Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H02030singletonON63263232900.0
KNAG0E01405singletonON63263232130.0
KNAG0J01380singletonON5091912783e-25
KNAG0H01620singletonON5446452758e-25
KNAG0G01100singletonON6103012751e-24
KNAG0B05600singletonON6103012732e-24
KNAG0B05400singletonON5713012713e-24
KNAG0G01050singletonON6103012688e-24
KNAG0K01360singletonON5416442543e-22
KNAG0F02660singletonON5446412544e-22
KNAG0E01550singletonON4461802081e-16
KNAG0B05625singletonON1541001543e-11
KNAG0B05460singletonON351771472e-09
KNAG0M01510singletonON17777920.006
KNAG0K01643singletonON8881790.075
KNAG0G034108.838ON526110771.1
CAGL0H03949g1.418ON39641724.0
NCAS0B031108.381ON149865716.5
SAKL0E13244g2.57ON43466699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02030
         (632 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02030 Chr8 complement(361381..363279) [1899 bp, 632 aa] {O...  1271   0.0  
KNAG0E01405 Chr5 (280036..281934) [1899 bp, 632 aa] {ON}             1242   0.0  
KNAG0J01380 Chr10 complement(251885..253414) [1530 bp, 509 aa] {...   111   3e-25
KNAG0H01620 Chr8 (288030..289664) [1635 bp, 544 aa] {ON}              110   8e-25
KNAG0G01100 Chr7 complement(238730..240562) [1833 bp, 610 aa] {O...   110   1e-24
KNAG0B05600 Chr2 complement(1094185..1096017) [1833 bp, 610 aa] ...   109   2e-24
KNAG0B05400 Chr2 (1043474..1045189) [1716 bp, 571 aa] {ON}            108   3e-24
KNAG0G01050 Chr7 complement(226282..228114) [1833 bp, 610 aa] {O...   107   8e-24
KNAG0K01360 Chr11 (271795..273420) [1626 bp, 541 aa] {ON}             102   3e-22
KNAG0F02660 Chr6 complement(498120..499754) [1635 bp, 544 aa] {O...   102   4e-22
KNAG0E01550 Chr5 complement(309050..310390) [1341 bp, 446 aa] {O...    85   1e-16
KNAG0B05625 Chr2 (1096660..1097124) [465 bp, 154 aa] {ON}              64   3e-11
KNAG0B05460 Chr2 complement(1066639..1067694) [1056 bp, 351 aa] ...    61   2e-09
KNAG0M01510 Chr13 complement(267954..268487) [534 bp, 177 aa] {ON}     40   0.006
KNAG0K01643 Chr11 (341746..342012) [267 bp, 88 aa] {ON} no start...    35   0.075
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    34   1.1  
CAGL0H03949g Chr8 (368426..369616) [1191 bp, 396 aa] {ON} highly...    32   4.0  
NCAS0B03110 Chr2 complement(536705..541201) [4497 bp, 1498 aa] {...    32   6.5  
SAKL0E13244g Chr5 complement(1092314..1093618) [1305 bp, 434 aa]...    31   9.7  

>KNAG0H02030 Chr8 complement(361381..363279) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 1271 bits (3290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/632 (97%), Positives = 616/632 (97%)

Query: 1   MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII 60
           MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII
Sbjct: 1   MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII 60

Query: 61  GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC 120
           GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC
Sbjct: 61  GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC 120

Query: 121 NSTFFPDTSSVYSEHVTMSVKDLDKTPTPSNTIDWGIPNPYIDPAAESSFITVPADSSFI 180
           NSTFFPDTSSVYSEHVTMSVKDLDKTPTPSNTIDWGIPNPYIDPAAESSFITVPADSSFI
Sbjct: 121 NSTFFPDTSSVYSEHVTMSVKDLDKTPTPSNTIDWGIPNPYIDPAAESSFITVPADSSFI 180

Query: 181 HILTEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI 240
           HILTEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI
Sbjct: 181 HILTEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI 240

Query: 241 MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC 300
           MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC
Sbjct: 241 MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC 300

Query: 301 PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSSED 360
           PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSSED
Sbjct: 301 PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSSED 360

Query: 361 XXXXXXXXXXXXXXXXTNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED 420
                           TNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED
Sbjct: 361 FRRRNVRKFKRKVENKTNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED 420

Query: 421 VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI 480
           VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI
Sbjct: 421 VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI 480

Query: 481 EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLR 540
           EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLR
Sbjct: 481 EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLR 540

Query: 541 QGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSR 600
           QGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSR
Sbjct: 541 QGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSR 600

Query: 601 IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC 632
           IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC
Sbjct: 601 IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC 632

>KNAG0E01405 Chr5 (280036..281934) [1899 bp, 632 aa] {ON}
          Length = 632

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/632 (95%), Positives = 607/632 (96%)

Query: 1   MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII 60
           MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII
Sbjct: 1   MNQASNMSINCEFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRII 60

Query: 61  GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC 120
           GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC
Sbjct: 61  GCVCDLVRKVAKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPC 120

Query: 121 NSTFFPDTSSVYSEHVTMSVKDLDKTPTPSNTIDWGIPNPYIDPAAESSFITVPADSSFI 180
           NSTFFPDTSSVYSEHVTMSVKDLDKTPT SNTIDWGIPNPYIDPAAESSFITVPADSSFI
Sbjct: 121 NSTFFPDTSSVYSEHVTMSVKDLDKTPTLSNTIDWGIPNPYIDPAAESSFITVPADSSFI 180

Query: 181 HILTEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI 240
           HI TEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI
Sbjct: 181 HIPTEFLSDEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTPTNNGLSIAPGI 240

Query: 241 MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC 300
           MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC
Sbjct: 241 MNDTIFSPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIAC 300

Query: 301 PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSSED 360
           PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSS+D
Sbjct: 301 PGLPVNSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEYKQCDDIIKCIRVSSKD 360

Query: 361 XXXXXXXXXXXXXXXXTNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED 420
                           TNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED
Sbjct: 361 FRRRNVRKFKRKVENKTNKVLQKIFKHSPRLTDGPSKAECSSTMSTADNKTRTASTEPED 420

Query: 421 VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI 480
           VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI
Sbjct: 421 VGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLI 480

Query: 481 EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLR 540
           EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQK     +TQIGECIQAGRHLR
Sbjct: 481 EKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKVVHRHKTQIGECIQAGRHLR 540

Query: 541 QGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSR 600
           QGIRSAKDATCRQQWEAEYRDHEKSVLVK HTALKSLVDAN DCDHQ+TLVEDIAK+KSR
Sbjct: 541 QGIRSAKDATCRQQWEAEYRDHEKSVLVKFHTALKSLVDANSDCDHQLTLVEDIAKKKSR 600

Query: 601 IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC 632
           IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC
Sbjct: 601 IYLKVRELDCRRPFQITMTEKLAWSNCLIQKC 632

>KNAG0J01380 Chr10 complement(251885..253414) [1530 bp, 509 aa] {ON}
           
          Length = 509

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 107/191 (56%)

Query: 441 NPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQ 500
           N SG+T+A+VKY+  L  E+ TW  YRH+L   S  D+L+ ++I +    G     + ++
Sbjct: 318 NSSGFTAAVVKYYTILTSEENTWRQYRHLLGISSNYDNLMRQNIDNNRYEGNTAKGVRRE 377

Query: 501 IYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYR 560
           I  VT +++ K+ LI+ YQK+ T     +G+ ++ G +L   I +AKD   R + E+E++
Sbjct: 378 INGVTDQMFNKVILIDKYQKENTTSLVGLGKILEDGHNLTVAIENAKDEVARMRLESEFQ 437

Query: 561 DHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTE 620
            ++   L K+H  L  +   +    +++    +I +EK+ IY  + ++D R  FQ+T+ E
Sbjct: 438 LYKSKCLKKIHKELGLMEILSKRHIYEVKRFSEIIEEKTEIYRYMCDIDSRTTFQVTLKE 497

Query: 621 KLAWSNCLIQK 631
              W  CL+ K
Sbjct: 498 NATWMKCLLTK 508

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 12 EFTKFIKATSKTFSQ-FQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKV 70
          +FT   K T K   + F NL +K + +  K  +E Y  P  C  C G I  CVCDL++KV
Sbjct: 2  KFTSVFKRTRKAVKERFVNLAKKPETQNFKFDMEHYVHPTSCSICQGIIPNCVCDLLQKV 61

Query: 71 AKNEVILESAALSAYLRK 88
             E+  +   L AYL+K
Sbjct: 62 DNGEIPADE-ILIAYLQK 78

>KNAG0H01620 Chr8 (288030..289664) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 143/645 (22%), Positives = 244/645 (37%), Gaps = 134/645 (20%)

Query: 12  EFTKFIKATSKTFSQ-FQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKV 70
           +FT   K T +   + F NL +K+K EV K+ +  Y  P  C  CNG I  C CDL++KV
Sbjct: 2   KFTSVFKQTKEAVKERFVNLAKKEKKEVFKLDVSFYVRPTGCNICNGIIPHCCCDLLQKV 61

Query: 71  AKNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPCNSTFFPDTSS 130
              ++  +   L AYL +   + C           ++  E   C        T   D+  
Sbjct: 62  NSGDIEADEN-LIAYLHEQELIRCSI---------LEQQERESC-------ETITNDSEE 104

Query: 131 VYSEHVTMSVKDLDKTPTPSNTIDWGIPNP-YIDPAAESSFITVPADSSFIHILTEFLSD 189
           V S   +M+ +   +T +   +      NP Y+ P        +P  SS   ++ E L  
Sbjct: 105 VMSIQSSMNWRYNSETSSSVESPVTATINPLYVVPL-------IPEVSSKKELMNERLKR 157

Query: 190 EPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTP--TNNGLSIAPGIMNDTIFS 247
              K+L                N+S N  RL     TH P       S+ P I  D    
Sbjct: 158 SVEKTL----------------NKSVN--RLSVNVKTHEPFIVMPTASVVPTINFD---- 195

Query: 248 PPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIACPGLPV-- 305
            PT              +++ P+++ H      IP +  T K+    SP++ C  LPV  
Sbjct: 196 -PT--------------VMSSPSAKAH------IPNEQVTAKKEPTTSPNLVCE-LPVSP 233

Query: 306 ----------------------NSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGE 343
                                 N K+   D     ++  K++L Y    W++       E
Sbjct: 234 EQQQLWGQSSESYRKGKDKNGSNDKM---DKTHTPKILTKSELSY----WQKASNLARLE 286

Query: 344 YKQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKHSPRLTDGPSKAECSST 403
           Y +C +I+  +++  E+                    ++ +FK        P+K      
Sbjct: 287 YTKCREIVTDLKIGCEEYRKKNSNKTTTRAKASAK--VKGLFKKVLH-CKFPAKG----- 338

Query: 404 MSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETW 463
                     A++   + G++  C               +G  +A+V+Y  AL +EK T 
Sbjct: 339 ----------ATSSKHNPGEVQCCG-------------FNGLATAMVRYEDALAREKNTC 375

Query: 464 SNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYT 523
             Y+  LH     D LI ++I++          +  ++  VT R+Y ++ LI   QK   
Sbjct: 376 RKYKRSLHNSVWFDELIRQNINANQHDSNASDVIKTELNGVTERMYNEMALIMKCQKNNL 435

Query: 524 AIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLD 583
            +  ++G+CI  G  L+    S  D   R++     + +   V    H  L +L     D
Sbjct: 436 TVMVRLGKCINYGYGLKLEYESTTDPVEREKLAVHCQVYNDKVAKHFHQHLDNLEKLQKD 495

Query: 584 CDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNCL 628
              ++     +  +K+ +Y ++ E DCR   ++ M E++AW  CL
Sbjct: 496 YKDEVVCFSRLIGQKAGLYRRMYESDCRSHLKVKMKEEVAWVQCL 540

>KNAG0G01100 Chr7 complement(238730..240562) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 128/301 (42%), Gaps = 33/301 (10%)

Query: 328 YERRLWKEIRTAVIGEYKQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKH 387
           ++ R W+  R A   EY +    IK I+ +S +                T  + +K+F+H
Sbjct: 318 HDLRRWRRFRDASRAEYTRAQATIKEIKRASLEFRLRKIKGMKDTVKTRTTALYRKLFEH 377

Query: 388 SPRLTDGPSKAECSSTMSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTS 447
           SP                  D +     T P D      C             +  GY++
Sbjct: 378 SP------------------DPEEPALPTRPVDA---PGCG------------DADGYSA 404

Query: 448 AIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTR 507
           A + + + L+ E+ETW  Y+H LH     D LI  +I      G +   +  ++ ++T  
Sbjct: 405 AKLMFTRLLKLEEETWRKYKHSLHGSLWLDSLIAANIDGNDYRGHICDSIRTEVGNLTGL 464

Query: 508 LYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVL 567
           L  KL L+  YQ+        I  C++ GR LR  +  A DAT R++ + EY  ++  ++
Sbjct: 465 LQDKLALLGKYQEHNLTTMNNISRCLETGRQLRLTMEQAPDATSRRKAKGEYLLYKDRLM 524

Query: 568 VKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNC 627
           VKLH  L SL   +     ++ L   +  EK  +Y ++  +D R    + + EK+AW  C
Sbjct: 525 VKLHRVLDSLDMMDSRYASEVELFSRLVSEKKEVYRRLHGMDLRHGIPVRVQEKIAWLRC 584

Query: 628 L 628
           +
Sbjct: 585 M 585

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 13 FTKFI----KATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVR 68
          F  FI    KA     ++F NLF +++VE  +++++ Y  P  C  C GR   CVCDL+ 
Sbjct: 3  FVTFIEKATKAKRTVKARFVNLFTREEVETYELEIKHYVRPKGCTTCMGRTPYCVCDLIE 62

Query: 69 KVAKNEVILESAALS 83
          KV    +  + A +S
Sbjct: 63 KVDAGLIACDEALVS 77

>KNAG0B05600 Chr2 complement(1094185..1096017) [1833 bp, 610 aa]
           {ON} 
          Length = 610

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 129/301 (42%), Gaps = 33/301 (10%)

Query: 328 YERRLWKEIRTAVIGEYKQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKH 387
           ++ R W++ + A   EY +    IK ++ +S +                T  + +K+FKH
Sbjct: 318 HDLRRWRKFKDASRAEYTRAQATIKELKRASLEFRLRKIKGMKGTVKTRTTALYRKLFKH 377

Query: 388 SPRLTDGPSKAECSSTMSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTS 447
           SP                  D +     T P D      C             +  GY++
Sbjct: 378 SP------------------DPEEPALPTRPVDA---PGCG------------DADGYSA 404

Query: 448 AIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTR 507
           A + + + L+ E+ETW  Y+H LH     D LI  +I      G +   +  ++ ++T  
Sbjct: 405 AKLMFTRLLKLEEETWRKYKHSLHVSLWLDSLIAANIDGNDYRGHICDNIRTEVGNLTGL 464

Query: 508 LYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVL 567
           L  KL L+  YQ+        I  C++ GR LR  +  A DAT R++ + EY  ++  ++
Sbjct: 465 LQDKLALLGKYQEHNLTTMNNISRCLETGRQLRLTMEQAPDATSRRKAKGEYLLYKDRLM 524

Query: 568 VKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNC 627
           VKLH  L SL   +     ++ L   +  EK  +Y ++  +D R    + + EK+AW  C
Sbjct: 525 VKLHRVLDSLDMMDGRYASEVELFSRLVSEKKEVYRRLHGMDLRHGIPVRVQEKIAWLRC 584

Query: 628 L 628
           +
Sbjct: 585 M 585

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 4/75 (5%)

Query: 13 FTKFI----KATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVR 68
          F  FI    KA     ++F NLF +++VE  ++ +E Y  P  C  C GR       L  
Sbjct: 3  FVTFIEKATKAKRTVKARFVNLFTREEVETYELDIEHYVRPKGCTTCMGRPPMSCATLSE 62

Query: 69 KVAKNEVILESAALS 83
          KV    +  + A +S
Sbjct: 63 KVDAGLIACDEALVS 77

>KNAG0B05400 Chr2 (1043474..1045189) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  108 bits (271), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 128/301 (42%), Gaps = 33/301 (10%)

Query: 328 YERRLWKEIRTAVIGEYKQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKH 387
           ++ R W++ R A   EY +    IK I+ +S +                T  + +K+FKH
Sbjct: 279 HDLRRWRKFRDASRAEYTRAQTTIKEIKRASLEFRLRKIKRHEGTVKTRTTALYRKLFKH 338

Query: 388 SPRLTDGPSKAECSSTMSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTS 447
           SP                  D +     T P D      C             +  GY++
Sbjct: 339 SP------------------DPEEPALPTRPVDA---PGCG------------DADGYSA 365

Query: 448 AIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTR 507
           A + + + L+ E+ETW  Y+H LH     D LI  +I      G +   +  ++ ++T  
Sbjct: 366 AKLMFTRLLKLEEETWRKYKHSLHVSLWLDSLIAANIDGNDYRGHICGSIRTEVGNLTGL 425

Query: 508 LYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVL 567
           L  KL L+  YQ+        I  C++ GR LR  +  A DAT R++ + EY  ++  ++
Sbjct: 426 LQDKLALLGKYQEHNLTTMNNISRCLETGRQLRLTMEQAPDATSRRKAKGEYLLYKDRLM 485

Query: 568 VKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNC 627
           VKLH  L SL   +     ++ L   +  EK  +Y ++  +D      + + EK+AW  C
Sbjct: 486 VKLHRVLDSLDMMDSRYASEVELFSRLVSEKKEVYRRLHGMDLHHGIPVRVQEKIAWLRC 545

Query: 628 L 628
           +
Sbjct: 546 M 546

>KNAG0G01050 Chr7 complement(226282..228114) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score =  107 bits (268), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 127/301 (42%), Gaps = 33/301 (10%)

Query: 328 YERRLWKEIRTAVIGEYKQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKH 387
           ++ R W+  R A   EY +    IK I+ +S +                T  + +K+F+H
Sbjct: 318 HDLRRWRRFRDASRAEYTRAQATIKEIKRASLEFRLRKIKGMKDTVKTRTTALYRKLFEH 377

Query: 388 SPRLTDGPSKAECSSTMSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTS 447
           SP                  D +     T P D      C             +  GY++
Sbjct: 378 SP------------------DPEEPALPTRPVDA---PGCG------------DADGYSA 404

Query: 448 AIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTR 507
           A + + + L+ E+ETW  Y+H LH     D LI  +I      G +   +  ++ ++T  
Sbjct: 405 AKLMFTRLLKLEEETWRKYKHSLHGSLWLDSLIAANIDGNDYRGHICDSIRTEVGNLTGL 464

Query: 508 LYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVL 567
           L  KL L+  YQ+        I  C++ GR LR  +  A DAT R++ + EY  ++  ++
Sbjct: 465 LQDKLALLGKYQEHNLTTMNNISRCLETGRQLRLTMEQAPDATSRRKAKGEYLLYKDRLM 524

Query: 568 VKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNC 627
           VKLH  L SL   +     ++ L   +  EK  +Y ++  +D      + + EK+AW  C
Sbjct: 525 VKLHRVLDSLDMMDSRYASEVELFSRLVSEKKEVYRRLHGMDLHHGIPVRVQEKIAWLRC 584

Query: 628 L 628
           +
Sbjct: 585 M 585

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 13 FTKFI----KATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVR 68
          F  FI    KA     ++F NLF +++VE  ++++E Y  P  C  C GR   CVCDL+ 
Sbjct: 3  FVTFIEKATKAKRTVKARFVNLFTREEVETYELEIEHYVRPKGCTTCMGRTPYCVCDLIE 62

Query: 69 KVAKNEVILESAALS 83
          KV    +  + A +S
Sbjct: 63 KVDAGLIACDEALVS 77

>KNAG0K01360 Chr11 (271795..273420) [1626 bp, 541 aa] {ON} 
          Length = 541

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 142/644 (22%), Positives = 245/644 (38%), Gaps = 135/644 (20%)

Query: 12  EFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKVA 71
           +FT   K T +    F NL +K+K +V ++ +  Y  P  C  CNG I  C CDL++KV 
Sbjct: 2   KFTSVFKRTKEAL--FVNLVKKEKKQVPELDISCYVRPTGCNICNGIIPHCCCDLLQKVN 59

Query: 72  KNEVILESAALSAYLRKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPCNSTFFPDTSSV 131
             ++  +   L AYL +            +  I   + E  +   +  C  T   D+  V
Sbjct: 60  SGDIEADEN-LIAYLHE------------QELIRRSIIEQQE---RESC-ETITNDSEEV 102

Query: 132 YSEHVTMSVKDLDKTPTPSNTIDWGIPNP-YIDPAAESSFITVPADSSFIHILTEFLSDE 190
            S   +M+ +   +T +   +      NP Y+ P        +P  SS   ++ E L   
Sbjct: 103 MSIQSSMNWRYNSETSSSVESPVTATINPLYVVP-------LIPEVSSKKELMNERLKRS 155

Query: 191 PAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTP--TNNGLSIAPGIMNDTIFSP 248
             K+L                N+S N  RL     TH P       SI P I  D     
Sbjct: 156 VEKTL----------------NKSVN--RLSVNVKTHEPFIVMPTASIVPTINFD----- 192

Query: 249 PTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIACPGLPV--- 305
           PT              +++ P+++ H      IP +  T K+  A SP++ C  LPV   
Sbjct: 193 PT--------------VMSSPSAKAH------IPNEQVTAKKEPATSPNLVCE-LPVSPE 231

Query: 306 ---------------------NSKIVCEDGCLASRLDPKTQLIYERRLWKEIRTAVIGEY 344
                                N K+   D     ++  K++L Y    W++       EY
Sbjct: 232 QQQLWGQSSESYRKGKDKNGSNDKM---DKTHTPKILTKSELSY----WQKASNLARLEY 284

Query: 345 KQCDDIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKHSPRLTDGPSKAECSSTM 404
            +C +I+  +++  E+                    ++ +FK        P+K       
Sbjct: 285 TKCREIVTDLKIGCEEYRKKNSNKTTTRAKASAK--VKGLFKKVLH-CKFPAKG------ 335

Query: 405 STADNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWS 464
                    A++   + G++  C               +G  +A+V+Y  AL +EK T  
Sbjct: 336 ---------ATSSKHNPGEVQCCG-------------FNGLATAMVRYEDALAREKNTCR 373

Query: 465 NYRHVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTA 524
            Y+  LH     D LI ++I++          +  ++  VT R+Y ++ LI   QK    
Sbjct: 374 KYKRSLHNSVWFDELIRQNINANQHDSNASDVIKTELNGVTERMYNEMALIMKCQKNNLI 433

Query: 525 IRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDC 584
              ++G+CI  G  L+    S  D   R++     + +   V    H  L +L     D 
Sbjct: 434 AMVRLGKCINYGYGLKLEYESTTDPVEREKLAVHCQVYNDKVAKHFHQHLDNLEKLQKDY 493

Query: 585 DHQITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNCL 628
             ++     +  +K+ +Y ++ E DCR   ++ + E++AW +CL
Sbjct: 494 KDEVVCFSRLIGQKAGLYRRMYEPDCRSHLKVKLKEEVAWVHCL 537

>KNAG0F02660 Chr6 complement(498120..499754) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 148/641 (23%), Positives = 250/641 (39%), Gaps = 126/641 (19%)

Query: 12  EFTKFIKATSKTFSQ-FQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKV 70
           +FT   K T +   + F NL +KKK E  K+ +  Y  P  C  CNG I  C CDL++KV
Sbjct: 2   KFTSVFKQTKEAVKERFVNLAKKKKKEDFKLDVSCYVRPTGCNICNGIIPHCCCDLLQKV 61

Query: 71  AKNEVILESAALSAYL--RKLAGLDCPTDGKKEAGIEVDVSENHDCTSKNPCNSTFFPDT 128
              ++  +   L AYL  ++L         ++E+   +  +     + ++  N  +  +T
Sbjct: 62  NSGDIEADEN-LIAYLHEQELIRRSIIEQQERESCETITDNSEEVMSIQSSMNWRYNSET 120

Query: 129 SSVYSEHVTMSVKDLDKTPTPSNTIDWGIPNPYIDPAAESSFITVPADSSFIHILTEFLS 188
           SS     VT ++  L                 Y+ P        +P  SS   ++ E L 
Sbjct: 121 SSTVESPVTATINSL-----------------YVVPL-------IPKVSSKKELMNERLK 156

Query: 189 DEPAKSLPIDLPVVSAFIDIPKINQSTNVLRLPTTSDTHTP--TNNGLSIAPGIMNDTIF 246
               K+L                N+S N  RL     TH P       SI P I  D   
Sbjct: 157 RSVEKTL----------------NKSVN--RLSVNVKTHEPFIVMPTASIVPTINFD--- 195

Query: 247 SPPTDDESSNTSGANNDNIITPPTSELHDTKALAIPEQAATQKRSIAISPSIACPGLPVN 306
             PT              +++ P+++ H      IP +  T K+  A SP++ C  LPV+
Sbjct: 196 --PT--------------VMSSPSAKAH------IPNEQVTAKKEPATSPNLVCE-LPVS 232

Query: 307 --------------SKIVCEDGCLASRLD----PKTQLIYERRLWKEIRTAVIGEYKQCD 348
                          K   ++G    ++D    PK     E   W+++      EY +C 
Sbjct: 233 PEQQQLWGQSSESYRKGKDKNGS-NDKMDKTHTPKILTTSELSYWQKVSNLARLEYTKCR 291

Query: 349 DIIKCIRVSSEDXXXXXXXXXXXXXXXXTNKVLQKIFKHSPRLTDGPSKA-ECSSTMSTA 407
           +I+  ++V  E+                +NK   +  K S ++     KA  C S +   
Sbjct: 292 EIVTDLKVGCEEYRKKN-----------SNKTTTRA-KASAKVKGLFKKALHCKSPV--- 336

Query: 408 DNKTRTASTEPEDVGDITTCSQIIERDDEFVFENPSGYTSAIVKYFKALQKEKETWSNYR 467
               + A++   + G++  C               +G  +A+V+Y  AL +EK T   Y+
Sbjct: 337 ----KGATSSKHNPGEVQCCG-------------FNGLATAMVRYEDALAREKNTCRKYK 379

Query: 468 HVLHELSMNDHLIEKSIHSVGGTGALPPELYKQIYDVTTRLYGKLELINGYQKKYTAIRT 527
             LH     D LI ++I++          +  ++  VT R+Y ++ LI   QK       
Sbjct: 380 RSLHNSVWFDELIRQNINANQHDSNASDVIKTELNGVTERMYNEMALIMKCQKNNLTAMV 439

Query: 528 QIGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQ 587
           ++G+CI  G  L+    S  D   R++     + +   V    H  L +L     D    
Sbjct: 440 RLGKCINYGYDLKLEHESTTDPVEREKLAVHCQVYNDKVAKHFHQHLDNLKKLQKDYKDA 499

Query: 588 ITLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNCL 628
           +     +  +K+ +Y ++ E DCR   ++ M E++AW  CL
Sbjct: 500 VVCFSRLIGQKAGLYRRMYESDCRSHLKVKMKEEVAWVQCL 540

>KNAG0E01550 Chr5 complement(309050..310390) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 96/180 (53%)

Query: 439 FENPSGYTSAIVKYFKALQKEKETWSNYRHVLHELSMNDHLIEKSIHSVGGTGALPPELY 498
           +++P+G+T+A VKY+  + +E++ W  Y H L + S  D  + +++ +    G+    + 
Sbjct: 253 YDDPAGFTAAAVKYYTTVIREEKAWRKYAHSLGKSSRYDTHMRQNMEANHYNGSAANAVR 312

Query: 499 KQIYDVTTRLYGKLELINGYQKKYTAIRTQIGECIQAGRHLRQGIRSAKDATCRQQWEAE 558
             + ++T  ++ K+ LI+ Y +      TQ+ + +Q G  +R  +  +K+   +++ EAE
Sbjct: 313 TIVNEITENVWEKMSLIHKYHENNIHTLTQVKKDLQRGYEMRFVMEHSKNPALKRKVEAE 372

Query: 559 YRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRELDCRRPFQITM 618
           Y+  ++  L  LH  L+   DA+ +   ++     I  +K  +Y  + +LDCR P +I +
Sbjct: 373 YQLFKERELKNLHQVLQKAEDASKEHMTEVQRFSRIIAQKKALYKGIGQLDCRDPIEIKL 432

>KNAG0B05625 Chr2 (1096660..1097124) [465 bp, 154 aa] {ON}
          Length = 154

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 53/100 (53%)

Query: 529 IGECIQAGRHLRQGIRSAKDATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQI 588
           I  C++ GR LR  +  A DAT R++ + EY  ++  ++VKLH  L SL   +     ++
Sbjct: 4   ISRCLETGRQLRLTMEQAPDATSRRKAKGEYLLYKDRLMVKLHRVLDSLDMMDGRYASEV 63

Query: 589 TLVEDIAKEKSRIYLKVRELDCRRPFQITMTEKLAWSNCL 628
            L   +  EK  +Y ++  +D R    + + EK+AW  C+
Sbjct: 64  ELFLRLVSEKKEVYRRLHGMDLRHGIPVRVQEKIAWLRCM 103

>KNAG0B05460 Chr2 complement(1066639..1067694) [1056 bp, 351 aa]
          {ON} 
          Length = 351

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 13 FTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKVAK 72
          F    KAT+   + F+ +FQ+ K    K  ++ Y PP  C  CNG I  C CDL+ K+  
Sbjct: 7  FKNLTKATNFVTATFETVFQQNKSAAAKFDIDQYVPPDNCTICNGEISWCSCDLLMKINN 66

Query: 73 NEVILESAALSAYLRKL 89
          NEV  + A +  YL+++
Sbjct: 67 NEVEADDAVM-GYLKEM 82

>KNAG0M01510 Chr13 complement(267954..268487) [534 bp, 177 aa]
          {ON}
          Length = 177

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 12 EFTKFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKVA 71
          +FT   K T +    F NL +K+K +V ++ +  Y  P  C  CN  I  C  DL++KV 
Sbjct: 2  KFTSVFKRTKEAL--FVNLVKKEKKQVPELDISCYVRPTGCNICNDIIPHCCYDLLQKVN 59

Query: 72 KNEVILESAALSAYLRK 88
            E I  +  L AYL +
Sbjct: 60 NGE-IAANDDLIAYLHE 75

>KNAG0K01643 Chr11 (341746..342012) [267 bp, 88 aa] {ON} no start
           codon; gene extends into a gap in the genome sequence
          Length = 88

 Score = 35.0 bits (79), Expect = 0.075,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 36/81 (44%)

Query: 548 DATCRQQWEAEYRDHEKSVLVKLHTALKSLVDANLDCDHQITLVEDIAKEKSRIYLKVRE 607
           D   R++     + +   V    H  L +L     D    +     +  +K+ +Y ++ E
Sbjct: 4   DPVEREKLAVHCQVYNDKVAKHFHQHLDNLEKLQKDYKDAVICFSRLIGQKAGLYRRMYE 63

Query: 608 LDCRRPFQITMTEKLAWSNCL 628
            DCR   ++ + E++AW +CL
Sbjct: 64  PDCRSHLKVKLKEEVAWIHCL 84

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 26/110 (23%)

Query: 494 PPELYKQIYDVTTRLYGKLELINGYQ-----KKYTAIRTQIGECIQA---GRHLRQGIRS 545
           PPE  K+I D    LYG LE I         K+ T +  +    +QA   GR     ++ 
Sbjct: 246 PPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGR-----VKL 300

Query: 546 AKDATCRQQWEAEYR-------------DHEKSVLVKLHTALKSLVDANL 582
           A++A  R +WE +YR             ++ K V   L  +L  LV  +L
Sbjct: 301 ARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDL 350

>CAGL0H03949g Chr8 (368426..369616) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P33309 Saccharomyces cerevisiae
           YNL001w DOM34
          Length = 396

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 400 CSSTMSTADNKTRTASTEPEDVGDITTCSQIIERDDEFVFE 440
            S T  +A+ +  T    PED  D+ T  QII++DDE +F+
Sbjct: 4   ISITKDSANKEGATIVLLPEDKEDLFTVHQIIDKDDEVIFK 44

>NCAS0B03110 Chr2 complement(536705..541201) [4497 bp, 1498 aa] {ON}
           Anc_8.381 YDR180W
          Length = 1498

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 15  KFIKATSKTFSQFQNLFQKKKVEVTKIKLEDYTPPAECIYCNGRIIGCVCDLVRKVAKNE 74
           +F+K  S   S F+ L+ ++ +  T +KL ++    E    N  IIG V D + K+ K E
Sbjct: 617 EFVKVNSTRMSNFKYLWNQRYI--TLLKLRNFAETKEEEDSNRTIIGIVEDELSKLNKEE 674

Query: 75  VILES 79
           +I+ +
Sbjct: 675 LIVNA 679

>SAKL0E13244g Chr5 complement(1092314..1093618) [1305 bp, 434 aa]
           {ON} similar to uniprot|P53870 Saccharomyces cerevisiae
           YNL193W Hypothetical ORF
          Length = 434

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 19  ATSKTFSQFQNLFQKKKVEVTKIKLEDY---TPPAECIYCNGRIIGCVCDLVRKVAKNEV 75
           A +KT  Q QNL  +K+ E+   KL+D      P     C+  II    +L R V K  +
Sbjct: 291 ALNKTLQQAQNLLSEKRTEIVSAKLKDSENELSPLVFKLCDVLIIRSDNELRRWVIKKSM 350

Query: 76  ILESAA 81
           +  +AA
Sbjct: 351 LQSAAA 356

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,257,862
Number of extensions: 3059137
Number of successful extensions: 11643
Number of sequences better than 10.0: 105
Number of HSP's gapped: 12066
Number of HSP's successfully gapped: 128
Length of query: 632
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 516
Effective length of database: 40,180,143
Effective search space: 20732953788
Effective search space used: 20732953788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)