345

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/350 (58%), Positives = 264/350 (75%), Gaps = 8/350 (2%)

Query: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71
           FG++NWC +++PLY  G+L S SNG V+L+DW S   I KF+  ET IN+L+++N D+ N
Sbjct: 11  FGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFEN 70

Query: 72  ETRFITASMHAVKLFDVRS-NACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
              F   S+ +VK++DVR+ ++ + TI N+  + FLSL+SR+D + CGTEL GVDA++ I
Sbjct: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFI 130

Query: 131 FDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQV 190
           +D+R    P ++ VDSHHDDIT IKFHPSD N+LLSGSTDGYTNIYDL+QE+ED++LHQV
Sbjct: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQV 190

Query: 191 INFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVD 250
           IN+ SIHSCGW++PKRIYTLSHMETFAIHELN+KSDELTEP+PLDFGDIR  W CDYVVD
Sbjct: 191 INYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWDCDYVVD 250

Query: 251 IYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQN----S 306
           +YPGYVA GKS E   GELK+   + E +  +N I IP+AHGDEVIRDVFIP  N    S
Sbjct: 251 LYPGYVAMGKSAENA-GELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHS 309

Query: 307 EVVYSCGEDGYLNIWR--NNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQ 354
           +++YSCGEDG +NIW     S  LNV + FWN    ++VL +  +   G+
Sbjct: 310 DIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGR 359

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  416 bits (1069), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 187/335 (55%), Positives = 250/335 (74%), Gaps = 1/335 (0%)

Query: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71
           FG++NWC +++PLY+AG+L +LSNG VHL+DW + KS+    + E++IN LQ++++    
Sbjct: 11  FGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDR 70

Query: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131
            T F TA+   VKLFD+R+  C+ T+ +  GAP LSLDSR+  +A GTEL GVDA + +F
Sbjct: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLF 130

Query: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191
            L +   P ++ VDSHHDD+T +KFHP+D N+LLSGSTDGY N+YDL Q EED++LHQVI
Sbjct: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVI 190

Query: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251
           NF SIHSCGW++PKRI++LSHMETFAIHELN+KS+   EPQP  FGD+R  W CDYVVD+
Sbjct: 191 NFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDV 250

Query: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVYS 311
           YPG++A G S  E  GEL+L+PL+ E V   N I +P AHGDEV+RDV +P  + E++YS
Sbjct: 251 YPGFIAAG-STRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPASSPELLYS 309

Query: 312 CGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE 346
            GEDG + IW++  GPLNVP  FW+Y     VL++
Sbjct: 310 AGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  395 bits (1015), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 196/359 (54%), Positives = 259/359 (72%), Gaps = 13/359 (3%)

Query: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           S  GS  FGS NWC ++QP++  GILTS+S+GEVHL+    +K  + FK  ET+INAL  
Sbjct: 3   SLAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLDLSKQ-DSFKVGETSINALSR 60

Query: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           V+     E  F  ++ + VK+FD+R N  + T+  E GA  LSL S +  +A G+E +GV
Sbjct: 61  VDG---QENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGV 117

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           DA LH+FD+R    P +S VDSH DDITSI FHP+D NVLLSGSTDGYTN+YDL + EE+
Sbjct: 118 DAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEEE 177

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244
           D+LHQVIN+ SIHSCGW+ P+RI+TLSHMETFAIHELN+KS+EL EPQPLDFGDIR  W 
Sbjct: 178 DALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPWD 237

Query: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304
           C+YVVDIYPGY++ G S EEGKG L++IP + E+V   +TI+I  AHGDE++RD +I   
Sbjct: 238 CNYVVDIYPGYISAGVS-EEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQPPISLQSEP 363
            S+++YSCGEDG +  WRN+   L++PE FW+Y   M++L + +      P + L+ +P
Sbjct: 297 QSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSDEV------PEVQLEKQP 348

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 71/134 (52%), Gaps = 20/134 (14%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL---- 178
           G D+Q+ ++DLRK + P  S+   HHD +TS++F P    +L SGS+D    I+DL    
Sbjct: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326

Query: 179 ---SQEEEDDSLHQVINFTSIH-------SCGWVNPKRIYTLSHMETFAIHELNNKSDEL 228
               QE+ DD + +++   + H       SC   +P   + ++ +E   + ++   S +L
Sbjct: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKL 383

Query: 229 TEPQ-PLDFGDIRA 241
           T P  P D+ +IR+
Sbjct: 384 TSPYIPRDY-NIRS 396

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 87/199 (43%), Gaps = 14/199 (7%)

Query: 7   IGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIV 65
           I S+ +  EN +     P     +L++  +G V L  W    + NK  S    ++   + 
Sbjct: 162 IASFSYHKENGYGLAFNPTVSGQLLSASDDGTVAL--WDVTSTANKSPSQTFDVHTDIVN 219

Query: 66  NTDWH--NETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
           +  WH    + F T S  + + + D  S+  I  +        L+   R + +       
Sbjct: 220 DCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA--- 276

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL---- 178
           G D+ ++++DLR+L  P  S+   H D +TS++F P    +L S  +D    ++DL    
Sbjct: 277 GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIG 335

Query: 179 SQEEEDDSLHQVINFTSIH 197
           ++++ DD+   V     +H
Sbjct: 336 AEQQPDDAYDGVPELFMMH 354

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 84/181 (46%), Gaps = 15/181 (8%)

Query: 7   IGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMD--WKSNKSINKFKSDETAINALQ 63
           + ++ F +EN +     P  K  +L+   +  + L D   KS + I  F    + I    
Sbjct: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI---- 202

Query: 64  IVNTDWHNETRFITASMH---AVKLFDVR-SNACIGTIHNEVGAPFLSLDSRYDKIACGT 119
           + +  WHN  + I  S+     ++L D R  +A +  +  +     L+  +    +    
Sbjct: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262

Query: 120 ELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
              G D+ ++++D R+   P   ++  H D +TS++FHP +  VL+S  +D  T ++DL+
Sbjct: 263 ---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318

Query: 180 Q 180
           +
Sbjct: 319 E 319

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 7/120 (5%)

Query: 64  IVNTDWHNETRFITASMH---AVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
           I +  WH+    I  S+     +KLFD RS+  I  I+ +     L+       +     
Sbjct: 230 INDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAAA- 288

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
             G D  ++++D+R + NP  ++   H D +T+I+F P++  +L S  +D  T ++DL +
Sbjct: 289 --GTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE 345

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 86/189 (45%), Gaps = 19/189 (10%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMD-----WKSNKSINKFKSDETAINALQIVNTD 68
           E +     PL K G +LT   +G+V+L       W ++K    F S+  +I  +Q   T+
Sbjct: 278 EGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTF-SNNKSIEDIQWSRTE 336

Query: 69  WHNETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
               T F T+     ++++D RS      I     A  +++ S  +KI         D +
Sbjct: 337 ---STVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGR 393

Query: 128 LHIFDLRKLDNPWKS-------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
             ++DLR+L +P  S         D H   ITSI F+P D +++   S D    ++DLS 
Sbjct: 394 WGVWDLRQL-SPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSV 452

Query: 181 EEEDDSLHQ 189
           E +D+ + Q
Sbjct: 453 EADDEEIKQ 461

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 84/187 (44%), Gaps = 16/187 (8%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN-- 71
           E +     PL K G +LT   +G V+L    ++K +   K+  T  N   I +  W    
Sbjct: 281 EGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTD-KTPFTVGNNKSIEDIQWSRTE 339

Query: 72  ETRFITASMHA-VKLFDVRSNA---CIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
            T F TA     ++++D RS      I T+ +      +S + +   +    + KG    
Sbjct: 340 STVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT--- 396

Query: 128 LHIFDLRKLD-NPWKSL----VDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
             I+DLR+   N  K+L     D H   ITSI F+P D +++   S D    ++DLS E 
Sbjct: 397 WGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEA 456

Query: 183 EDDSLHQ 189
           +D+ + Q
Sbjct: 457 DDEEIKQ 463

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 83/179 (46%), Gaps = 16/179 (8%)

Query: 23  PLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN--ETRFITAS 79
           PL K+G +LT   +GE+ L    ++K I + +S     N   I +  W    +T F TA 
Sbjct: 299 PLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVG-NNKSIEDIQWSKTEQTVFATAG 357

Query: 80  MHA-VKLFDVRSNA---CIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRK 135
               ++++D RS      I T  + V    +S + + + +    + KGV     ++DLR+
Sbjct: 358 CDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGV---WGVWDLRQ 414

Query: 136 LDNPWK-----SLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQ 189
                +     +  D H   ITSI F+P D + +   S D    ++DLS E +D+ + Q
Sbjct: 415 FSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQ 473

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 10/184 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH--N 71
           E +     PL K G +LT   +G V L    S+K I   K   T  N   I +  W    
Sbjct: 286 EGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITD-KQPFTVDNNKSIEDIKWSPSE 344

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F T  +   V+++D+RS      +  +V    +++ S   KI+        +    +
Sbjct: 345 NTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGV 404

Query: 131 FDLRKLDNPWKSL-----VDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDD 185
           +DLR+  N    +      D H   ITSI F+P D +++   S D    ++DLS E +D+
Sbjct: 405 WDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDE 464

Query: 186 SLHQ 189
            + Q
Sbjct: 465 EIKQ 468

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 6/101 (5%)

Query: 115 IACGTELKGVDAQLHIFDLRKLDNPW----KSLVDSHHDDITSIKFHPSDCNVLLSGSTD 170
           I  G  L G D    +F  ++  + W    +     ++  I  IK+ PS+  V  +   D
Sbjct: 296 IKTGALLTG-DCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVD 354

Query: 171 GYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLS 211
           G+  I+D+  ++   +L   ++ T ++   W N K  Y L+
Sbjct: 355 GHVRIWDIRSKKHKPALSVKVSDTDVNVMSW-NQKISYLLA 394

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 87/183 (47%), Gaps = 19/183 (10%)

Query: 4   CSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKS--NKSINKFKSDETAINA 61
            + I   +     +     PL K  +L+   +  V L D  S  N+ + K+++  + I  
Sbjct: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-- 224

Query: 62  LQIVNTDWHN--ETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRY---DKI 115
             + +  WHN  ++ F T S   ++++ D R +  + TI+     PF +L   +   + +
Sbjct: 225 --VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING--TKPFNTLSFSHHSENLL 280

Query: 116 ACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNI 175
           A G    GV+++++++D R ++ P   L+  H D +TS+ F   D  ++LS   D    I
Sbjct: 281 ATG----GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335

Query: 176 YDL 178
           +D+
Sbjct: 336 WDI 338

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 77/176 (43%), Gaps = 25/176 (14%)

Query: 17  WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDW----HNE 72
           +     PL K  +L+S  +G V    W   KSI      ET+I    I +  W     N 
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSI----INDVRWNQFNQNL 226

Query: 73  TRFITASMHAVKLFDVRSN---ACIGTIHN-----EVGAPFLSLDSRYDKIACGTELKGV 124
             ++T S   + L DVR+N     I + H+        A   S  S Y   A G      
Sbjct: 227 FGYVTES-SCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE----- 280

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           D+ ++++D R L+ P   +   H D +TS+ FH  +  +++SG +D    ++DL Q
Sbjct: 281 DSLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 2   SQCSQIGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMD--WKSNKSINKFKSDETA 58
           S  S + +Y +  +N +     P+ K  +L++  +G + + D   +S   +  ++S +  
Sbjct: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198

Query: 59  INALQIVNTDWH--NETRFITAS--MHAVKLFDVRSNACIGTIHNEVGAPFLSLD-SRYD 113
           I    I +  WH  + T F T S   + + ++D+R+   + +I  E+  PF SL  S++ 
Sbjct: 199 I----INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHS 252

Query: 114 KIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYT 173
           K        G D  ++++DLR       S+   H   +T+++FH S   +L+S S D   
Sbjct: 253 KNLFSA--AGTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309

Query: 174 NIYDLSQ 180
            I+DL +
Sbjct: 310 IIWDLME 316

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +  + IFD    D+P K+    H D+   + F+P     LLS + DGY  +YD++ E ED
Sbjct: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 69  WH--NETRFITASMHA-VKLFDVRSNA-CIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
           WH  +E  F + S  + +KL D RS +  I TI  +     L+       +       G+
Sbjct: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAA---GL 263

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           D  ++++D R+   P   +   H D IT ++FHP +  +L+SG  D    ++DL++
Sbjct: 264 DTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 80/186 (43%), Gaps = 13/186 (6%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH--N 71
           E +     PL K G +LT   +G++ L    ++K I   K   TA N   + +  W    
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITD-KQPFTAANNQSVEDIQWSPTE 338

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F T+     V+++D RS      I        +++ S  +K+         +    +
Sbjct: 339 STVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGV 398

Query: 131 FDLRKLDNPWKS-------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +DLR+  +P  S         D H   ITSI F+P D +V+   S D    ++DLS E +
Sbjct: 399 WDLRQF-SPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEAD 457

Query: 184 DDSLHQ 189
           DD + Q
Sbjct: 458 DDEIQQ 463

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

Query: 90  SNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPW----KSLVD 145
           S   I TI N        LD     I  G  L G D    IF  ++  + W    +    
Sbjct: 266 SRKAIHTIRNHGNVEGYGLDWS-PLIKTGALLTG-DCSGQIFLTQRHTSKWITDKQPFTA 323

Query: 146 SHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNPK 205
           +++  +  I++ P++  V  +  TDGY  I+D   ++   ++    + T ++   W N K
Sbjct: 324 ANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW-NEK 382

Query: 206 RIYTLS 211
             Y L+
Sbjct: 383 LGYLLA 388

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 84/183 (45%), Gaps = 32/183 (17%)

Query: 17  WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKF-KSDETAINALQIVNTD------- 68
           W +Q Q L    + TS S+G+V + D      + K+ K+  T IN L +   D       
Sbjct: 201 WNWQRQGL----LATSYSHGQVCVWD------LEKYDKNSPTLINPLAMSTVDPRGSNEV 250

Query: 69  -W---HNETRFITASMHAVKLFDVRS----NACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            W   H+      +  + V + D+R+     +     H+  G      +   D + C  +
Sbjct: 251 SWMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSAD 310

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTD-GYTNIYDLS 179
             G   +++++D+R    P K+L+  H+D I+ ++++P +  VL +G  D G   I+DLS
Sbjct: 311 SAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLS 365

Query: 180 QEE 182
           Q E
Sbjct: 366 QPE 368

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 10/184 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN-- 71
           E +     PL ++G +LT   +G+V+     ++K +   K   T  N   I +  W    
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTD-KQPFTVSNNKSIEDIQWSRTE 338

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F TA     ++++D RS      I  +     +++ S  +K+         +    +
Sbjct: 339 ATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGV 398

Query: 131 FDLRKLDNPWK-----SLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDD 185
           +DLR+     +     +  D H   ITSI FHP+D +++   S D    ++DLS E +D+
Sbjct: 399 WDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDE 458

Query: 186 SLHQ 189
            + Q
Sbjct: 459 EIKQ 462

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 18/184 (9%)

Query: 18  CFQI--QPLYKAGILTSLSNGEVHLMDWKS-----NKSINKFKSDETAINALQIVNTDWH 70
           C  I   P  +  +L+  SNG +HL D++      N+ IN    D T  + L      W 
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWD-TNFDDLGCNEVTWM 256

Query: 71  NETRFITASM---HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
           N    I A+    + + +FD R    + +I  E G     ++S          L   D+ 
Sbjct: 257 NGHNSIFATCGENNKMAVFDTRKEGIVNSI--EQGNHNGGINSCKFNYENAMLLASGDSN 314

Query: 128 --LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGST-DGYTNIYDLSQEEED 184
             ++++D+RKL+ P ++L   H   I++I++ P    ++ SG   DG   ++D+S EEE 
Sbjct: 315 GIINLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISNEEEP 372

Query: 185 DSLH 188
             +H
Sbjct: 373 IFIH 376

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 20/157 (12%)

Query: 58  AINALQIVN-TDWH--NETRFITASM-HAVKLFDVRS---NACIGTIHNEVGAPFLSLDS 110
            +N   IVN + WH  +E  F T S    +++ D RS   +A +  +   + A   S  S
Sbjct: 200 VMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHS 259

Query: 111 RYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTD 170
           +    A GT     D +++++DLR+L  P  ++   H D +TSI+F      +L S  +D
Sbjct: 260 KNLIAAAGT-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSD 313

Query: 171 GYTNIYDLS-------QEEEDDSLHQVINFTSIHSCG 200
               I+DL+       QE+ DD + +++   + H   
Sbjct: 314 RRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           GVD+Q++++D+R + +P   ++  H D +T+++F P    ++ S  +D    I+DL+Q
Sbjct: 293 GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (43%), Gaps = 11/185 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN-- 71
           E +     PL K G +L+   +G+++L    +++ +   K   T  N   I +  W    
Sbjct: 274 EGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTD-KQSFTVSNNESIEDIQWSRTE 332

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F TA+    ++++D RS      I  +     +++ S  DKI         +    +
Sbjct: 333 STVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGV 392

Query: 131 FDLRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+        V      D H   ITSI F+P D +++  GS D    ++DLS E +D
Sbjct: 393 WDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 452

Query: 185 DSLHQ 189
           + + Q
Sbjct: 453 EEIKQ 457

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 10/127 (7%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH     I +    + +KL+D RS  CI TI   +G     + +++     G  L
Sbjct: 212 VRSCDWHPTMGLIASGSKDNLIKLWDPRSGQCISTI---LGCKHTIISTKFQPTK-GNML 267

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R+  N  +  V     D  S+ +HP + ++   G  DG    +DL 
Sbjct: 268 AVISKDKSCRVFDIRQ--NMKELAVYRDESDYMSLTWHPINESIFTVGCYDGSMKHFDLM 325

Query: 180 QEEEDDS 186
           QE +D S
Sbjct: 326 QEPQDSS 332

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 11/185 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNET 73
           E +     PL K G +LT   +G+++     ++K I   K   T  N   I +  W    
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITD-KQPFTVANNQSIEDIQWSRTE 333

Query: 74  RFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
             + AS      ++++D RS      I  +     +++ S  +K+         +    +
Sbjct: 334 STVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGV 393

Query: 131 FDLRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+        V      D H   ITSI F+P D +++  GS D    ++DLS E +D
Sbjct: 394 WDLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADD 453

Query: 185 DSLHQ 189
           + + Q
Sbjct: 454 EEIKQ 458

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 10/127 (7%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH     I +    + VKL+D R+  CI TI   +G     + +++     G  L
Sbjct: 212 VRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTI---LGCKHTIISTKFQPTK-GNML 267

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    IFD+R+  N  +  V     D  S+ +HP + ++   G  DG    +DL 
Sbjct: 268 AVISKDKSCRIFDIRQ--NMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLL 325

Query: 180 QEEEDDS 186
           QE +D S
Sbjct: 326 QEPQDSS 332

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 13/186 (6%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNET 73
           E +     PL K G +LT   +G+V+L    ++K I+  K   T  N   + +  W    
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISD-KEPFTVANNQSVEDIQWSRTE 342

Query: 74  RFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
             + AS      ++++D RS      I  +     +++ S  +KI         +    +
Sbjct: 343 STVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGV 402

Query: 131 FDLRKLDNPWKS-------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +DLR+  +P  S         D H   ITSI F+P D +++   S D    ++DLS E +
Sbjct: 403 WDLRQF-SPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEAD 461

Query: 184 DDSLHQ 189
           D+ + Q
Sbjct: 462 DEEIKQ 467

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 87/196 (44%), Gaps = 13/196 (6%)

Query: 12  FGSEN-WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH 70
           F  EN +     PL +  +L+   +  V L D   N    +     + +++  + ++ WH
Sbjct: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWH 217

Query: 71  NETR--FITASMHAV-KLFDVR-SNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDA 126
           N  +  F T S  ++ K+ D+R  N   GT   +   PF +L   +          G D+
Sbjct: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTA--KCPEPFNTLAFSHHSSNL-LAAAGTDS 274

Query: 127 QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ----EE 182
            ++++DLR +  P   +   H D +T+++F P    V++S  +D    ++DL Q    + 
Sbjct: 275 HVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQT 333

Query: 183 EDDSLHQVINFTSIHS 198
            DD+   V     +H+
Sbjct: 334 PDDAEDGVPELIMVHA 349

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 90/189 (47%), Gaps = 27/189 (14%)

Query: 9   SYFFGSENWCFQIQPLYKAGILT-SLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNT 67
           +Y   S  W +Q     ++GIL  S S+G+V + D       NK +   T  +    V+ 
Sbjct: 189 NYEASSLAWNYQ-----RSGILAASYSDGDVKIWD---ITKYNKAQPQLTVPDLRWQVDK 240

Query: 68  DWHNETRFIT--ASMHAV-------KLFDVRSNACIGTIHNEV---GAPFLSLDSRYDKI 115
           +  NE  ++   +S+ AV        + D R+     T  +     G   +  +   D +
Sbjct: 241 EGANEVSWMVHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFL 300

Query: 116 ACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLS-GSTDGYTN 174
            C  + +G    L+I D+R+L++P K+   SH D +++I+++P    V+ S G  DG   
Sbjct: 301 LCSADSEGT---LNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVK 355

Query: 175 IYDLSQEEE 183
           I+DL+QE++
Sbjct: 356 IWDLAQEDD 364

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 88/188 (46%), Gaps = 20/188 (10%)

Query: 3   QCSQIGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINK--FKSDETAI 59
           Q + I +  F  EN +     P  K  +L+   +G + L D + N ++ K   K  ++  
Sbjct: 185 QSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH 244

Query: 60  NALQIVNTDWHNETRFITASMH---AVKLFDVR-SNACIGTIHNEVGAPFLSL----DSR 111
           N + + +  W+     + AS+     ++L D R  N  I +I  +   PF +L     S+
Sbjct: 245 NDI-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSI--KTTDPFNTLAFSKHSQ 301

Query: 112 YDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDG 171
           Y   A GT     D+ ++++D R L  P  S+ + H D IT+++F P    VL+S   D 
Sbjct: 302 YLMAAAGT-----DSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDR 355

Query: 172 YTNIYDLS 179
              ++D++
Sbjct: 356 RVIMWDIN 363

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 64/154 (41%), Gaps = 33/154 (21%)

Query: 147 HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED--------DSLHQVINFTSIHS 198
           H ++   + F+P+D   LLSGS DG   ++D+ +            DS+H  I    ++ 
Sbjct: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI----VND 250

Query: 199 CGW--VNPKRIYTLSHMETFAIHELNNK-----SDELTEP-QPLDFGD----IRAAWGCD 246
           C W   N     ++S   T  +H+   +     S + T+P   L F      + AA G D
Sbjct: 251 CKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTD 310

Query: 247 YVVDIY-------PGYVATGKSHEEGKGELKLIP 273
            +V +Y       P Y   G  HE+    L+  P
Sbjct: 311 SLVYLYDSRNLSVPLYSMNG--HEDSITNLEFSP 342

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 84/198 (42%), Gaps = 16/198 (8%)

Query: 11  FFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH 70
           F     +     PL K  +L+   +  V L D                +++  + ++ WH
Sbjct: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH 217

Query: 71  NETR--FITASMHAV-KLFDVRS-NACIGTIHNEVGAPF--LSLDSRYDKIACGTELKGV 124
           N  +  F T S  ++ K+ D+R+ N  I T   +   PF  L+       I       G+
Sbjct: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTA--KCPQPFNTLAFSHHSSNILAAA---GM 272

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ---- 180
           D+ ++++DLR +  P   +   H D +T+++F P    V++S  +D    ++DL Q    
Sbjct: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAE 331

Query: 181 EEEDDSLHQVINFTSIHS 198
           +  DD+   V     +H+
Sbjct: 332 QTPDDAEDGVPELIMVHA 349

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 87/189 (46%), Gaps = 19/189 (10%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINA-----LQIVNTD 68
           E +     PL K+G +LT   +G V+L    + +  +K+ +D+TA +A     ++ +   
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYL----TQRHTSKWITDKTAFSAGNNQSIEDIQFS 341

Query: 69  WHNETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
               T F +      ++++D RS      I  +  A  +++ S  +KI         +  
Sbjct: 342 RTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGS 401

Query: 128 LHIFDLRKLDNPWKSLVDS-------HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
             ++DLR+  +P  +   S       H   ITSI F+P D +++   S D   +++DLS 
Sbjct: 402 WGVWDLRQF-SPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSV 460

Query: 181 EEEDDSLHQ 189
           E +D+ + Q
Sbjct: 461 EADDEEIKQ 469

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 289 SAHGDEVIRDVFIPEQNSEVVYSCGEDGYLNIWRNNS 325
           SA  ++ I D+      + V  SCG DGY+ IW   S
Sbjct: 328 SAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRS 364

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 85  LFDVRSNACIGTIHNEVGAPFLSLD--SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKS 142
           ++D+RS   I T+      P   +D  S   ++A G    G D  ++++DLRKL+ P   
Sbjct: 334 VWDLRSGKNIVTLQGH-AKPVYCVDWSSNSHQLATG----GGDGVVNVWDLRKLEQPATK 388

Query: 143 LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
           L+ +H   ++S++F  +  +VL+SG  D   N+Y
Sbjct: 389 LL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 11/185 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN-- 71
           E +     PL K G +L+   +G+++     +++ +   K   T  N   I +  W    
Sbjct: 275 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQWSRTE 333

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F TA     ++++D RS      I  +     +++ S  DKI         +    +
Sbjct: 334 STVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGV 393

Query: 131 FDLRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+        V      D H   ITSI F+P D +++  GS D    ++DLS E +D
Sbjct: 394 WDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 453

Query: 185 DSLHQ 189
           + + Q
Sbjct: 454 EEIKQ 458

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 26/191 (13%)

Query: 69  WH--NETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLD-SRYDKIACGTELKGV 124
           WH  NE  F + S    +++ D R+N+ +  +   + +PF +LD S++ +        G 
Sbjct: 214 WHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLFAA--AGT 269

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL----SQ 180
           D+ ++++DLR   +   ++   H D +TS++F P    +L S  +D    ++DL    S+
Sbjct: 270 DSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSE 328

Query: 181 EEEDDSLHQVINFTSIH----------SCGWVNPKRIYTLSHMETFAIHELNNKSDELTE 230
           + ++D+   V     +H          S  W  P   + ++ +E   I  +   S +LT 
Sbjct: 329 QAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP---WLMASVEEDNIVHVWKVSKKLTS 385

Query: 231 PQPLDFGDIRA 241
           P  +   DIR+
Sbjct: 386 PGLIQDYDIRS 396

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 11/185 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN-- 71
           E +     PL K G +L+   +G+++     +++ +   K   T  N   I +  W    
Sbjct: 273 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQWSRTE 331

Query: 72  ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F TA     ++++D RS      I  +     +++ S  DKI         +    +
Sbjct: 332 STVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGV 391

Query: 131 FDLRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+        V      D H   ITSI F+P D +++  GS D    ++DLS E +D
Sbjct: 392 WDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 451

Query: 185 DSLHQ 189
           + + Q
Sbjct: 452 EEIKQ 456

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 79/185 (42%), Gaps = 11/185 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNE- 72
           E +     PL K G +L+   +G+V+     +++ +   K   T  N   I +  W    
Sbjct: 273 EGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTD-KQPFTVSNNKSIEDIQWSRSE 331

Query: 73  -TRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
            T F TA     ++++D RS      I  +     +++ S  DKI         +    +
Sbjct: 332 STVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGV 391

Query: 131 FDLRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+        V      D H   ITSI F+P D +++  GS D    ++DLS E +D
Sbjct: 392 WDLRQFTPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 451

Query: 185 DSLHQ 189
           + + Q
Sbjct: 452 EEIKQ 456

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 84/188 (44%), Gaps = 17/188 (9%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINA-----LQIVNTD 68
           E +     PL K+G +LT   +G V+L    + +  +K+ +D+TA +A     ++ +   
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYL----TQRHTSKWITDKTAFSAGNNQSIEDIQFS 342

Query: 69  WHNETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
               T F T      ++++D RS      I  +  +  +++ S  +KI         +  
Sbjct: 343 RTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGT 402

Query: 128 LHIFDLRKLDNPWKSLVDS------HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
             ++DLR+      + V        H   ITSI F+P D +++   S D    ++DLS E
Sbjct: 403 WGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVE 462

Query: 182 EEDDSLHQ 189
            +D+ + Q
Sbjct: 463 ADDEEIKQ 470

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 2   SQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINA 61
           ++  + G+Y  G+E         Y + + T   +G V L D +  K +   +     I +
Sbjct: 478 TRSGKNGTYLLGTEAPMIGALQCYNSALATGTKDGVVRLWDLRIGKPVRSLEGHTDGITS 537

Query: 62  LQIVNTDWHNETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
           L+       +  + +T SM ++V+++D+R+++ +  I  ++  P  SLD     I  G  
Sbjct: 538 LKF------DSEKLVTGSMDNSVRIWDLRTSSIVDVIAYDL--PVTSLDFDDKLITVGAN 589

Query: 121 LKGVDAQLHIFDLRKLDNPW 140
            +GV+    IF++ + D  W
Sbjct: 590 ERGVN----IFNMER-DEHW 604

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 59/132 (44%), Gaps = 11/132 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH     I +    + +KL+D RS  CI TI   +G     + +++     G  L
Sbjct: 210 VKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTI---LGFKHTIIKTKFQPTK-GNLL 265

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             V  D    IFD+R+     KS  D    D  S+ +HP + ++   G  DG    +DL 
Sbjct: 266 AVVAKDKSCKIFDIRQNMKELKSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHFDLL 323

Query: 180 QEE-EDDSLHQV 190
           Q+    +S H +
Sbjct: 324 QDTGSSNSFHDI 335

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 81/190 (42%), Gaps = 11/190 (5%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNET 73
           E +     P+ K G +LT   +G+++     ++K I   K   TA N   + +  W    
Sbjct: 281 EGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITD-KQPFTAENNKSVEDIQWSRTE 339

Query: 74  RFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
             + AS      ++++D RS      +  +     +++ S  +KI         +    +
Sbjct: 340 STVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGV 399

Query: 131 FDLRKL------DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           +DLR+       D    +  D H   ITSI F+P D +++   S D    ++DLS E +D
Sbjct: 400 WDLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADD 459

Query: 185 DSLHQVINFT 194
           + + Q I  T
Sbjct: 460 EEIKQQIAET 469

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 86/188 (45%), Gaps = 17/188 (9%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAI---NALQIVNTDWH 70
           E +     PL K+G +L+   +G+++L    + +  +K+ +D+ A    N   I +  W 
Sbjct: 277 EGYGLDWSPLIKSGALLSGDCSGQIYL----TQRHTSKWVTDKQAYSVGNNKSIEDIQWS 332

Query: 71  N--ETRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
               T F TA     ++++D RS      I  +     +++ S  +KI         +  
Sbjct: 333 KTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGS 392

Query: 128 LHIFDLRKL--DNPWK----SLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
             ++DLR+   DN       +  + H   ITSI F+P + +++  GS D    ++DLS E
Sbjct: 393 WGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVE 452

Query: 182 EEDDSLHQ 189
            +D+ + Q
Sbjct: 453 ADDEEIKQ 460

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 8/123 (6%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYD-KIACGTE 120
           + + DWH +   I +    + +K +D RS +C+ T+   +G     + +++  K      
Sbjct: 210 VKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTM---LGFKHTIISTKFQPKQGNLLS 266

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           +   D    ++D+R+      S+ D    D  ++++HP D  V   G  DG    +DLSQ
Sbjct: 267 VISKDKTCKVYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQ 324

Query: 181 EEE 183
           E +
Sbjct: 325 ENQ 327

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 76/178 (42%), Gaps = 13/178 (7%)

Query: 23  PLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMH 81
           P+ K G +L+   +G+V L    ++K I   K   T  N   I +  W      + AS  
Sbjct: 295 PIIKTGAMLSGDCSGQVFLTQRHTSKWITD-KQAFTVANNKSIEDLQWSRTESTVFASCG 353

Query: 82  A---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDN 138
               ++++D RS      I  +     +++ S  +KI         D    ++DLR+   
Sbjct: 354 IDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQF-T 412

Query: 139 PWKSLVDS-------HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQ 189
           P  +   S       H   ITSI F+P D +++   S D    ++DLS E +D+ + Q
Sbjct: 413 PQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQ 470

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 123 GVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           G    + ++D+ K   +DNP  + +  H   I S+ F+ S  N+L+SG  DG   ++DL 
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLR 260

Query: 180 QEEE 183
             + 
Sbjct: 261 SSQR 264

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 104/252 (41%), Gaps = 28/252 (11%)

Query: 8   GSYFFGSENWCFQIQPLYKAGILTSLSN-GEVHLMDWKSNKSINKFKSDETAINALQ--I 64
           G Y +  EN       +   G L S S+ G + + D KS K++       T++N+L   I
Sbjct: 153 GKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSGKTV------PTSVNSLHSDI 206

Query: 65  VNT-DWHNETRFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
           VN   WH     I  S+     + + D RS   +  +  +     ++       +     
Sbjct: 207 VNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLLQKEPFNTIAFSKHSSNLFAAA- 265

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
             G DA +++FD RK      S+   H + +TS++F      +L SG +D    ++DL Q
Sbjct: 266 --GTDAMVYLFDSRKPTEALHSM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQ 322

Query: 181 -------EEEDDSLHQVINFTSIHSCGW----VNPKRIYTLSHMETFAIHELNNKSDELT 229
                  E+ DD   +++   + H         +P   + ++ +E   I ++   S +LT
Sbjct: 323 IGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWKPSRKLT 382

Query: 230 EPQPLDFGDIRA 241
            P      DIR+
Sbjct: 383 NPYFPQGYDIRS 394

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 9/68 (13%)

Query: 115 IACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTN 174
           +A GT+    D  + ++DLR  +   K +   H D ITS+KF   D N ++SGS DG T 
Sbjct: 594 LATGTK----DGIIRLWDLRSGEIARKLI--GHQDAITSLKF---DTNNIISGSLDGSTR 644

Query: 175 IYDLSQEE 182
           I+DL Q++
Sbjct: 645 IWDLRQDQ 652

>NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON}
           Anc_1.247
          Length = 718

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 67/162 (41%), Gaps = 26/162 (16%)

Query: 25  YKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASM-HAV 83
           + A ++T   +G V   D ++ K +   +   ++I  L+       +    IT S    V
Sbjct: 571 FDAAVVTGTKDGIVRFWDLRTGKVVRHLEGHTSSITCLKF------DSKNIITGSTDKTV 624

Query: 84  KLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSL 143
           +++D+R     G +      P LSLD   DKIA GT     D  + ++D R  D  W   
Sbjct: 625 RVWDIRMGTLAGLL--SFDTPVLSLDFDTDKIAIGT----YDESVKVYD-RHHDEQWACR 677

Query: 144 VDSHHDD---------ITSIKFHPSDCNVLLSGSTDGYTNIY 176
            D  + D         + +I++       L+ G TDG  N +
Sbjct: 678 EDYDNVDEAPAEISSKVETIRYKNG---YLVDGRTDGTINTW 716

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 17/188 (9%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDE---TAINALQIVNTDWH 70
           E +     PL K G ILT   +G V+L    + ++ +++ +D+   T  N   I +  W 
Sbjct: 286 EGYGLDWSPLIKTGSILTGDCSGRVYL----TQRTASRWVTDKQPFTVGNNKSIEDIQWS 341

Query: 71  NE--TRFITASMHA-VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQ 127
               T F T  +   ++++D RS      +   V    +++ S  +KI            
Sbjct: 342 RAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGT 401

Query: 128 LHIFDLRKL--DNPWKSL----VDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
             ++DLR+    N  K+      + H   ITSI F+P D +++   S D    ++DLS E
Sbjct: 402 WGVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVE 461

Query: 182 EEDDSLHQ 189
            +D+ + Q
Sbjct: 462 ADDEEIKQ 469

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 10/127 (7%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           I + DWH E   I ++   + VKL+D RS  CI TI   +      L +R+     G  L
Sbjct: 219 IKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTI---IKFKHTVLKTRFQPTR-GNLL 274

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++ ++P + ++   G+ DG    +DL 
Sbjct: 275 AAISKDKSCRVFDIRHSMKELMCVRD--EVDYMTLTWNPINESMFTVGNYDGAMKYFDLL 332

Query: 180 QEEEDDS 186
           Q+ E  S
Sbjct: 333 QDLEGPS 339

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 81/186 (43%), Gaps = 13/186 (6%)

Query: 15  ENWCFQIQPLYKAG-ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNET 73
           E +     PL K G +LT   +G+++L    ++K +   K   T  N   + +  W    
Sbjct: 280 EGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTD-KQPFTVGNNKSVEDIQWSRTE 338

Query: 74  RFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130
             + AS      V+++D RS      +  +     +++ S  +KI         +    +
Sbjct: 339 ATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGV 398

Query: 131 FDLRKL--DN-----PWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +DLR+   DN     P  +  D H   ITSI F+P + +++   S D    ++DLS E +
Sbjct: 399 WDLRQFTPDNINNVQP-VAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEAD 457

Query: 184 DDSLHQ 189
           D+ + Q
Sbjct: 458 DEEIKQ 463

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 123 GVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           G    + I+D+ K   L+ P  +++  H   I S+ F+ +  ++L+SGS DG   ++DL 
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDLR 244

Query: 180 QEE 182
             +
Sbjct: 245 SSQ 247

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 57/138 (41%), Gaps = 36/138 (26%)

Query: 72  ETRFITASMH---------AVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
           + RF+T S           +V++FD+RS A    I+    +P     S  +  A    LK
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPA----SGPNAGATTPSLK 347

Query: 123 GVDAQLH----------------------IFDLRKLDNPWKSLVDSHHDDITSIKFHPSD 160
           G DA L                       I D+R  ++P  +L + H   +  IK+HP+ 
Sbjct: 348 GSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNL-EGHTCSVNEIKWHPTK 406

Query: 161 CNVLLSGSTDGYTNIYDL 178
            NVLLS S D     +DL
Sbjct: 407 RNVLLSCSDDCQALYWDL 424

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 13/77 (16%)

Query: 105 FLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKS---LVDSHHDDITSIKFHPSDC 161
            +S D+  DKI  G             D+   D+ W S   LV +H  D+T++K  PS+ 
Sbjct: 104 LISCDASTDKIVIGDSGG---------DINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNA 154

Query: 162 NVLLSGSTDGYTNIYDL 178
            VLLSGSTD    ++ L
Sbjct: 155 -VLLSGSTDMQLKVWSL 170

>KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.405
           YER107C
          Length = 362

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 57/138 (41%), Gaps = 20/138 (14%)

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYD--KIACGTELKGVDAQLHIFDLRKLDNPW 140
           V+++DV+S    G    E  AP LS     D  K+A G    G D  + IFD+    +  
Sbjct: 58  VRIWDVQSGTAQGRSQYEHAAPVLSTRWSNDGTKVASG----GCDNAIKIFDVATGQSQQ 113

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCG 200
             L D+    +  +   P++  +L++GS D     +D  Q +   ++             
Sbjct: 114 LGLHDAPVKAVRFVNCGPTNTEMLVTGSWDKSIKYWDFRQPQPVSTV------------- 160

Query: 201 WVNPKRIYTLSHMETFAI 218
            + P R+Y + + +   +
Sbjct: 161 -IMPDRVYAMDNKQQLLV 177

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 64  IVN-TDWHN--ETRFITASMHAV-KLFDVRS-NACIGTIHNEVGAPFLSLDSRYDKIACG 118
           IVN   WHN  E  F T S  ++ K+ DVR+ N  I  +  +   PF +L   +   +  
Sbjct: 236 IVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAV--KCPQPFNTLAFSHHS-SNL 292

Query: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
               G+D+ ++++DLR +  P   +   H D +T+I+F      V++S  +D    ++DL
Sbjct: 293 LAAAGMDSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDL 351

Query: 179 SQ----EEEDDSLHQVINFTSIHS 198
            Q    +  DD+   V     +H+
Sbjct: 352 KQIGAEQTPDDAEDGVPELIMVHA 375

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 13/183 (7%)

Query: 16  NWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRF 75
           +W   IQ      +LT   +G+++     ++K +   K   T  N   I +  W      
Sbjct: 281 DWSPSIQ---TGALLTGDCSGQIYFTQRHTSKWVTD-KQPFTVSNNKSIEDIQWSRTEGT 336

Query: 76  ITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFD 132
           + AS      ++++D RS      I  +     +++ S  DK+         +    ++D
Sbjct: 337 VFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVWD 396

Query: 133 LRKLDNPWKSLV------DSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDS 186
           LR+      + V      D H   ITSI F+P D +++   S D    ++DLS E +D+ 
Sbjct: 397 LRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEE 456

Query: 187 LHQ 189
           + Q
Sbjct: 457 IKQ 459

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 27/139 (19%)

Query: 72  ETRFITASMH---------AVKLFDVRSNACIGTIHNEV---GAP----------FLSLD 109
           + RF+T S           +V++FD+R  A    I+      GAP           L L+
Sbjct: 259 DVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLE 318

Query: 110 -SRYDKIACGTELKGVDA-QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSG 167
            S +D     T    +D+ ++ I D+R   +P  +L ++H   I  IK+HP+  NVLLS 
Sbjct: 319 PSPFDPNVIAT--FAIDSSKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRNVLLSA 375

Query: 168 STDGYTNIYDLSQEEEDDS 186
           S D     +DL+   + +S
Sbjct: 376 SDDCQVLYWDLNTHLDSES 394

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 98  HNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFH 157
           H+  G      +   D + C  +  G   +++++D+R   +P +SL   HH  +++++++
Sbjct: 288 HHSNGVNACQFNYYKDLLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWN 342

Query: 158 PSDCNVLLS-GSTDGYTNIYDLSQ 180
           P    +L + G  DG   I+DLSQ
Sbjct: 343 PHHPTILATAGQDDGLVKIWDLSQ 366

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 68  DWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV- 124
           DWH E   I +    + VK +D RS  C+ TI N        L +R+     G  L G+ 
Sbjct: 216 DWHPEMGLIVSGSKDNLVKFWDPRSGQCVSTILN---FKHTVLRTRFQPTR-GNYLLGIS 271

Query: 125 -DAQLHIFDLRKLDNPWKSLVDSHHD-DITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
            D    +FD+R   N  K L+    + D  ++ +HP + +V    + DG    +D+ ++ 
Sbjct: 272 KDKSCRVFDIR---NHTKELLTVRDEVDFMTLSWHPINESVFTLANYDGSIKHFDILEDL 328

Query: 183 E 183
           E
Sbjct: 329 E 329

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 65  VNTDWHNETRFITASMHAVKL------FDVRSNACIGTIHNEVGAPFLSLDSRYDKIACG 118
           +NT  HN    I + +++V+L      F V+     G   N V   +  +D+  D+    
Sbjct: 42  LNTGEHNNFVQIGSKLYSVELDGRKYKFRVKE----GNYANVVQDRWTCIDA-VDQPTTQ 96

Query: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
             L   D  + +FD     +    + ++H D+IT +KF PS   VLLSGSTD    I+ L
Sbjct: 97  FALGDSDGNIRVFDSSP--SLQHHIREAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSL 153

Query: 179 SQE 181
           + E
Sbjct: 154 ADE 156

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 11/101 (10%)

Query: 82  AVKLFDVRSNACIGTIHNEVGAPF----LSLDSRYDKIACGTELKGVDAQLHIFDLRKLD 137
            ++L D R      T   +V APF     S  S+Y   A GT     D+ +++FD R + 
Sbjct: 242 TLQLHDQREKDTF-TSQFKVDAPFNTLAFSKHSQYLFAAAGT-----DSHVYLFDRRDIS 295

Query: 138 NPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
            P  S+   H   +T+++F P    +L++   D    I+D+
Sbjct: 296 RPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335

>Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON}
           (77284..78369) [1086 nt, 362 aa]
          Length = 361

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 12/105 (11%)

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYD--KIACGTELKGVDAQLHIFDLRKLDNPW 140
           V+++D++     G    E  AP L     +D  K+A G    G D  + ++DL    N  
Sbjct: 58  VRIWDIQGGNPQGKAQYEHSAPVLCTRWSFDGTKVASG----GCDNVVKVYDLNSGQN-- 111

Query: 141 KSLVDSHHDDITSIKF---HPSDCNVLLSGSTDGYTNIYDLSQEE 182
              V SH   + S++F    P++   L++GS D     +DL Q +
Sbjct: 112 -QQVGSHDSAVQSLRFVQCGPTNAECLVTGSWDKTLKYWDLRQPQ 155

>CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} similar
           to uniprot|P46680 Saccharomyces cerevisiae YMR092c AIP1
          Length = 610

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 73/148 (49%), Gaps = 18/148 (12%)

Query: 30  LTSLSNGEVHLMDWKSNKSINKFK-SDETAINALQIVNTDWHNETRFITASM-HAVKLFD 87
           +T  S+ ++   D KS + +   + +DE     L  V+  W +ETRF+TAS    V+++D
Sbjct: 223 VTVGSDRKIACFDGKSGEFVKYIEDADEPITGGLFAVS--WLDETRFVTASADQKVRVWD 280

Query: 88  VRSNACIGTIHN-EVGAPFLSLDSRYDKIACGTEL---KGVDAQLHIFDLRKLDNPWKSL 143
           VR + C   +H+  +G P      +   +A   +      +D  L+   + + D P +++
Sbjct: 281 VRESKC---LHSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTLNFLKIGE-DKPVRTM 336

Query: 144 VDSHHDDITSIKFHPSDCNVLLSGSTDG 171
              H+  IT++  +P     L++GS DG
Sbjct: 337 -HGHNKSITALAVNP-----LVTGSYDG 358

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 10/124 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + ++L+D RS  CI ++ N        L +R+     G  L
Sbjct: 211 VKSCDWHPEMGLIVSASKDNLIRLWDPRSGQCISSLLN---FKHTVLKTRFQPTK-GNLL 266

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R      + +V     D  ++++HP++  +    S DG    +D+ 
Sbjct: 267 TAISKDKSCRVFDIRHSMR--ELMVYRDEVDYMTLEWHPTNETMFTVASYDGSLKHFDIL 324

Query: 180 QEEE 183
           Q+ E
Sbjct: 325 QDLE 328

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 83/196 (42%), Gaps = 12/196 (6%)

Query: 11  FFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWH 70
           F     +      L K  +L+   +  V L +  S     K       +++  I +  WH
Sbjct: 158 FHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWH 217

Query: 71  NETR--FITASMHAV-KLFDVRSN-ACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDA 126
           N  +  F T S  ++ K+ DVR+N   I T+  +   PF +L   +          G+D+
Sbjct: 218 NFNKDLFGTVSEDSLLKINDVRANNTTIDTV--KCPQPFNTLAFSHHSSNL-LAAAGMDS 274

Query: 127 QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ----EE 182
            ++++DLR +  P   +   H D + +++F      V++S  +D    ++DL Q    + 
Sbjct: 275 YVYLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQT 333

Query: 183 EDDSLHQVINFTSIHS 198
            DD+   V     +H+
Sbjct: 334 PDDAEDGVPELIMVHA 349

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 123 GVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           G    + I+D+ +   +D P   ++  H   I S+ F+ +  ++L+SGS DG   ++DL 
Sbjct: 185 GTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDLR 244

Query: 180 QEE 182
             +
Sbjct: 245 SSQ 247

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 123 GVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           G    L I+D+ +   + +P  +    H   I S+ F+    N+++SG  DGY  ++DL
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDL 271

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 18/109 (16%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRK--LDN 138
           H+VK++D+     I T+H  + +       +Y  +  G    G DA L ++D+ K   D 
Sbjct: 420 HSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITG----GRDAVLKLWDIDKAMADE 475

Query: 139 PWKS---------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
              S           DSH D+IT+I F   D + L+SGS D     +DL
Sbjct: 476 ASNSSEDNDACLYTFDSHVDEITAISF---DGDNLVSGSQDRTVRQWDL 521

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 74/153 (48%), Gaps = 19/153 (12%)

Query: 61  ALQIVNTDWHNETRFI-TASMHAVKL-FDVRSNACIGTIHNEVGAPFLSLDSRYD--KIA 116
           + ++ +  +HN+   + TA + A+ L +D+RS   I ++      P  S+D   +  ++A
Sbjct: 305 SAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGH-SKPIYSVDWSQNGYQLA 363

Query: 117 CGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
            G+     D  + ++D+RK  N    L  +H+  ++ +KF+  +   L+S   D   NI+
Sbjct: 364 SGSG----DGTIKVWDIRKKGNVETIL--AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIF 417

Query: 177 D----LSQEEEDDSLHQVINFT----SIHSCGW 201
           +    + +   +  L +V++       I+S GW
Sbjct: 418 NDGNWIKERSLEGHLDKVMSIDIVGPDIYSAGW 450

>KLLA0F12694g Chr6 complement(1174812..1175954) [1143 bp, 380 aa]
           {ON} weakly similar to uniprot|Q6Q5U4 Saccharomyces
           cerevisiae YDR065W Hypothetical ORF
          Length = 380

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 55/147 (37%), Gaps = 28/147 (19%)

Query: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHE-------LNNKSDELTEPQPLDFG 237
           ++L Q +     H  GW     +  LSH+  + + +       L NK  E  EP P    
Sbjct: 41  NTLRQAVRRNRNHKAGWYVRGLLEDLSHLNKYIVGDDIIKLVALKNKYTEQIEPAPEPLQ 100

Query: 238 DIRAAWGCDYVVDIYPGYVATGKSHEEGKGELK--LIPLKGEN----------VVIDNTI 285
                           G V T    +E + E K  L P+ G+            +   T 
Sbjct: 101 QANKPIS---------GVVVTENMGDESRREKKKRLAPIPGDGDLYRYLLRYYKIYGPTK 151

Query: 286 SIPSAHGDEVIRDVFIPEQNSEVVYSC 312
           +IP  H DE++R + I E+  +++Y  
Sbjct: 152 TIPRKHIDELLRPLAIHERYCKILYRI 178

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
           G D+ +HI+D R   +  K  +   + D+ ++KF+ +D N ++SGS DG   +YDL  +
Sbjct: 254 GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDDGIIRLYDLRAD 309

>KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1541

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 17/179 (9%)

Query: 38   VHLMDWKSNKSINKFKSDE---TAINALQIVNTDWHNETRFITASMHAV-KLF-DVRSNA 92
            + L DW  NK +++F +     T I  L+ +N D  + T  +T S   + K+F D+ SN+
Sbjct: 1215 ITLFDWDENKMLSRFSNSNPFGTKITDLKFINED--DSTLLMTGSSDGIIKIFKDINSNS 1272

Query: 93   CIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDI- 151
             +  I    G   + L  R + +   TE   +   L      K+   W +  ++   DI 
Sbjct: 1273 SVELIAAWRGLTEMLLTPRSNGLL--TEWHQMRGALLATGDVKIIRIWDAHTETVEVDIP 1330

Query: 152  -------TSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVN 203
                   TS+       N+ ++G  DG   +YD   +  D  + +  + ++  +  W+N
Sbjct: 1331 AKTSSLVTSLTSDQLAGNIFVAGFADGTLRVYDRRIDARDSMVRRWRSASTGRANCWIN 1389

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 10/118 (8%)

Query: 68  DWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV- 124
           DWH     I ++   + VKL+D R+  C+ TI   +      L +R+ +   G  L G+ 
Sbjct: 215 DWHPTMGLIASASKDNLVKLWDPRTGNCVSTI---LKFKHTVLKTRF-QPGGGNLLLGIS 270

Query: 125 -DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
            D    +FD+R+  N  + +V     D  ++ +HP + +    G+ DG    +D+ Q+
Sbjct: 271 KDKSCRVFDIRQ--NMTELMVFRDDVDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQD 326

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 123 GVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           G    + I+D+ K   +DNP  + +  H   I S+ F+    ++L+SG  DG   I+DL
Sbjct: 197 GTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWDL 255

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 10/122 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + VKL+D RS  CI +I   +      L +R+  +  G  L
Sbjct: 222 VKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI---LKFKHTVLKTRFQPVK-GNLL 277

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++++HP + ++      DG    +DL 
Sbjct: 278 MAISKDKSCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGSLKHFDLL 335

Query: 180 QE 181
           Q+
Sbjct: 336 QD 337

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 56/113 (49%), Gaps = 11/113 (9%)

Query: 81  HAVKLFDVRSNACI-----GTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRK 135
           +++ + D R+   +      T H+  G      +   D + C  +  G   +++++D+R 
Sbjct: 273 NSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG---RVNLWDIRD 329

Query: 136 LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSG-STDGYTNIYDLSQEEEDDSL 187
           L+ P KSL   H   I+  +++P+   +L +   +DG   ++D++QE  ++ L
Sbjct: 330 LETPLKSL--DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGEELL 380

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 82  AVKLFDVRSNACIGTIHNEV---GAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDN 138
           ++ LFD R+   +  I N+    G      +   + +   T+  G   + +++D+RKL  
Sbjct: 273 SLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKLSA 329

Query: 139 PWKSLVDSHHDDITSIKFHPSDCNVLLS-GSTDGYTNIYDLSQEEEDDSL 187
                 D H   +++++++P D +VL + G +DG   I+D S E ED ++
Sbjct: 330 EPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTI 378

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 63/137 (45%), Gaps = 19/137 (13%)

Query: 81  HAVKLFDVRSNACIGTIH-NEVGAPFLSLDSRYDKIACG-----TELKGVDAQLHIFDLR 134
           H +KL+D+  +  IG +  ++     L +D  Y+ +         +L  VD  +  F+  
Sbjct: 388 HTIKLWDLTKSTQIGELKGHKATVNSLQMDLTYNMVISAGKDATVKLWNVDLGIESFNTE 447

Query: 135 KLDNPWKSLVDSHHDDITSI-KFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINF 193
           +  NP     DSH D+IT+I  +H +    L+SGS D     +DL    +     Q++N 
Sbjct: 448 RYFNPCIYTFDSHTDEITAISSYHEN----LVSGSRDKTIRQWDL----KTGKCIQILNI 499

Query: 194 TSIHS----CGWVNPKR 206
             ++S     G V+P R
Sbjct: 500 GFLNSQKELLGTVDPIR 516

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 20/120 (16%)

Query: 59  INALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACG 118
           +  L ++ T  +N+T+    S +        S + +G+    +GA    L      +A G
Sbjct: 459 VQQLDLIVTPTYNDTKVSARSAN-------NSTSVLGSEAPMIGA----LQCYNSALASG 507

Query: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           T+    D  + ++DLR +  P ++L + H D ITS+KF   D   L++GS D    I+DL
Sbjct: 508 TK----DGVVRLWDLR-IGKPVRAL-EGHTDGITSLKF---DSEKLVTGSMDNSVRIWDL 558

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 30/135 (22%)

Query: 72  ETRFITASMH---------AVKLFDVRSNACIGTIHNEVG--APFLSLD----------- 109
           + RF+T S           +V++FD+RS A    I+      AP L+ D           
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDA 351

Query: 110 ------SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNV 163
                 S YD     T       ++ I D+R  ++P  +L + H   +  IK+HP+  NV
Sbjct: 352 LLRLEPSPYDPNVLAT-FAAESNKIIILDMRNPESPILNL-EGHSSSVNEIKWHPTKRNV 409

Query: 164 LLSGSTDGYTNIYDL 178
           LLS   D     +DL
Sbjct: 410 LLSCGDDCQVLYWDL 424

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 128 LHIFDLRKLDNPWKSLVDS---HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           + I+D+ K +   K+L+ S   H   + S  F+  D N+L+SG  DG   I+DL     +
Sbjct: 205 ISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGSLN 264

Query: 185 DSLHQVINFT----SIHSCGWV 202
            S    IN      SI    W+
Sbjct: 265 GSTRSDININTASDSIRDVKWM 286

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 124 VDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +D Q+ ++D+R      K  V+ H   I  +K+H +D   L S   +GYT  +DL   + 
Sbjct: 316 IDNQVKVWDIRSTGA--KCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 184 DDSLHQVINFTS--------IHSCG--WVNPKRIYTLSHME 214
               H    F S        I  CG   V PK + T+S ++
Sbjct: 373 VSECHLATGFLSITEEKISEIKQCGNVVVAPKNLRTVSSIK 413

>Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C
           (AIP1) - actin cortical patch component [contig 55] FULL
          Length = 611

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (51%), Gaps = 27/116 (23%)

Query: 68  DW----HNETRFITASM-HAVKLFDVRSNACI------GTIHN-EVGAPFLSLDSRYDKI 115
           DW     N  +F+TAS   A++L+DV S AC+       T+ N +VG   +S D+ +  +
Sbjct: 254 DWVDEGENSKKFVTASADAAIRLWDVESGACLEKWSLEATLPNQQVGVAAIS-DTEFVSV 312

Query: 116 ACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDG 171
           +       +D  L+IF + +  +P +  ++ H+  IT++   P     L+SGS DG
Sbjct: 313 S-------LDGCLNIFKVGQ-KSPSRR-IEGHNKAITALAAGP-----LVSGSYDG 354

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 43/190 (22%)

Query: 149 DDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNPKRIY 208
           D+IT++KF+ ++ ++LLS  +D    +YDL     +    +++     +S  W NP    
Sbjct: 216 DNITAVKFNQNEADLLLSSGSDNSVVLYDL---RTNSPTQKIVQTMKTNSMCW-NP---- 267

Query: 209 TLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDIYPGYVATGKSHEEGKGE 268
               ME F     N       E Q   + D+R      +V           K H     +
Sbjct: 268 ----MEPFNFVTAN-------EDQNAYYYDMRNMSRALHVF----------KDHVSAIMD 306

Query: 269 LKLIPLKGENVVI---DNTI---SIPSAHGDEV-----IRDVFIPE--QNSEVVYSCGED 315
           + + P  GE +V    D TI   +I   H  EV     ++ VF  +   +S+ + S  +D
Sbjct: 307 VDISPT-GEEIVTGSYDKTIRIFNIKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDD 365

Query: 316 GYLNIWRNNS 325
           G + +WR+N+
Sbjct: 366 GNVRLWRSNA 375

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 22/121 (18%)

Query: 59  INALQIVNTDWHNETRFITASMHAVKLFDVRSNACI-GTIHNEVGAPFLSLDSRYDKIAC 117
           I  L ++ T  H++ +    S++        + AC+ GT    +GA    L      +A 
Sbjct: 457 IQQLDLIFTPTHSDIKMPARSLN--------NGACLLGTEAPMIGA----LQCYNSALAT 504

Query: 118 GTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
           GT+    D  + ++DLR +  P + L++ H D ITS+KF   D   L++GS D    I+D
Sbjct: 505 GTK----DGIVRLWDLR-VGKPVR-LLEGHTDGITSLKF---DSEKLVTGSMDNSVRIWD 555

Query: 178 L 178
           L
Sbjct: 556 L 556

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 21/128 (16%)

Query: 72  ETRFITASMH---------AVKLFDVRSNACIGTIH-------NEVGAPFLSLD---SRY 112
           + RF+T S           +V++FD+RS A    I+       N   + F  L    S +
Sbjct: 281 DVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPH 340

Query: 113 DKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGY 172
           D     T       ++ I D+R  ++P   +++ H   +  IK+HP   NVLLSG  D  
Sbjct: 341 DPNVMAT-FAADSNKILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDCQ 398

Query: 173 TNIYDLSQ 180
              +DL++
Sbjct: 399 VLYWDLNK 406

>KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.119
           YGL004C
          Length = 412

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           +  +H++   +L NP   + ++H  DITS+KF PS   ++LS STD    I+ L
Sbjct: 119 NGNIHLY--YELFNPLYKIEEAHFGDITSVKFFPSG-KLILSASTDMRMKIWSL 169

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + +KL+D RS  C+ T+ N        L +++     G  L
Sbjct: 215 VKSCDWHPEMGLIVSASKDNLIKLWDPRSGQCVSTLLN---FKHTVLKTKFQPTK-GNLL 270

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++ +HP++ ++    S DG    +D+ 
Sbjct: 271 AAISKDKSCRVFDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDIL 328

Query: 180 QEEEDDSLHQVINF 193
           Q  E+    QVI +
Sbjct: 329 QNLEEP--QQVIPY 340

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 56/129 (43%), Gaps = 24/129 (18%)

Query: 72  ETRFITASMH---------AVKLFDVRS----------NACIGTIHNEVGA---PFLSLD 109
           + RF++ S H         +V++FD+RS           A  GT+ N+V A     L L+
Sbjct: 295 DVRFLSQSTHLFASCGGDGSVRVFDLRSLAHSTIVYEPPAGEGTV-NDVTAQNNALLRLE 353

Query: 110 SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGST 169
                      L      + I D+R  ++P  +L   H   +  IK+HP+  NVLLS S 
Sbjct: 354 PSLMDPNIIATLVADSKDILILDMRNPESPALTL-KGHSSLVNQIKWHPTKRNVLLSCSD 412

Query: 170 DGYTNIYDL 178
           D     +DL
Sbjct: 413 DCQVLYWDL 421

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 128 LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           + I+DLR    P   L   H+  + SI F   + N ++S S DG    +DLS+EE+
Sbjct: 183 VFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 10/124 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I +    + VKL+D RS  C+ T+   +      L +R+     G  L
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTL---LKFKHTVLKTRFQPTK-GNLL 266

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FDLR   N    + D    D   +++   + ++   G  DG    +DL 
Sbjct: 267 AAISKDKSCRVFDLRASMNELMCVRD--EVDFMELEWSTINESMFTVGCYDGSLKHFDLG 324

Query: 180 QEEE 183
           Q+ E
Sbjct: 325 QDTE 328

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 66/152 (43%), Gaps = 19/152 (12%)

Query: 25  YKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASM-HAV 83
           + A + T   +G V L D +S   +   +    A+ AL+       + +  +TAS    V
Sbjct: 570 FDAALATGTKDGIVRLWDLRSGVPVRTLEGHTDAVTALKF------DSSSIVTASSDKQV 623

Query: 84  KLFDVRSNACIGTIHNEVG--APFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWK 141
           +++D+R+    GT+ N      P  SLD     I C T+     +   +F+  K++N   
Sbjct: 624 RIWDLRT----GTLSNAFALEKPITSLDFDSTSIICSTKT----SNFQVFN--KIENRHW 673

Query: 142 SLVDSHHDDITSIKFHPSDCNVLLSGSTDGYT 173
           +   +H  + +     PS+ N++     D YT
Sbjct: 674 NCGPTHDSEQSGTSNEPSESNIITIRVKDNYT 705

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 10/95 (10%)

Query: 135 KLDNPWKSLVDSHHDDITSIKFHP------SDCNVLLSGSTDGYTNIYDLSQEEEDDSLH 188
           K   PW   +  H   ITS+ + P       D   L S S DG   I+D S+      L+
Sbjct: 216 KAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRT---CLY 272

Query: 189 QVINFTSIHSC-GWVNPKRIYTLSHMETFAIHELN 222
            +   T+  SC  W     +YT SH +T  + ++ 
Sbjct: 273 TLSGHTNSVSCVKWGGQGLLYTGSHDKTIRVWDIK 307

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 24/122 (19%)

Query: 59  INALQIVNTDWHNETRFIT-ASMHAVKLFDVRSNACIGTIHNEVGAPFL-SLDSRYDKIA 116
           I  L ++    HN++R    +S ++ +L D               AP + +L      +A
Sbjct: 476 IQQLDLIFAPTHNDSRISAPSSNYSTRLLDT-------------DAPMIGALQCYKSALA 522

Query: 117 CGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
            GT+    D  + ++DLR +  P + L+  H D ITS+KF   D   L++GS D    I+
Sbjct: 523 TGTK----DGIVRLWDLR-VGKPVR-LLRGHTDGITSLKF---DSEKLVTGSMDNSVRIW 573

Query: 177 DL 178
           DL
Sbjct: 574 DL 575

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           G D   +I+D R      K  V     D+TSIKF   D N +++GS DG  N++DL
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVS--DSDVTSIKFF-KDGNSIITGSDDGIINMFDL 303

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 60/126 (47%), Gaps = 15/126 (11%)

Query: 68  DWHNETRFITASMH--AVKLF---DVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
           DW ++   I  ++    V+ F   + RS A +      V    ++ ++R   + C    K
Sbjct: 69  DWSHDNAIIAGALENGVVEFFAPEEPRSVAKLAQHTTPVKT--VTFNARQHNVLCSGGSK 126

Query: 123 GVDAQLHIFDLRKLDNP-WKSLVD----SHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
           G   +++I+D  K++ P +   V     +  D+I S+ ++ +  +V  S  + GY +I+D
Sbjct: 127 G---EIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWD 183

Query: 178 LSQEEE 183
           L  ++E
Sbjct: 184 LKAKKE 189

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 80/192 (41%), Gaps = 43/192 (22%)

Query: 18  CFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFK--SDETAINALQI----VNTDWHN 71
           C Q+   Y   + T   +  V L  W +N  I +++  ++  A++ L      V++ + +
Sbjct: 452 CMQVDKNYNM-VATGSKDATVKL--WNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYID 508

Query: 72  ETRFITASM-HAVKLFDVRSNACI-----------------------GTIHNEVGAPFLS 107
               +TAS    ++ +D+ S  CI                         I   V  P + 
Sbjct: 509 GANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIG 568

Query: 108 LDSRYDK-IACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLS 166
               +D  +A GT+    D  + ++D+R        +++ H D ITS+KF   D   ++S
Sbjct: 569 SIQSFDAALATGTK----DGLIRLWDMRT--GEVVRVLEGHMDAITSLKF---DATTIIS 619

Query: 167 GSTDGYTNIYDL 178
           GS DG   ++DL
Sbjct: 620 GSLDGTIRLWDL 631

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 22/128 (17%)

Query: 72  ETRFITASMH---------AVKLFDVRSNACIGTIHNEVGAPFLSLD-SRYDKIACGTEL 121
           + RF+T S           +V++FD+RS A    I+     P  + D S+        E 
Sbjct: 329 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEP 388

Query: 122 KGVDA-----------QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTD 170
              DA           ++ I D+R  ++P   +++ H   I  IK+HP+   +LLS S D
Sbjct: 389 SPTDANVIATFVSESNKILILDMRNSESP-VLVLEGHKSAINQIKWHPTKRYILLSCSDD 447

Query: 171 GYTNIYDL 178
                +DL
Sbjct: 448 CQVLYWDL 455

>AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL190C (CDC55)
          Length = 454

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP+ CN+L+  S+ G   + D+ Q
Sbjct: 233 ITSAEFHPTHCNLLMYSSSKGTIKLADMRQ 262

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + VKL+D RS  CI +I   +      L +R+     G  L
Sbjct: 224 VKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI---LKFKHTVLKTRFQPTK-GNLL 279

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++++HP + ++      DG    +DL 
Sbjct: 280 MAISKDKSCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLL 337

Query: 180 QE 181
           Q+
Sbjct: 338 QD 339

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + VKL+D RS  CI +I   +      L +R+     G  L
Sbjct: 222 VKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI---LKFKHTVLKTRFQPTK-GNLL 277

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++++HP + ++      DG    +DL 
Sbjct: 278 MAISKDKSCRVFDIRYSMRELMCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLL 335

Query: 180 QE 181
           Q+
Sbjct: 336 QD 337

>Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}
           similar to Ashbya gossypii AFR195W
          Length = 547

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP+ CN+L+  S+ G   + D+ Q
Sbjct: 326 ITSAEFHPTHCNLLMYSSSKGTIKLADMRQ 355

>KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa]
           {ON} similar to uniprot|P38123 Saccharomyces cerevisiae
           YBR175W SWD3 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 316

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 95  GTIHNEVG--APFLSLDSRYD-KIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDI 151
           G +H  VG  AP  SL   +   I C   +   D  + ++D+  L       + +H + +
Sbjct: 90  GELHRLVGHTAPVTSLKYTFKGNILCSCSM---DESIKVWDI--LTGTLLRTLSAHSEPV 144

Query: 152 TSIKFHPSDCNVLLSGSTDGYTNIYD 177
            SI   P D ++L SGS DG   I+D
Sbjct: 145 VSIDIPPFDPSILSSGSYDGLIRIFD 170

>Smik_16.428 Chr16 (739953..741455) [1503 bp, 500 aa] {ON} YPR169W
           (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 29  ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDV 88
           +L    +G++H+++ +S    N  +S     +   I++ D  +  +FI+     +  FDV
Sbjct: 201 VLIGDESGDIHVINSESLALTNSIRSIHFGDSINDILHFDKRSAYKFISLGQTTLAYFDV 260

Query: 89  R-SNACIGTIHNEVGAPFLSLDSRYDKIACG 118
           R  NA   T  NE G   +S D + D++ CG
Sbjct: 261 RDKNAKPNTAENEDGKILVS-DDQEDEVLCG 290

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 127 QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           ++ I D+R  ++P  +L + H   +  IK+HP+  NVLLS S D     +DL
Sbjct: 376 KIIILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 10/121 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + VKL+D RS  CI +I   +      L +R+     G  L
Sbjct: 222 VKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSI---LKFKHTVLKTRFQPTK-GNLL 277

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R        + D    D  ++++HP + ++      DG    +DL 
Sbjct: 278 MAISKDKSCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLL 335

Query: 180 Q 180
           Q
Sbjct: 336 Q 336

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 10/117 (8%)

Query: 69  WHNETRFITA--SMHAVKLFDVRSNACIGTIHNEVGA-PFLSLDSRYDKIACGTELKGVD 125
           +H +T  + A  S   +K++D+ S   + T +    A   L+ DS   ++  G+     D
Sbjct: 82  YHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGSN----D 137

Query: 126 AQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
           + + ++DL      +K  + SH D+IT I +   D N L+S S DG   ++DL  ++
Sbjct: 138 SDIIVWDLVSEVGLYK--LRSHKDNITGI-WCSDDENWLISTSKDGLIKVWDLKIQQ 191

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 128 LHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           + I+DL K   +DNP  + +  H   I S  F+  + N+L+SG  D    I+DL   +  
Sbjct: 235 ISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCVKIWDLRSNKPK 294

Query: 185 DSLHQVINFT----SIHSCGWV 202
            S    I+      SI    W+
Sbjct: 295 SSNRSDISINTASDSIRDVKWM 316

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 8/111 (7%)

Query: 75  FITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDA--QLHIFD 132
           F   S   V+LF  R+   I T        + S   R D    G  L   DA  ++ I+D
Sbjct: 55  FAITSSTRVQLFSSRTRQVIKTFSRFKDVVY-SASFRQD----GKLLAMGDATGRVSIYD 109

Query: 133 LRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
                    S+  S H    + KFHP+D   L++ S D    ++D++Q +E
Sbjct: 110 SYNPRTQLVSIAASSHPTHVA-KFHPADSRTLVTASDDRVVRVWDITQAQE 159

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 77/179 (43%), Gaps = 28/179 (15%)

Query: 26  KAGIL-TSLSNGEVHLMDWKSNKSINKFKSDETAIN--ALQIV-------NTDW---HNE 72
           KAGI+ +S SNG + + D      I +++  +  I+   L+I+       +  W   H+ 
Sbjct: 205 KAGIIASSYSNGLIKVWD------ITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSS 258

Query: 73  TRFITASMHAVKLFDVRSNACIGTIH---NEVGAPFLSLDSRYDKIACGTELKGVDAQLH 129
                   + + L D R+           +  G   L  +   D + C  +  G    + 
Sbjct: 259 ILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNG---GIA 315

Query: 130 IFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVL-LSGSTDGYTNIYDLSQEEEDDSL 187
           ++D R    P    V +H D +++++++P+   ++  +G  DG   I+D S+E ED  L
Sbjct: 316 LWDCRAFSKPLS--VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSREPEDSLL 372

>NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa]
           {ON} Anc_7.405 YER107C
          Length = 362

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/136 (19%), Positives = 53/136 (38%), Gaps = 16/136 (11%)

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKS 142
           V+++DV+     G    E   P LS  +R+          G D  + +FD+    +    
Sbjct: 59  VRIWDVQGGVAQGRSQYEHAGPVLS--TRWSNDGSKVASGGCDNIVKLFDVASGQSQQIG 116

Query: 143 LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWV 202
           + D+    +  +   PS+   L++GS D     +D+ Q +   ++              +
Sbjct: 117 MHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQAISTV--------------I 162

Query: 203 NPKRIYTLSHMETFAI 218
            P R+YT+   +   +
Sbjct: 163 MPDRVYTMDSKQQLLV 178

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 137 DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
           +N +   V+ H  D+TS++FHP + ++L SGS D   +++D
Sbjct: 480 NNGFLPRVNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWD 520

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 25/116 (21%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGA-PFLSLDSRYDKIACGTELKGVDAQLHIFDLR----- 134
           H VK++D+     IG +   +     + +D  Y+ +  G    G DA L +++L      
Sbjct: 419 HTVKIWDLSKQTQIGELAGHLATINCMQIDCDYETLVTG----GRDAALKLWNLNLAQQL 474

Query: 135 ------------KLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
                        +D+P     ++H D++T++   PS    L+SGS D     +DL
Sbjct: 475 YQETQNPTSFTSHIDSPCVYTFEAHTDEVTALSLDPS---FLVSGSQDRTIRQWDL 527

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 126 AQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDD 185
           A++H++D+ +L  P  +L     D+ITS+KF+ S+ ++L S  +D    +YDL       
Sbjct: 199 AKIHLWDVNRL-KPVSNL-SWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 186 SLHQVINFTSI 196
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 128 LHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           + I+DL K   LDNP  + +  H   I S  F+  + N+++SG  D    I+DL
Sbjct: 238 ISIYDLNKSSSLDNPLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDL 291

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 25/116 (21%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGA-PFLSLDSRYDKIACGTELKGVDAQLHIFDLR----- 134
           H VK++D+     IG +   +     + +D  Y  +  G    G DA L +++L      
Sbjct: 415 HTVKIWDLSKRKKIGELAGHLATINCMQIDRDYGTLVTG----GRDAALKLWNLNLAEQL 470

Query: 135 ------------KLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
                       ++D+P     ++H D++T++   P   N L+SGS D     +DL
Sbjct: 471 YQETQNLTCPASQIDSPCVFTFEAHIDEVTALSLDP---NFLVSGSQDRTIRQWDL 523

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 127 QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           ++ I D+R  D+P   +++ H   I  IK+HP+  N L+S S D     +D+S
Sbjct: 367 EILILDMRNPDSPLV-VLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDIS 418

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 66/134 (49%), Gaps = 18/134 (13%)

Query: 55  DETAINALQIVNTDWHNETRFITASMHA--VKLFDVRSNACIGTIHNEVGAPFLSLDSRY 112
           DE  I AL++       + R++  +  A  +K+FD+R    + ++  ++ +P   +DS  
Sbjct: 59  DEQDITALKLTA-----DGRYLCFASQAQLLKIFDLREGKIVRSM--KISSPSYVVDS-- 109

Query: 113 DKIACGTELKGVDAQLHIFDLRKLDNPWKS-LVDSHHDDITSIKFHP---SDCNVLLSGS 168
           D  +    + G D  + + D+   +N + +  +  H   I+S+KF+     +  +L SG 
Sbjct: 110 DSTSTLLAIGGTDGSITVVDV---ENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGD 166

Query: 169 TDGYTNIYDLSQEE 182
           T+G   I+DL + +
Sbjct: 167 TNGMVKIWDLVKRK 180

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 5/71 (7%)

Query: 144 VDSHHDDITSIKFHPSDCN-----VLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHS 198
           V  H   +  I FH S  N      L+SG  D   N +  + +++   L  +     + S
Sbjct: 185 VQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKKCTLLKTLPVSQQVES 244

Query: 199 CGWVNPKRIYT 209
           CG+ N + IYT
Sbjct: 245 CGFANSELIYT 255

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 138 NPWKSLVD----SHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           NP   LV     SH   +   KFHP+D   L++ S D    ++D++Q +E
Sbjct: 112 NPRAQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQE 159

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 10/124 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH +   I ++   + VKL+D RS  C+ T+   +      L +++     G  +
Sbjct: 210 VKSCDWHPQMGLIASASKDNLVKLWDPRSGQCVSTL---LKFKHTVLKTKFQPTQ-GNLM 265

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FDLR+     + +V     D  ++ +HP +  +      DG    +D+ 
Sbjct: 266 AAISKDKSCRVFDLRQSMK--ELMVTRDEVDYMTLLWHPINETMFTVACYDGSLKNFDIL 323

Query: 180 QEEE 183
           Q+ E
Sbjct: 324 QDTE 327

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 46/83 (55%), Gaps = 8/83 (9%)

Query: 106 LSLDSRYDKIACGTELKGVDAQLHIFDLRKLDN----PWKSLVD-SHHDDITSIKFHPSD 160
           L  +++ D + C  + +G   ++ I+D+ K+ +    P+   V  +  D++ S+ ++ S 
Sbjct: 110 LKFNAKQDNVLCSGDSRG---EIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAWNQSL 166

Query: 161 CNVLLSGSTDGYTNIYDLSQEEE 183
            +V  S  + GYT+I+DL  ++E
Sbjct: 167 AHVFASAGSSGYTSIWDLKAKKE 189

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 26/142 (18%)

Query: 38  VHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTI 97
           +HL D K     N+F S       L  +NT  H     I  S   ++++DV    CI T+
Sbjct: 462 IHLCDTK-----NEFTS-------LSWINTGSHIA---IGQSNGIIEIYDVTKRKCIRTL 506

Query: 98  --HNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIK 155
             H +  A  LS +S    +  G+  + +   LH  D+R + +P+   + SH  ++  +K
Sbjct: 507 SGHTDRTA-CLSWNSHI--LTSGSRDRTI---LH-RDVR-MKDPFFERIKSHTQEVCGLK 558

Query: 156 FHPSDCNVLLSGSTDGYTNIYD 177
           ++ SD N L+SG  D   NIYD
Sbjct: 559 WNESD-NKLVSGGNDNTVNIYD 579

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 10/118 (8%)

Query: 68  DWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV- 124
           DWH     I ++   + +KL+D RS  C+ TI   +      L +R+     G  L  + 
Sbjct: 214 DWHPTMGLIASASKDNLIKLWDPRSGNCVSTI---LKFKHTVLKTRFQPTK-GNLLVAIS 269

Query: 125 -DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
            D    +FD+R      + +V     D  ++ +HP + +V   G+ DG    +D+ Q+
Sbjct: 270 KDKSCRVFDIRHSMK--ELMVVRDEVDYMTLLWHPINESVFTVGNYDGSLKHFDILQD 325

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 128 LHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           + I+D+ K   +DNP  +    H   + S  F+ +  ++L+SG  DG   I+DL
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDL 261

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 69/161 (42%), Gaps = 35/161 (21%)

Query: 24  LYKAGILTSLSNGEV-HLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHA 82
           L K+  LT+ SNGEV HL D             E    +L  V +  H     +  S   
Sbjct: 282 LGKSIFLTNNSNGEVIHLCD------------TENEYTSLNWVGSGSH---LAVGQSNGI 326

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGT------ELKGVDAQLHIFDLRKL 136
           V++FDV    CI T+   +G          D++AC +           D  +   D+R  
Sbjct: 327 VEIFDVNKKKCIRTM---LG--------HSDRVACLSWNSYILTSGSRDHNILHRDVRSP 375

Query: 137 DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
           D P+   ++SH  ++  +K++  D N L+SG  D   N+YD
Sbjct: 376 D-PFFEKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYD 414

>TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1508

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 68/162 (41%), Gaps = 20/162 (12%)

Query: 67   TDWHNE--TRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124
            T+W     +  +T  +  ++++D  S +    I  +  +   S+ S  D++A  T + G 
Sbjct: 1269 TEWQQSKGSLLVTGDVKVIRVWDAHSESIEVDIPVKTSSLVTSITS--DQLAGDTVVCGF 1326

Query: 125  -DAQLHIFDLR-----KLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
             D  + ++D R      +   W+S     H  I  +         L SG+TDG   ++D+
Sbjct: 1327 SDGSIRVYDRRLNSRDAMVRLWRSNEGKKHYPINYVHLQRGGFRELASGTTDGTVELWDI 1386

Query: 179  SQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHE 220
              ++   S +       I S    +  RI T++ M+   +HE
Sbjct: 1387 RNQDPITSFN-------IGSSNQSSESRISTMTKMQ---LHE 1418

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 26/116 (22%)

Query: 81  HAVKLFDVRSNACIGTI---HNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLR--- 134
           H++KL+++     +G +   H  +    + LD++Y+ +  G    G DA L ++DL    
Sbjct: 437 HSIKLWNLSKKNQVGQMTGHHASINC--MQLDNQYNMLISG----GRDAVLKLWDLSLAY 490

Query: 135 ---KLDNPWKS--------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
              + D  + S          DSH D+IT++ F   D   L+SGS D     +DLS
Sbjct: 491 QLYQEDTEFASNSEEACVYTFDSHLDEITALSF---DSGHLVSGSQDRTLRQWDLS 543

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPW 140
           H VK +D+ ++ C+ T         L+       +ACG+  + +   LH F         
Sbjct: 298 HTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLHLLACGSSARHI--TLHDFRANSSSKIT 355

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           +  +  H + + S+   P +  +L+SGS DG   ++D+
Sbjct: 356 QQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDI 393

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
           G D  L+I+D R   +     V     D++ +KF   + N + +GS DG TN+YDL  + 
Sbjct: 281 GSDGYLYIWDKRVPTSVQSFFVS--DSDVSKVKFF-RNGNTIATGSDDGCTNLYDLRSD- 336

Query: 183 EDDSLHQVINFT---SIHSCGWVNPKRIYTLSHMETFA 217
                 ++ N++   SIH    V  ++ Y +S+M+  A
Sbjct: 337 -----CRIANYSLSRSIHGATPVQ-QQTYIMSNMDYTA 368

>NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa]
           {ON} Anc_8.585 YBR175W
          Length = 335

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 95  GTIHNEVG--APFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDIT 152
           G +H  VG  AP +SL   Y+          +D  + ++D+  L+      + +H + + 
Sbjct: 96  GPLHRLVGHTAPVVSL--CYNGKGNLLYSSSMDESIKVWDV--LNGILMKTISAHSESVV 151

Query: 153 SIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           S+   P D  VL SGS DG   ++D S 
Sbjct: 152 SVDICPEDSTVLSSGSFDGLIRLFDSSS 179

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 290 AHGDEVIRDVFIPEQNSEVVYSCGEDGYLNIW 321
           AH D +++  F+PE ++   +SCG+DG +  W
Sbjct: 607 AHSDSIMKVAFLPESHN--FFSCGKDGLVKYW 636

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 149 DDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWVNP 204
           D+I ++KF+ +D NVL S  +D    +YDL     + +  +++    ++S  W NP
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDL---RTNSATQKIVQTMRVNSMCW-NP 268

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 30/135 (22%)

Query: 72  ETRFITASMH---------AVKLFDVRS----------------NACIGTI--HNEVGAP 104
           + RF+T S           +V++FD+RS                 A  GTI   ++    
Sbjct: 292 DVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDA 351

Query: 105 FLSLD-SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNV 163
            L L+ S YD     T       ++ I D+R  ++P  +L   H   +  IK+HP+  NV
Sbjct: 352 LLRLEPSPYDPNVLAT-FAADSNKIIILDMRNPESPILNL-QGHGSSVNGIKWHPTKRNV 409

Query: 164 LLSGSTDGYTNIYDL 178
           LLS   D     +DL
Sbjct: 410 LLSCGDDCQVLYWDL 424

>NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {ON}
           Anc_8.150 YGL190C
          Length = 500

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS  FHP DCN+ +  S+ G   + D+ Q
Sbjct: 224 ITSAVFHPQDCNLFMYSSSKGTIKLCDMRQ 253

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYD--KIACGTELKGVDAQLHIFDLRKLDN 138
           +A  ++DVR+   I  +      P  S+D   D   IA G    G D  ++I+D+RK   
Sbjct: 339 NAAIVWDVRTGKSIMNLQGH-AKPIYSVDWSPDGYHIATG----GGDGVINIWDIRKTTE 393

Query: 139 PWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
             + L  +H++ +T ++F  S  + L+S   D    IY
Sbjct: 394 TTRLL--AHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 71/163 (43%), Gaps = 25/163 (15%)

Query: 63  QIVNTDWHNETRFITASMHAV--KLFDVRSNACIGTIHNEVGAPFLSLDSRYD-KIACGT 119
           ++VN D+H   RF+ ++   +  +L+D+ S   +       G    SL  + D  + C  
Sbjct: 277 RVVNVDFHPSGRFVASASFDMTWRLWDIESETEL-QFQEGHGKEVYSLSFQNDGALLCS- 334

Query: 120 ELKGVDAQLHIFDLRKLDNPWKSLVD--SHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
              G+D    ++D+R      KS+++   H   I S+ + P D   + +G  DG  NI+D
Sbjct: 335 --GGLDNAAIVWDVR----TGKSIMNLQGHAKPIYSVDWSP-DGYHIATGGGDGVINIWD 387

Query: 178 LSQEEEDDSLHQVINFTS-----------IHSCGWVNPKRIYT 209
           + +  E   L    N  +           + SCG+    RIY+
Sbjct: 388 IRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYS 430

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 4/64 (6%)

Query: 115 IACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTN 174
           I  GT L         F  +K+    K  +D H +  TS+ F P+  N+LLSG  D    
Sbjct: 126 IDVGTSLNKPPLSFKCFLPKKI----KYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVK 181

Query: 175 IYDL 178
           ++D 
Sbjct: 182 VWDF 185

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 123 GVDAQLHIFDLRKL---DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           G    + I+D+ +    D+P  + +  H   I S+ F+    ++L+SG  DG   ++DL
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDL 261

>TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.615
           YOR026W
          Length = 325

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 14/179 (7%)

Query: 25  YKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVK 84
           Y+  ++    NG +H++D  +N    K + D       +I     ++E   + A+ +   
Sbjct: 113 YRDKLICGSWNGSLHIIDCHTNSVDFKIQLD-----GRKIFKMSSNDEKLILYATNNTTL 167

Query: 85  LFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI--FDLRKLDNPWK- 141
            FD+        I  E G  F + D       CG     VD ++ +  FD       ++ 
Sbjct: 168 YFDLPLQKNSEGIKVESGLKFQTRDIALTPGGCGYVSSSVDGRVAVEYFDDESKKFAFRC 227

Query: 142 ---SLVDSHHD-DITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSI 196
              +L DS     + +I F P+  N+L +G +DG  + +++S + +   L + IN TSI
Sbjct: 228 HRMTLSDSQFVFPVNTICFIPNS-NILYTGGSDGCVSCWNISSKRKVGQLPK-INETSI 284

>ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 431

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 292 GDEVIRDVFIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL 344
           GD +   +  P  NS +  SCG DGY  +W   S   NV + F+  D  +N +
Sbjct: 228 GDVLSLSLPPPNTNSNLFASCGSDGYAFVWDTRS--TNVAQTFFISDSDVNAI 278

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 126 AQLHIFDLRKL----DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181
           A++H++D+ +L    D  W +      D+ITS+KF+ ++ ++L S  +D    +YDL   
Sbjct: 199 AKIHLWDVNRLKPVSDLSWGA------DNITSLKFNQNETDILASTGSDNSIVLYDLRTN 252

Query: 182 EEDDSLHQVINFTSI 196
                + Q +   +I
Sbjct: 253 SPTQKIVQTMRTNAI 267

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 12/76 (15%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLH 188
           HI+ LR        +   H  D+  + FHP+ C V  +GS+D    ++D+S     DS+ 
Sbjct: 622 HIYPLR--------IFAGHLSDVDCVSFHPNGCYV-FTGSSDKTCRMWDIST---GDSVR 669

Query: 189 QVINFTSIHSCGWVNP 204
             +  T+   C  V+P
Sbjct: 670 LFLGHTAPVLCTAVSP 685

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 12/113 (10%)

Query: 75  FITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLR 134
           F   S   V+LF  R+   I T        + +      K+ C  +  G+   + ++D  
Sbjct: 55  FAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSY 111

Query: 135 KLDNPWKSLVD----SHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
              NP   LV     +H   +T  KFH  D   L++ S D  T ++D+SQ  E
Sbjct: 112 ---NPRALLVSINASTHPTHVT--KFHSHDSKSLVTASDDRITRVWDISQSYE 159

>KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.119
           YGL004C
          Length = 409

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTD 170
           + + D+H  DITS+KF PS   VLLS STD
Sbjct: 134 REIEDAHASDITSLKFFPSG-EVLLSASTD 162

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
           YOL138C (REAL)
          Length = 1332

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 128 LHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           + I+DL K   ++NP  + +  H   I S  F+  + N+++SG  D    I+DL      
Sbjct: 236 ISIYDLNKSSSIENPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDLRSNTSK 295

Query: 185 DSLHQVINFT----SIHSCGWV 202
            S    IN      SI    W+
Sbjct: 296 SSNRADININTASDSIRDVKWM 317

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1311

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 119 TELKGVDAQLHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNI 175
           T +      + IFD+ +   ++NP  + +  H   + S  F+    N+++SG  DG   I
Sbjct: 189 TAICTTSTDISIFDISRNINIENPLLTSLSEHTRSVNSFDFNMVQSNLIISGGQDGCVKI 248

Query: 176 YDLSQEEEDDSLHQVINFT----SIHSCGWV 202
           +DL       S    I+F     SI    W+
Sbjct: 249 WDLRSNSIKGSSRCDISFNTGSDSIRDVKWM 279

>Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}
           YGL190C (REAL)
          Length = 529

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP +CN+ +  S+ G   + D+ Q
Sbjct: 236 ITSAEFHPQECNLFMYSSSKGTIKLCDMRQ 265

>Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}
           YGL190C (REAL)
          Length = 526

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP +CN+ +  S+ G   + D+ Q
Sbjct: 236 ITSAEFHPQECNLFMYSSSKGTIKLCDMRQ 265

>Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}
           YGL190C (REAL)
          Length = 526

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP +CN+ +  S+ G   + D+ Q
Sbjct: 236 ITSAEFHPQECNLFMYSSSKGTIKLCDMRQ 265

>YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}
           CDC55Non-essential regulatory subunit B of protein
           phosphatase 2A (PP2A); localization to the cytoplasm
           requires Zds1p and Zds2p and promotes mitotic entry;
           localization to the nucleus prevents mitotic exit;
           required for correct nuclear division and chromosome
           segregation in meiosis; maintains nucleolar
           sequestration of Cdc14p during early meiosis; limits
           formation of PP2A-Rts1p holocomplexes to ensure timely
           dissolution of sister chromosome cohesion
          Length = 526

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP +CN+ +  S+ G   + D+ Q
Sbjct: 236 ITSAEFHPQECNLFMYSSSKGTIKLCDMRQ 265

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLH 188
           HI+ LR        +   H +D+  + FHP+ C V  +GS+D    ++D+S     DS+ 
Sbjct: 600 HIYPLR--------IFAGHLNDVDCVSFHPNGCYV-FTGSSDKTCRMWDVST---GDSVR 647

Query: 189 QVINFTSIHSCGWVNP 204
             +  T+   C  V+P
Sbjct: 648 LFLGHTAPVICIAVSP 663

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/168 (19%), Positives = 69/168 (41%), Gaps = 10/168 (5%)

Query: 63  QIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
           Q++     N   +  +  H +K +D+ +  CI T         ++  S  + +ACG+  +
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSAR 351

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-- 180
            +   LH   +       +  +  H + ++S+   P +  +L SGS DG   ++D+    
Sbjct: 352 HI--TLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTS 409

Query: 181 -----EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNN 223
                  ED S+ + +N   + +  W     I +    +   I++ +N
Sbjct: 410 PMYTITREDKSVQKGVN-DKVFAVKWAEKVGIISAGQDKKIQINKGDN 456

>KAFR0G02760 Chr7 (571389..574763) [3375 bp, 1124 aa] {ON} Anc_7.163
           YER013W
          Length = 1124

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 118 GTELKGVDAQLHIFDL--RKLDNPWKSLVDSHHDDITSIKFHPS 159
           GTELK  D  +HI ++  R++ +P+  +V+     +  IK HP+
Sbjct: 205 GTELKKCDGLMHISEMSKRRISDPYDIVVEDQDVYVKVIKLHPN 248

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 149 DDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSI 196
           D+ITS+KF+ +D N+L S  +D    +YDL        + Q +   S+
Sbjct: 213 DNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNSL 260

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-- 180
           G    ++++D+R       S+   H + +TS++F      +L+SGS+D    ++DL +  
Sbjct: 261 GTTNNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIG 319

Query: 181 -----EEEDDSLHQVI 191
                +E DD L +V+
Sbjct: 320 AEQQPDEADDGLPEVM 335

>Kwal_47.17206 s47 complement(299680..300366) [687 bp, 228 aa] {ON}
           YGL190C (CDC55) - Protein phosphatase 2A regulatory
           subunit B [contig 212] PARTIAL
          Length = 228

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 8   ITSAEFHPQHCNLFMYSSSKGTIKLADMRQ 37

>ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON}
           NOHBY322; No homolog in Saccharomyces cerevisiae
          Length = 954

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 19/122 (15%)

Query: 106 LSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHD-DITSIKFHPSDCNVL 164
           LS D RY  +    EL G   ++ ++ L    N +   V   H   + ++KFHPSD  V 
Sbjct: 168 LSQDGRYMIVG---EL-GHKPRILVYSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVF 223

Query: 165 LSGS--TDGYTNIYDLSQEEEDDSLHQVI-----NFTSIHSCGWVNPKRI-YTLSHMETF 216
           +S     DG+ +++ L+      S + V+     N +S+    W N K I Y + H++ +
Sbjct: 224 MSLGQINDGFLHVWRLT------STNVVLLGTNKNISSVTDVLWCNSKFITYGVRHLKEW 277

Query: 217 AI 218
            I
Sbjct: 278 RI 279

>SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar to
           uniprot|P38123 Saccharomyces cerevisiae YBR175W SWD3
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 314

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 95  GTIHNEVG--APFLSLD-SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDI 151
           G +H  VG  AP LSL  +    + C   +   D  + I+D+  L       + +H + +
Sbjct: 88  GRLHRLVGHTAPVLSLVYTSKGNLLCSASM---DESIKIWDV--LTGTLLKTISAHSEPV 142

Query: 152 TSIKFHPSDCNVLLSGSTDGYTNIYD 177
            SI     D ++L SGS DG   I+D
Sbjct: 143 VSIDMPVCDPSILSSGSYDGLIRIFD 168

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLH 188
           HI+ LR        +   H +D+  + FHP+ C V  +GS+D    ++D+S     DS+ 
Sbjct: 602 HIYPLR--------IFAGHLNDVDCVSFHPNGCYV-FTGSSDKTCRMWDVST---GDSVR 649

Query: 189 QVINFTSIHSCGWVNP 204
             +  T+   C  V+P
Sbjct: 650 LFLGHTAPVICIAVSP 665

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 143 LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
           ++  H   +  + FHP   N+L S S D    I+D+SQEE
Sbjct: 147 MLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEE 186

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
           RTC1Subunit of the SEA (Seh1-associated) complex, a
           coatomer-related complex that associates dynamically
           with the vacuole; null mutation suppresses cdc13-1
           temperature sensitivity; has N-terminal WD-40 repeats
           and a C-terminal RING motif
          Length = 1341

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 128 LHIFDLRK---LDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           + I+DL K   +DNP  + +  H   I S  F+  + N+++SG  D    I+DL
Sbjct: 235 ISIYDLNKSSSIDNPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDL 288

>TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 124 VDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +D  L+  +  +LD    S+++     + +   HP   N+L++G++ G+ N Y L+    
Sbjct: 143 IDFSLNEPNFAQLDTGLDSIMEQDQRFVITSVVHPKYDNILVTGTSKGWINFYLLADSNS 202

Query: 184 DDSLHQ--VINFTSIHSCGWVNPKRIYTLSHMETFAIH 219
           ++++++  +I+   I +C   N K+I    + +  AI+
Sbjct: 203 NENVNETKLIHSVKIGNC---NIKQIIISENGDKLAIN 237

>Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii AFL014C
          Length = 569

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 62/139 (44%), Gaps = 6/139 (4%)

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            ++I + DW +    I A    +++ DVR    I     +  +    +  R D +   + 
Sbjct: 318 GVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIVNTWEKHTSEVCGIKFRQDGLQLAS- 376

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLS--GSTDGYTNIYDL 178
             G D  + I+D R+ D  W  +  +H+  + +I +HP   N+L +  GS D + + ++ 
Sbjct: 377 -GGNDNTVMIWDTRQDDPVW--VKRNHNAAVKAIAWHPDVLNLLATGGGSLDRHIHFWNT 433

Query: 179 SQEEEDDSLHQVINFTSIH 197
           +      S++     +S+H
Sbjct: 434 TTGARIGSINTGSQVSSLH 452

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 4/109 (3%)

Query: 75  FITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLR 134
           F   S   V++F  R+   I T        + +   +  K+ C  +  G+ +    ++ R
Sbjct: 55  FAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGLVSVYDSYNPR 114

Query: 135 KLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
            L     S+  S H    + KFH  D   L+S S D  T ++D+S   E
Sbjct: 115 TL---LVSVAASQHPTHVT-KFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
           D  + I+DLRK+D+     + +H + +T +KF   +   L+S S D   N++
Sbjct: 372 DGTIKIWDLRKVDDV--ETILAHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

>Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W
           (REAL)
          Length = 460

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/168 (19%), Positives = 68/168 (40%), Gaps = 10/168 (5%)

Query: 63  QIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
           Q++     N   +  +  H +K +D+ +  CI T         ++     + +ACG+  +
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRATSYSLLSIAQLPSLNLLACGSSAR 351

Query: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-- 180
            +   LH   L       +  +  H + ++S+   P +  +L SGS DG   ++D+    
Sbjct: 352 HI--TLHDPRLGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDIRSTA 409

Query: 181 -----EEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNN 223
                  ED S+ + +N   + +  W     I +    +   I++ +N
Sbjct: 410 PMYTITREDKSVQKGVN-DKVFAVQWAEKVGIISAGQDKKIQINKGDN 456

>NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa]
           {ON} Anc_3.259 YDR030C
          Length = 478

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 135 KLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           K+D+   +  +SHH  IT++K++  D  +  +GS D    I+D +Q
Sbjct: 160 KMDDLEAAQGESHHGGITTMKWYGEDNGMFFTGSNDKIIKIWDTNQ 205

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 95  GTIHNEVG--APFLSLD-SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDI 151
           G +H  VG  AP  S+  +    + C   +   D  + I+D+  L       + +H + +
Sbjct: 90  GELHRLVGHTAPVTSVKYTMKGNLLCSCSM---DESIKIWDI--LSGTLLRTLSAHSEPV 144

Query: 152 TSIKFHPSDCNVLLSGSTDGYTNIYD 177
            SI   P D ++L SGS DG   I+D
Sbjct: 145 VSIDLPPFDPSILSSGSYDGLIRIFD 170

>CAGL0L06182g Chr12 (702461..703948) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|Q00362 Saccharomyces cerevisiae
           YGL190c CDC55
          Length = 495

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 229 ITSAEFHPQQCNLFMYSSSKGTIKLCDMRQ 258

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 128 LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184
           ++++D+RK  +P  S+++ H   + SI F+P +   ++S   DG    +D ++ E++
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 22/114 (19%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGA-PFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNP 139
           H++K++D+      G +   + +   + +D+RY+ +  G    G DA L +++L      
Sbjct: 420 HSIKIWDLSQKKQTGQMAGHLASISCMQIDNRYNMLITG----GRDAVLKMWNLNLGAQL 475

Query: 140 WKS--------------LVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           ++                 DSH D+IT++ F   D   L+SGS D     +DL+
Sbjct: 476 YQEESDAIPSSETACVYTFDSHVDEITALSF---DSGHLVSGSQDRTVRQWDLT 526

>NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {ON}
           Anc_8.150 YGL190C
          Length = 506

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 230 ITSAEFHPQQCNLFMYSSSKGTIKLCDMRQ 259

>TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {ON}
           Anc_8.721 YOR272W
          Length = 458

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPW 140
           HA+K +D+ ++ C+ T         ++   + + +ACG+  + +   LH   +       
Sbjct: 308 HAIKTWDLITSRCVDTKSTSYSLLSIAQLPKLNLLACGSSARHI--TLHDPRVNSSSKIT 365

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-------EEEDDSLHQVIN 192
           +  +  H + + S+   P +  +L SGS DG   ++D+           ED S+ + +N
Sbjct: 366 QQQLIGHKNFVVSLDTCPENDYMLCSGSHDGTVKVWDVRSTTPMYTITREDKSVQKGVN 424

>KLTH0E06534g Chr5 complement(600189..601571) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q00362 Saccharomyces cerevisiae
           YGL190C CDC55 Non-essential regulatory subunit B of
           protein phosphatase 2A has multiple roles in mitosis and
           protein biosynthesis found in the nucleus of most cells
           but also at the bud neck (large-budded cells) and at the
           bud tip (small-budded cells)
          Length = 460

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 240 ITSAEFHPQHCNLFMYSSSKGTIKLADMRQ 269

>KLLA0F09053g Chr6 (842591..843949) [1359 bp, 452 aa] {ON} similar
           to uniprot|Q00362 Saccharomyces cerevisiae YGL190C CDC55
           Non-essential regulatory subunit B of protein
           phosphatase 2A has multiple roles in mitosis and protein
           biosynthesis found in the nucleus of most cells but also
           at the bud neck (large-budded cells) and at the bud tip
           (small-budded cells)
          Length = 452

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN  +  S+ G   + D+ Q
Sbjct: 231 ITSAEFHPQQCNAFMYSSSKGTIKLCDMRQ 260

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           D  + ++DLR  + P ++L   H   I S+ +   D N+LLS   D    +++    EE
Sbjct: 234 DPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 11/95 (11%)

Query: 85  LFDVRSNACIGTIHNEVGAPFLSLD---SRYDKIACGTELKGVDAQLHIFDLRKLDNPWK 141
           ++D+RS   I  +   +  P   LD   + YD IA G+     D  + ++D+RK+     
Sbjct: 337 VWDLRSGKSIMALEGHI-KPIYGLDWSPNGYD-IATGS----ADGTIRLWDVRKVGIL-- 388

Query: 142 SLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIY 176
             + +H+  ++ +KF  ++ + L+S S D   NIY
Sbjct: 389 GALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>Skud_16.468 Chr16 (821432..822928) [1497 bp, 498 aa] {ON} YPR169W
           (REAL)
          Length = 498

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 29  ILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDV 88
           IL    +G++H+++ ++    N  +S     +   I++ D  +  +FI+     +  FDV
Sbjct: 200 ILLGDESGDIHVLNSENLALSNSIRSIHFGDSINDIIHFDKRSAYKFISLGQTTLAYFDV 259

Query: 89  R-SNACIGTIHNEVGAPFLSLDSRYDKIACG 118
           R  +A   T  NE G   +S D + D++ CG
Sbjct: 260 RDKDAKPNTAENEDGKILVS-DDQEDEVLCG 289

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 130 IFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           I+DLRK   P   LV  H   + S+ F+      L++GS DG    +D S+
Sbjct: 184 IWDLRKGSTPLGKLV-GHGSSVNSVDFNRFKRTELMTGSNDGSVKFWDYSK 233

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRK-LDN--- 138
           +K++++  N  + +I   +         +Y+ +  G    G DA L ++D++K +DN   
Sbjct: 436 IKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITG----GRDALLKMWDIQKAIDNDSI 491

Query: 139 PWKSL----VDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           P   +     DSH D+IT++ F   + N L+SGS D     +DL
Sbjct: 492 PSDEVCIYTFDSHIDEITALSF---EANNLVSGSQDRTIRQWDL 532

>AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL116W
           (CDC20)
          Length = 557

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 63/139 (45%), Gaps = 6/139 (4%)

Query: 61  ALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTE 120
            ++I + DW +    I A    +++ DVR    I +   +  +    +  R D +   + 
Sbjct: 306 GVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLAS- 364

Query: 121 LKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLS--GSTDGYTNIYDL 178
             G D  + I+D R+ +  W  +  +H+  + +I +HP   N+L +  GS D + + ++ 
Sbjct: 365 -GGNDNTVMIWDTRQDEPLW--VKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNT 421

Query: 179 SQEEEDDSLHQVINFTSIH 197
           +      S++     +S+H
Sbjct: 422 TTGARIGSINTGSQVSSLH 440

>NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {ON}
           Anc_2.450 YKL121W
          Length = 993

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 64  IVNTDWHNETRFITASM-HAVKLFDVRSNACIGTIHNE---VGAPFLSLDSRYDKIACGT 119
           +++ DW      +TASM   VKL+ +     + T  ++       F  +D R+    C  
Sbjct: 401 VLDLDWSKNNFLVTASMDKTVKLWHIDRATSLRTFRHQDFVTCVAFHPIDDRFIISGC-- 458

Query: 120 ELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNI 175
               +D +  ++ +  LDN      D H D ITS+   P D    + G+ +GY +I
Sbjct: 459 ----LDHKCRLWSI--LDNEVSFEFDCH-DLITSLTLSPEDGKYTIVGTFNGYIHI 507

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 130 IFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           I D+R  + P  +L   H   +  IK+HP++ N+LLS + D     +DL
Sbjct: 375 ILDMRNPETPVLTL-QGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

>Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 95  GTIHNEVG--APFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDIT 152
           G +H  VG  AP +SL   +++         +D  + I+D   L+      + +H + + 
Sbjct: 87  GLLHTFVGHTAPVISL--AFNRKGNLLFTSSMDESIKIWD--TLNGSLMKTISAHSEAVV 142

Query: 153 SIKFHPSDCNVLLSGSTDGYTNIYD 177
           S+    +D ++L SGS DG   I+D
Sbjct: 143 SVDVPTNDSSILSSGSYDGLIRIFD 167

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 124 VDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD------ 177
            D  + ++D+RK+ NP+  L  +H++ ++ +KF       L+S S D   +++       
Sbjct: 372 ADGTVKVWDIRKVGNPFSIL--AHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLR 429

Query: 178 -LSQEEEDDSLHQVI---NFTSIHSCGWVNPKRIYTL 210
             S +   D +  +    +F+ ++S GW    +++ L
Sbjct: 430 LASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 134 RKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           R   N  + ++  H   IT I FHP++  +L + S D Y + +D+
Sbjct: 100 RSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDM 144

>TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {ON}
           Anc_8.150 YGL190C
          Length = 521

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 233 ITSAEFHPEHCNLFMYSSSKGTIKLCDMRQ 262

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 132 DLRKLDN----PWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEE 182
           D+R L++    P    +D H   I ++++HP   N ++S + DG+   +  S+EE
Sbjct: 198 DIRVLNSQTLQPLAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEE 252

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 90/215 (41%), Gaps = 31/215 (14%)

Query: 7   IGSYFFGSENWCFQIQPLYKA--GILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64
           IG    G  +  + I   Y +   + T  ++G +   +  + +    FK+    I  L +
Sbjct: 59  IGQLGHGHRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCV 118

Query: 65  V-------NTDWHNETRFITASM-HAVKLFDV-------RSNACIGTIHNEVG------- 102
                    +DW N+   ++ S    VKL+ +       + ++   ++ NE G       
Sbjct: 119 TQPHFHDKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDG 178

Query: 103 -APFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDC 161
            + F  +DS  +     T      A++H++D+ +L  P  +L     D+ITS++F+ ++ 
Sbjct: 179 ESAFQGIDSHRENSTFATG----GAKIHLWDVNRL-KPISNL-SWGADNITSVRFNQNET 232

Query: 162 NVLLSGSTDGYTNIYDLSQEEEDDSLHQVINFTSI 196
           ++L S  +D    +YDL        + Q +   +I
Sbjct: 233 DILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAI 267

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 101 VGAPFLSLD-SRYDKIACGTELKGVDA-QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHP 158
            G P L L+ S +D     T    +D+ ++ I D+R   +P   +++ H   +  +++HP
Sbjct: 352 TGVPLLRLEPSPFDPNVIAT--FAIDSPRVLILDMRNPGSP-VLVLEGHSAAVNQMRWHP 408

Query: 159 SDCNVLLSGSTDGYTNIYDL 178
           S  NVLLS + D     +DL
Sbjct: 409 SKRNVLLSCADDCQVLYWDL 428

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 19/144 (13%)

Query: 47  KSINKFKSDETAINALQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFL 106
           K ++ FK     ++ L+ +N    NE+    +      L+D+  +  +    + +G   L
Sbjct: 168 KIVSIFKGHTCYVSDLEFIN----NESILTASGDMTCALWDIPKSKRVSEYSDHLG-DVL 222

Query: 107 SLD------SRYDKI-ACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPS 159
           +L       + YD + A G    G D  ++++D R   +     V     DI++++F  S
Sbjct: 223 TLSVPPAGTTSYDSMFASG----GSDGYVYLWDTRSPSSVQNFFV--SDSDISTVRFF-S 275

Query: 160 DCNVLLSGSTDGYTNIYDLSQEEE 183
           D N +++GS DG   ++DL  + E
Sbjct: 276 DGNSIITGSDDGIARLFDLRSDCE 299

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 10/138 (7%)

Query: 36  GEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHA-VKLFDVRSNACI 94
           G++ + +W+S   I K +     +N L    T   + +R +TAS    +K++DV S  C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDTLNGL----TYSPDGSRVVTASEDGKIKIWDVVSGFCL 376

Query: 95  GTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSI 154
            T      A      S+  ++     L   D  +  +DL +  N +++   +      S+
Sbjct: 377 ATFEEHTSAVSAVQFSKRGQVLFSASL---DGTVRAWDLIRYRN-FRTFTAAERIQFNSL 432

Query: 155 KFHPSDCNVLLSGSTDGY 172
              PS   V+ +GS D Y
Sbjct: 433 AVDPSG-EVVCAGSIDNY 449

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 11/129 (8%)

Query: 63  QIVNTDWHNETRFITASMHA---VKLFDVRSNACIGTIHNEVGAPFLSLDSR-YDKIA-- 116
           + V  DW+ +   I AS ++   + ++D++       I ++  A F+  +S+ ++ ++  
Sbjct: 178 ETVALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWM 237

Query: 117 ----CGTELKGVDAQLHIFDLRKLDNPWKSLVDSHH-DDITSIKFHPSDCNVLLSGSTDG 171
               C   +   D  + +FD R   N  ++   ++H   I   KF+PS   ++ + S DG
Sbjct: 238 PSHDCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDG 297

Query: 172 YTNIYDLSQ 180
              ++D+ +
Sbjct: 298 LVQLWDIRK 306

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           HI+ LR        +   H +D+ ++ FHP+ C V  +GS+D    ++D+S
Sbjct: 606 HIYPLR--------IFAGHTNDVDTVSFHPNGCYV-FTGSSDKTCRMWDVS 647

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 9/107 (8%)

Query: 75  FITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYD--KIACGTELKGVDAQLHIFD 132
           F  +S    +++D+ +   +        AP LS+    D  ++A G+E    D  +HI+D
Sbjct: 653 FTGSSDKTCRMWDITTGESVRLFIGHT-APILSVAVAPDGLRLATGSE----DGVIHIWD 707

Query: 133 LRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           +       K L+      + S+ ++  + N+L+SG +D    I+DL+
Sbjct: 708 I-GTGKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDLT 752

>TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.333
           YDL156W
          Length = 526

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 131 FDLRKLDNPWKSLVDSHHDDITSIKFHPS-DCNVLLSGSTDGYTNIYDLSQE 181
           FDL+  D    + +   HD ITS+ FHP+ D  +++ G T G   ++++  E
Sbjct: 173 FDLQPYDVFQPNEIKITHDRITSMYFHPTVDKKLIIGGDTSGNIGLWNVRDE 224

>Suva_2.29 Chr2 complement(47586..55955) [8370 bp, 2789 aa] {ON}
            YBL088C (REAL)
          Length = 2789

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 140  WK----SLVDSHHDDI-TSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-----EEEDDSLHQ 189
            WK     L+DS    + T+IK  P D N  +    +    ++D  Q     EE  D+L  
Sbjct: 1867 WKLLTPKLIDSKEKGLYTAIKNIPRDINSTVKSLENSLLTVFDCRQDFTNHEEWMDTLTA 1926

Query: 190  VINFTSIHSCG 200
            +I FT I SC 
Sbjct: 1927 IIEFTKIASCS 1937

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 83  VKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV------DAQLHIFDLRKL 136
           V+++DV  N CI T+   V           D++AC +    V      D ++   D+R  
Sbjct: 342 VEIYDVLKNKCIRTLSGHV-----------DRVACLSWNNHVLSSGSRDRKILHRDVRAP 390

Query: 137 DNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYD 177
           + P+   +D+H  ++  +K++ ++ N L SG  D    +YD
Sbjct: 391 E-PFFEQIDTHSQEVCGLKWNVNE-NKLASGGNDNMVYVYD 429

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           HI+ LR        +   H +D+ ++ FHP+ C V  +GS D    ++D+S
Sbjct: 614 HIYPLR--------IFAGHLNDVETVSFHPNGCYV-FTGSADKTCRMWDIS 655

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 129 HIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           HI+ LR        +   H  D+ ++ FHP+ C V  +GS+D    ++D+S
Sbjct: 616 HIYPLR--------IFAGHLSDVDTVSFHPNGCYV-FTGSSDKTCRMWDIS 657

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 123 GVDAQ-LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTD 170
           G D+  + I D+R    P  +L D H   I  IK+HP+  N +LS S D
Sbjct: 385 GADSNSVLILDMRNPGTPVLTL-DGHSAPINQIKWHPTKKNTILSSSDD 432

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 77/169 (45%), Gaps = 17/169 (10%)

Query: 124 VDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           +D    ++DL+  +N  K+ + +H  ++  ++F      +  S   DG   ++DL     
Sbjct: 264 IDTTCIVWDLQS-NNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAH 322

Query: 184 DDSLHQVINFTS---IHSCGWVN-PKRIYTLSHMETFAIHELNNKSDEL--TEPQPLDFG 237
              +++    TS   + S G V+ P  + T S + +    +L++KS+ L   EP P D  
Sbjct: 323 STIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSV---DLSSKSNALLRLEPSPTD-P 378

Query: 238 DIRAAWGCD----YVVDIY-PGY-VATGKSHEEGKGELKLIPLKGENVV 280
           ++ A +G D     ++D+  PG  V T   H     ++K  P K   ++
Sbjct: 379 NVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTIL 427

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 128 LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSL 187
           + ++DLRK   P  SL   H   + SI F+      L+S S DG    +D S+   +   
Sbjct: 181 VFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWDYSKSTTESKR 239

Query: 188 HQVINF 193
               NF
Sbjct: 240 TVTTNF 245

>ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} highly
           similar to uniprot|Q00362 Saccharomyces cerevisiae
           YGL190C CDC55 Non-essential regulatory subunit B of
           protein phosphatase 2A has multiple roles in mitosis and
           protein biosynthesis found in the nucleus of most cells
           but also at the bud neck (large-budded cells) and at the
           bud tip (small-budded cells)
          Length = 539

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 151 ITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ITS +FHP  CN+ +  S+ G   + D+ Q
Sbjct: 239 ITSAEFHPLHCNLFMYSSSKGTVKLCDMRQ 268

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 130 IFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           I D+R   +P  +L + H   +  IK+HP   NVLLS   D     +DL++
Sbjct: 353 ILDMRNPGSPVLTL-EGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 110 SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGST 169
           + Y   A G++    D  + I+DLR  + P  +L   H   I S+ +   D ++LLS   
Sbjct: 227 TTYVATASGSD---SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGR 283

Query: 170 DGYTNIYDLSQEE 182
           DG   ++D    E
Sbjct: 284 DGIVALWDTKANE 296

>TPHA0B00550 Chr2 (123270..127262) [3993 bp, 1330 aa] {ON} Anc_4.315
            YLR436C
          Length = 1330

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 18/91 (19%)

Query: 170  DGYTNIYDLSQEEEDDSLHQVINFTSIHSCGWV------------------NPKRIYTLS 211
            D ++ +Y+ S+   + +++ V + TSI S G +                  NP  +Y  +
Sbjct: 1072 DTHSGLYNTSENTFESTINAVSSSTSIDSLGIISGKDNANEYGSHLNGERKNPACLYKTN 1131

Query: 212  HMETFAIHELNNKSDELTEPQPLDFGDIRAA 242
               +      +N+S+EL+   PLD  D+ +A
Sbjct: 1132 SNNSVLTSYFSNQSNELSSQMPLDISDMHSA 1162

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 128 LHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180
           ++I+DLR    P   LV  H   + SI F+    + ++S S DG    +D+S+
Sbjct: 185 IYIWDLRMGSTPLHKLV-GHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISK 236

>Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121W
           (REAL)
          Length = 852

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 13/116 (11%)

Query: 61  ALQIVNTDWHNETRFITASM-HAVKLFDVRSNACIGT-IHNE--VGAPFLSLDSRYDKIA 116
           AL I++ +W      ITASM    KL+       + T +H +    A F   D R+    
Sbjct: 280 ALDILDANWSKNGFLITASMDKTAKLWHPERKCSLKTFVHPDFVTSAIFFPGDDRFIITG 339

Query: 117 CGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGY 172
           C      +D +  ++ +  LDN      D   D ITS+   PSD    + G+ +GY
Sbjct: 340 C------LDHKCRLWSI--LDNEVSYAFDCK-DLITSLTLSPSDGEYTIIGTFNGY 386

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 147 HHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEE 183
           H +  TS++F P   ++LLSG  D    ++D   E E
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERE 170

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 59/136 (43%), Gaps = 12/136 (8%)

Query: 46  NKSINKFKSDETAINALQIVNTDWHNETRFIT--ASMHAVKLFDVRSNACIGTIHNEVGA 103
           N  +N F + ++A + L I +  +  + +F+   A    ++++D+     +  +      
Sbjct: 360 NNDVNSFVTAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGH-EQ 418

Query: 104 PFLSLD--SRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDC 161
              SLD     DK+  G+     D  + I+DLR       SL  S  D +T++   P D 
Sbjct: 419 DIYSLDYFPSGDKLVSGSG----DRTVRIWDLR---TGQCSLTLSIEDGVTTVAVSPGDG 471

Query: 162 NVLLSGSTDGYTNIYD 177
             + +GS D    ++D
Sbjct: 472 KFIAAGSLDRAVRVWD 487

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 64  IVNTDWHNETRFITASM--HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121
           + + DWH E   I ++   + VKL+D R   CI TI   +      L +R+     G  L
Sbjct: 210 VKSCDWHPEMGLIASASKDNLVKLWDPRVGQCISTI---LKFKHTVLKTRFQPTG-GNLL 265

Query: 122 KGV--DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
             +  D    +FD+R      + +V     D  ++ ++P + ++L     DG    +D+ 
Sbjct: 266 AAISKDKSCRVFDIRHSLK--ELMVVRDEVDYMTLLWNPINESMLTVACYDGSLKDFDVV 323

Query: 180 QE 181
           Q+
Sbjct: 324 QD 325

>TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8.288
           YDR128W
          Length = 1134

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 127 QLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179
           ++ I+DLRK   P   L+  H   + SI F+    + +++GS DG    +D S
Sbjct: 181 EVSIWDLRKGSTPLGKLL-GHESGVNSIDFNRFKNDEIMTGSNDGTVKFWDYS 232

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 78/182 (42%), Gaps = 30/182 (16%)

Query: 17  WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSIN--------KFKSDETAINALQIVNTD 68
           W  Q + L    +L+S SNG+V + D K     N           SD + +N +  + T 
Sbjct: 208 WNLQQEAL----LLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVNDVTWMPT- 262

Query: 69  WHNETRFITASMHAVKLFDVRSNA------CIGTIHNEVGAPFLSLDSRYDKIACGTELK 122
            H+         + V L D+R+        C    HN  G      + R   I    +  
Sbjct: 263 -HDSLFAACTEGNTVSLLDLRTKKEKLKSNCRS--HNG-GVNSCKFNYRNSLILASADSN 318

Query: 123 GVDAQLHIFDLRKL-DNPWKSLVDSHHDDITSIKFHPS-DCNVLLSGSTDGYTNIYDLSQ 180
           G   +L+++D+R + D P  ++   H   ++++++ P+ D  +  +G  DG   ++D S+
Sbjct: 319 G---KLNLWDIRNMNDCPLTTM--EHGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDTSR 373

Query: 181 EE 182
           EE
Sbjct: 374 EE 375

>Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272W
           (REAL)
          Length = 461

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPW 140
           H +K +D+ +  CI T         ++     + +ACG+  + +   LH   L       
Sbjct: 311 HTIKTWDLVTARCIDTRVTSYSLLSIAQLPSLNLLACGSSARHI--TLHDPRLGASSKVT 368

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ-------EEEDDSLHQVIN 192
           +  +  H + ++S+   P +  +L SGS DG   ++D+           ED S+ + +N
Sbjct: 369 QQQLIGHKNLVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSVQKGVN 427

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 61/138 (44%), Gaps = 10/138 (7%)

Query: 36  GEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHA-VKLFDVRSNACI 94
           G++ + +W+S   I K +    A N+L    T   + +R +TA+    +K++DV S  C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNSL----TYSPDGSRVVTAAEDGKIKVWDVASGFCL 376

Query: 95  GTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSI 154
            T      A      ++  ++     L   D  +  +DL +  N ++    +     T +
Sbjct: 377 ATFEEHTSAVTAVQFAKKGQVLFSASL---DGTVRAWDLIRYRN-FRVFTATERVQFTCL 432

Query: 155 KFHPSDCNVLLSGSTDGY 172
              PS   V+ +GSTD +
Sbjct: 433 AVEPSG-EVVSAGSTDSF 449

>Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON}
           (64223..65584) [1362 nt, 454 aa]
          Length = 453

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 81  HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIFDLRKLDNPW 140
           H +K +D+ ++ CI T         L+     + +ACG+  + +   LH   +       
Sbjct: 303 HTIKTWDLVTSRCIDTKTTSYSLLSLAQLPTLNLLACGSSARHI--TLHDPRIGSTSKIT 360

Query: 141 KSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178
           +  +  H + + S+   P +  +L SGS DG   ++D+
Sbjct: 361 QQQLVGHKNFVVSLDTCPENEYMLCSGSHDGTVKVWDV 398

>NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {ON}
           Anc_8.631
          Length = 424

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 12/89 (13%)

Query: 34  SNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHNETRFITASMHAV-KLFDVRSNA 92
           S+G  ++ D +++ ++ KF + +T +NA+Q     + +    +T     V  +FD+RS+ 
Sbjct: 248 SDGYTYIWDTRTSAAVQKFFASDTDVNAIQF----FKDGNSIVTGGDDGVINMFDLRSDC 303

Query: 93  CIGT------IHNEVGAP-FLSLDSRYDK 114
            I +      I  E+  P ++S +  Y +
Sbjct: 304 AIASYSLQQGIQKEIRDPTYMSSNMEYSR 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,152,148
Number of extensions: 2160013
Number of successful extensions: 7586
Number of sequences better than 10.0: 351
Number of HSP's gapped: 7714
Number of HSP's successfully gapped: 375
Length of query: 399
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 287
Effective length of database: 40,638,807
Effective search space: 11663337609
Effective search space used: 11663337609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)