Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H020202.284ON59259228290.0
KAFR0H033302.284ON36931212871e-174
Skud_14.3092.284ON63933312661e-167
TDEL0G021502.284ON66131112481e-164
NCAS0G038102.284ON66131412481e-164
YNL020C (ARK1)2.284ON63830612391e-163
Smik_14.3112.284ON63734512391e-163
Suva_14.3272.284ON63234512351e-163
NDAI0G006402.284ON62131212291e-162
Kwal_27.115422.284ON79131512421e-161
SAKL0E07722g2.284ON79131512321e-160
NCAS0B062602.284ON72331112211e-159
KLLA0E08405g2.284ON77731112151e-158
KAFR0J013702.284ON78032512141e-157
Suva_9.1042.284ON80531212141e-157
NDAI0B035602.284ON75631112091e-157
TPHA0C033802.284ON69731612031e-157
YIL095W (PRK1)2.284ON81032112061e-156
Smik_9.842.284ON80832012011e-155
Kpol_1003.352.284ON71331211911e-155
KLTH0G10318g2.284ON79031511871e-153
ZYRO0A01848g2.284ON70433611781e-153
Skud_9.782.284ON80931211841e-153
CAGL0G02607g2.284ON68831111691e-152
CAGL0J03432g2.284ON62232111591e-151
TBLA0B059302.284ON71733511391e-147
ADL217W2.284ON75032411111e-142
Kpol_1039.332.284ON70131910981e-141
Ecym_33232.284ON74831311001e-141
KNAG0A054302.284ON78831610421e-132
TBLA0B069402.284ON144334010771e-131
TPHA0D015402.284ON7073289761e-123
KNAG0J008203.273ON10913228014e-94
SAKL0D03234g3.273ON8583157747e-92
CAGL0H10208g3.273ON10273207783e-91
TBLA0E025903.273ON10613267794e-91
KAFR0A010403.273ON9123417725e-91
Kpol_251.43.273ON8383147614e-90
KAFR0C004303.273ON9493227658e-90
NDAI0A057003.273ON11573267651e-88
Kpol_1052.223.273ON11013157621e-88
Suva_4.2973.273ON11073197604e-88
Smik_2.1913.273ON11083197579e-88
KLTH0C07260g3.273ON9013087471e-87
Skud_2.1793.273ON10903197523e-87
NCAS0A105903.273ON10953187515e-87
Kwal_27.109453.273ON9353087438e-87
ZYRO0E06864g3.273ON11153227455e-86
YBR059C (AKL1)3.273ON11083197445e-86
KLLA0F18612g3.273ON8143177308e-86
Ecym_26503.273ON8943077348e-86
KNAG0H012203.273ON9133267341e-85
TPHA0A040303.273ON10543277401e-85
AGR027C3.273ON9613077361e-85
CAGL0K11990g3.273ON9913247352e-85
TPHA0M011203.273ON7883147201e-84
TDEL0D035203.273ON10493177242e-83
TBLA0I019303.273ON13613167075e-80
SAKL0A03344g6.262ON3643552352e-20
Ecym_21536.262ON3633482316e-20
KNAG0F002901.52ON11253322386e-20
KLTH0H03080g6.262ON3463352281e-19
Kwal_56.242746.262ON3462612262e-19
KAFR0A050906.31ON6682412332e-19
KNAG0E008506.31ON7112762305e-19
Kpol_1037.206.31ON7043132279e-19
SAKL0C01716g1.52ON12153282271e-18
Kpol_1065.36.222ON3762782202e-18
TDEL0G043806.31ON7222752252e-18
TPHA0F024306.31ON7982742243e-18
KAFR0C014403.92ON10952722235e-18
AFL101C6.222ON3672792141e-17
Skud_16.426.262ON3643342131e-17
Kpol_1023.266.31ON7392762181e-17
TPHA0J004206.31ON7073132181e-17
Suva_16.706.262ON3643472131e-17
Ecym_21946.222ON3662862122e-17
KLTH0D05566g2.479ON11282182182e-17
Smik_4.7891.52ON11363302172e-17
KLLA0C01650g1.52ON11123372172e-17
KNAG0F029006.31ON6493102152e-17
Skud_4.7831.52ON11353302172e-17
TDEL0A067506.262ON3723022112e-17
YPL236C (ENV7)6.262ON3643322103e-17
KLTH0H03982g6.222ON3981992113e-17
KLLA0C06138g6.31ON7082752153e-17
TBLA0B082503.92ON13472172154e-17
Kpol_1072.198.668ON8961962144e-17
NDAI0C026806.31ON7502792135e-17
AFR696C1.52ON11422312145e-17
KLTH0C10912g6.31ON6972762118e-17
KAFR0D041001.52ON11173362128e-17
Suva_2.6871.52ON11283302121e-16
NCAS0B044906.222ON3491942051e-16
KLTH0F16676g5.406ON8782882101e-16
Kpol_1012.68.654ON6282552091e-16
CAGL0J11638g6.31ON7462772092e-16
SAKL0H06754g8.668ON8841972092e-16
ZYRO0E07876g6.262ON3693342042e-16
ZYRO0C07480g6.31ON7742752082e-16
KNAG0F001701.24ON5431982072e-16
NCAS0D021006.31ON7262792082e-16
TBLA0A071501.52ON13913292083e-16
NDAI0A006601.52ON10222362073e-16
YAR019C (CDC15)3.177ON9743212073e-16
YDR507C (GIN4)1.52ON11423302074e-16
NCAS0C041008.141ON9053692064e-16
Smik_6.4416.262ON3643342014e-16
Skud_3.391.52ON10172472065e-16
Suva_3.1901.52ON10242382065e-16
Kwal_33.131121.24ON5052432026e-16
CAGL0J03872g8.654ON6612032046e-16
KLLA0F13552g2.479ON12671992056e-16
Smik_13.1596.31ON7052762047e-16
Ecym_35863.92ON10772052047e-16
Smik_1.793.177ON9743212048e-16
Kwal_26.77882.479ON12672022048e-16
CAGL0I07513g3.92ON10762522048e-16
Ecym_73922.479ON14342012048e-16
NCAS0A002801.24ON5352802028e-16
TDEL0C064901.52ON11532302049e-16
YCL024W (KCC4)1.52ON10372372039e-16
KAFR0G026906.31ON7132762029e-16
Kwal_56.224766.31ON6972762021e-15
CAGL0M02299g8.668ON8932862031e-15
Ecym_30356.31ON7402802021e-15
Skud_1.723.177ON9743212031e-15
NDAI0F045201.24ON4892852001e-15
Kwal_55.215455.406ON8652732021e-15
TDEL0A025502.479ON13692002031e-15
Ecym_10581.52ON11643282031e-15
SAKL0E01584g6.31ON6952762011e-15
Smik_3.541.52ON10322372021e-15
ACL006W6.31ON7082802011e-15
SAKL0E02860g2.479ON13772982021e-15
Kpol_2002.241.24ON4872641992e-15
Skud_4.7643.92ON7562632012e-15
KAFR0G012001.24ON5072671992e-15
TDEL0D053203.92ON10572232002e-15
NCAS0B086001.52ON11172382003e-15
ABL034W2.479ON14253492003e-15
YKL101W (HSL1)2.479ON15182222003e-15
Skud_13.1546.31ON7052761983e-15
TBLA0I011502.479ON17451982003e-15
YMR001C (CDC5)6.31ON7052761983e-15
Suva_13.1636.31ON7052761983e-15
TPHA0P010503.92ON11212881993e-15
Suva_16.1608.668ON9181971984e-15
YPL150W8.668ON9011991984e-15
TDEL0C067801.24ON4682851955e-15
KLTH0F01672g1.52ON11642661985e-15
KLTH0D10714g8.654ON8722311975e-15
CAGL0K05709g1.52ON11032381985e-15
Suva_11.1232.479ON15262221976e-15
NDAI0E023908.668ON8831951966e-15
NCAS0C049403.92ON11162261967e-15
KAFR0D032002.479ON14481951967e-15
YDR490C (PKH1)3.92ON7662091957e-15
Smik_11.1392.479ON15342221968e-15
AFR335C3.92ON10331971968e-15
TPHA0E036401.52ON11372261968e-15
ZYRO0F07194g8.668ON9381971951e-14
NCAS0C016708.668ON8961981941e-14
NDAI0E012908.654ON7292341941e-14
Kpol_431.92.479ON15521931951e-14
KLTH0C09548g3.92ON9932031941e-14
Smik_4.7673.92ON7582101941e-14
Kwal_56.240916.222ON3811941901e-14
TBLA0A020506.222ON4342081911e-14
ZYRO0B06512g3.92ON11112261941e-14
TDEL0A061408.668ON8612851931e-14
Skud_11.1262.479ON15182211941e-14
Kwal_56.226933.92ON9842051931e-14
Suva_2.6663.92ON7642051931e-14
Skud_16.1328.668ON9241991932e-14
TBLA0B004906.31ON7872771922e-14
Kpol_1072.298.654ON8932061932e-14
NDAI0F016006.222ON4122011892e-14
KNAG0A065402.479ON14322301932e-14
ZYRO0G03366g2.479ON16161931932e-14
CAGL0M02519g8.654ON7562571922e-14
CAGL0K08514g2.479ON14891981922e-14
Suva_1.863.177ON9743251912e-14
YPL209C (IPL1)6.222ON3672281873e-14
TDEL0E053106.222ON3742021873e-14
ZYRO0F18062g1.24ON4712711883e-14
Skud_4.7971.24ON4852061883e-14
Kwal_26.87098.654ON8292311903e-14
YDR523C (SPS1)1.24ON4902061884e-14
SAKL0H07084g8.654ON9192701904e-14
Smik_4.8031.24ON4902061874e-14
KNAG0D008306.262ON3873661864e-14
Suva_2.7031.24ON4851931875e-14
Kwal_26.87518.668ON8481991895e-14
YHR205W (SCH9)4.384ON8242941895e-14
KAFR0K002806.222ON3602131845e-14
TDEL0A060008.654ON7902821885e-14
Smik_8.2954.384ON8242941885e-14
TBLA0A106904.384ON9692861886e-14
TBLA0A074601.24ON5161881866e-14
ZYRO0F17402g1.52ON11892421887e-14
KLLA0E21693g5.406ON10162331887e-14
KAFR0A037308.654ON7882081878e-14
CAGL0G04609g3.92ON9652901879e-14
Skud_8.2724.384ON8352941861e-13
TPHA0E028206.222ON3842021821e-13
KAFR0H025408.654ON8172781861e-13
NDAI0G042903.92ON11132731861e-13
SAKL0C00946g1.24ON5642801841e-13
KAFR0D012207.86ON10551971851e-13
TPHA0E038501.24ON4821921831e-13
ACR119W8.654ON9312531852e-13
AFR724C1.24ON4402791822e-13
KAFR0D033902.496ON7982721842e-13
Ecym_10301.24ON4402801822e-13
Kpol_1055.242.496ON9372661842e-13
KLLA0B02332g6.222ON3611861802e-13
TPHA0C001604.384ON7542861842e-13
Skud_15.543.92ON10822281842e-13
Suva_15.4114.384ON8152941842e-13
NCAS0A057702.479ON14611921842e-13
ACR133C8.668ON8511951832e-13
ZYRO0F06842g8.654ON8433051832e-13
SAKL0G01848g5.406ON8851981833e-13
Ecym_83398.654ON9202531823e-13
KNAG0D002106.371ON8332071823e-13
KLTH0D11044g8.668ON8491971823e-13
KNAG0M001904.384ON7922871823e-13
Kpol_2002.461.52ON11233301833e-13
YOL100W (PKH2)3.92ON10812281823e-13
Skud_15.3998.654ON8072031823e-13
CAGL0E05720g6.222ON3582331783e-13
TPHA0D011408.654ON6222381813e-13
SAKL0A04246g6.222ON4002081793e-13
Suva_15.653.92ON10802221823e-13
Ecym_60406.371ON8962831814e-13
ZYRO0E07018g6.222ON3671921774e-13
KNAG0A030408.654ON6442261804e-13
Skud_16.706.222ON3671921774e-13
Smik_6.3478.668ON9171991814e-13
Kpol_1054.23.92ON10962601814e-13
TPHA0G016308.668ON8712011815e-13
TBLA0B038608.668ON9882031815e-13
YCR091W (KIN82)6.371ON7201961805e-13
KNAG0D048107.86ON14401991806e-13
YOR233W (KIN4)8.654ON8002101797e-13
Smik_6.4146.222ON3671921757e-13
NDAI0D034204.384ON8012901788e-13
Suva_8.2848.654ON8082001789e-13
ZYRO0D05500g7.86ON12622001799e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02020
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...  1094   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   500   e-174
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   492   e-167
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   485   e-164
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   485   e-164
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   481   e-163
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   481   e-163
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   480   e-163
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    478   e-162
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   483   e-161
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   479   e-160
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   474   e-159
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   472   e-158
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   472   e-157
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   472   e-157
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   470   e-157
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   468   e-157
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   469   e-156
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   467   e-155
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   463   e-155
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   461   e-153
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   458   e-153
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   460   e-153
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   454   e-152
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   451   e-151
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   443   e-147
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   432   e-142
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   427   e-141
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   428   e-141
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   405   e-132
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   419   e-131
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   380   e-123
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   313   4e-94
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   302   7e-92
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   304   3e-91
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   304   4e-91
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   301   5e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   297   4e-90
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   299   8e-90
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   299   1e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   298   1e-88
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   297   4e-88
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   296   9e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   292   1e-87
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   294   3e-87
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   293   5e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   290   8e-87
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   291   5e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   291   5e-86
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   285   8e-86
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   287   8e-86
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   287   1e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   289   1e-85
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   288   1e-85
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   287   2e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   281   1e-84
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   283   2e-83
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   276   5e-80
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    95   2e-20
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    94   6e-20
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    96   6e-20
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    92   1e-19
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    92   2e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             94   2e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    93   5e-19
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    92   9e-19
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    92   1e-18
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    89   2e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    91   2e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    91   3e-18
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    91   5e-18
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    87   1e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    87   1e-17
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    89   1e-17
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    89   1e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    87   1e-17
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    86   2e-17
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    89   2e-17
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    88   2e-17
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    88   2e-17
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               87   2e-17
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    88   2e-17
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    86   2e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    86   3e-17
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    86   3e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    87   3e-17
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    87   4e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    87   4e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    87   5e-17
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    87   5e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    86   8e-17
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    86   8e-17
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    86   1e-16
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     84   1e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    86   1e-16
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    85   1e-16
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    85   2e-16
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    85   2e-16
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    83   2e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    85   2e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    84   2e-16
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      85   2e-16
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    85   3e-16
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     84   3e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    84   3e-16
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    84   4e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     84   4e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    82   4e-16
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    84   5e-16
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    84   5e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    82   6e-16
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    83   6e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    84   6e-16
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    83   7e-16
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    83   7e-16
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    83   8e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    83   8e-16
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    83   8e-16
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    83   8e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        82   8e-16
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    83   9e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    83   9e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    82   9e-16
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    82   1e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    83   1e-15
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    82   1e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    83   1e-15
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    82   1e-15
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    82   1e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    83   1e-15
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    83   1e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    82   1e-15
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    82   1e-15
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    82   1e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    82   1e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    81   2e-15
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    82   2e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    81   2e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    82   2e-15
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    82   3e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    82   3e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    82   3e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    81   3e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    82   3e-15
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    81   3e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    81   3e-15
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    81   3e-15
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    81   4e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    81   4e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    80   5e-15
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    81   5e-15
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    80   5e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    81   5e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    80   6e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    80   6e-15
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    80   7e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    80   7e-15
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    80   7e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    80   8e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    80   8e-15
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    80   8e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    80   1e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    79   1e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    79   1e-14
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    80   1e-14
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    79   1e-14
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    79   1e-14
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    78   1e-14
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               78   1e-14
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    79   1e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    79   1e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    79   1e-14
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    79   1e-14
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    79   1e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    79   2e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    79   2e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    79   2e-14
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    77   2e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    79   2e-14
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    79   2e-14
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    79   2e-14
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    79   2e-14
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    78   2e-14
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    77   3e-14
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    77   3e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    77   3e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    77   3e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    78   3e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    77   4e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    78   4e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    77   4e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    76   4e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    77   5e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    77   5e-14
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    77   5e-14
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    75   5e-14
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    77   5e-14
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    77   5e-14
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    77   6e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    76   6e-14
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    77   7e-14
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    77   7e-14
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    77   8e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    77   9e-14
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    76   1e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    75   1e-13
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    76   1e-13
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    76   1e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    75   1e-13
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    76   1e-13
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    75   1e-13
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    76   2e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    75   2e-13
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    75   2e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    75   2e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    75   2e-13
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    74   2e-13
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    75   2e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    75   2e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    75   2e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    75   2e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    75   2e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    75   2e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    75   3e-13
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    75   3e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    75   3e-13
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    75   3e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    75   3e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    75   3e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    75   3e-13
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    75   3e-13
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    73   3e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   3e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   3e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    75   3e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    74   4e-13
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    73   4e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    74   4e-13
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    73   4e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    74   4e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    74   4e-13
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    74   5e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    74   5e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    74   5e-13
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    74   6e-13
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    74   7e-13
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    72   7e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     73   8e-13
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    73   9e-13
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    74   9e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    73   9e-13
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    74   1e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    73   1e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    73   1e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    73   1e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    73   1e-12
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    72   1e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    73   1e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    73   1e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    73   1e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    73   1e-12
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    73   1e-12
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    73   1e-12
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    73   1e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    73   1e-12
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    72   2e-12
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    72   2e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    72   2e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    72   2e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    73   2e-12
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    73   2e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     72   2e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    72   2e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     72   2e-12
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    72   2e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    72   2e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    71   2e-12
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     72   2e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    72   2e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    72   2e-12
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    72   2e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   2e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    72   2e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    72   2e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   3e-12
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    72   3e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    72   3e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    72   3e-12
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    71   3e-12
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    72   3e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               72   3e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   3e-12
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    72   3e-12
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    71   3e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    72   3e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    71   3e-12
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    72   3e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     71   4e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    70   4e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    72   4e-12
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    71   4e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    71   4e-12
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    71   4e-12
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    70   4e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    71   4e-12
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    71   4e-12
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    71   4e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    71   4e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    71   5e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    71   5e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    71   5e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    71   5e-12
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    71   5e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    71   5e-12
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    71   6e-12
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    70   6e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    70   6e-12
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    70   6e-12
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    71   6e-12
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    71   7e-12
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    71   7e-12
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   7e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    70   7e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    70   7e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    70   8e-12
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    70   8e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    70   8e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    70   8e-12
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    70   8e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    70   8e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    70   9e-12
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    70   9e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    70   1e-11
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    70   1e-11
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    70   1e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    70   1e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    70   1e-11
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    70   1e-11
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    70   1e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    70   1e-11
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    69   1e-11
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    70   1e-11
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    70   1e-11
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    70   1e-11
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       69   1e-11
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    70   1e-11
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    69   1e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    69   1e-11
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    69   1e-11
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    70   1e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    69   2e-11
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    70   2e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    68   2e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   2e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   2e-11
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    69   2e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    69   2e-11
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    69   2e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    69   2e-11
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    69   2e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    69   2e-11
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    69   2e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    69   2e-11
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    69   2e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    69   2e-11
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    69   2e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    68   2e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    69   2e-11
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    69   2e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    69   2e-11
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    67   3e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    68   3e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    68   3e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    69   3e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    69   3e-11
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    69   3e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    69   3e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    69   3e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    69   3e-11
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    68   3e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    69   3e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    68   3e-11
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    68   3e-11
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    68   3e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    68   4e-11
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    68   4e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    68   4e-11
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    68   4e-11
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    68   4e-11
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    68   4e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    68   4e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    68   5e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    67   5e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    67   6e-11
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    67   6e-11
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    67   6e-11
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    67   6e-11
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    67   6e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    67   6e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    67   6e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    67   6e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    67   6e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    67   7e-11
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    67   7e-11
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    66   7e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    67   7e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    67   7e-11
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    67   8e-11
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    67   8e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    67   8e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    66   1e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    67   1e-10
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    67   1e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    66   1e-10
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   1e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    65   1e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    66   1e-10
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    67   1e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    66   1e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    67   1e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    66   1e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   1e-10
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    66   1e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    66   1e-10
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    66   1e-10
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    66   1e-10
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    66   1e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    66   1e-10
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    66   2e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    66   2e-10
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    66   2e-10
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    66   2e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    66   2e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    66   2e-10
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    66   2e-10
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    66   2e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    66   2e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    66   2e-10
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    66   2e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    65   2e-10
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    65   2e-10
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    66   2e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    65   2e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    65   2e-10
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    66   2e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   2e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     64   2e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    64   2e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   3e-10
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    65   3e-10
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    65   3e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    64   3e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    65   3e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    65   3e-10
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    65   3e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    65   3e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    65   3e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    64   3e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     65   3e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    65   3e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    64   3e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    64   3e-10
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    65   3e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    65   3e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    64   4e-10
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    65   4e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    65   4e-10
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    65   4e-10
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    65   4e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    65   4e-10
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    64   4e-10
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    65   4e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    64   4e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    64   4e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    64   4e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    65   4e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    64   4e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    65   4e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    65   5e-10
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    65   5e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    64   5e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   5e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    64   5e-10
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   5e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   5e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   5e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    64   5e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    64   5e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    64   5e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    64   5e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    64   5e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    64   5e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    64   5e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    64   6e-10
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    64   6e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    64   6e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    64   6e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    64   6e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    64   6e-10
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     63   6e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     64   6e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    64   7e-10
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    63   7e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     63   7e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    64   7e-10
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    63   7e-10
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    64   8e-10
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    64   8e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    64   8e-10
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    64   8e-10
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    64   9e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   9e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    63   9e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    64   1e-09
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    64   1e-09
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    64   1e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    63   1e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    63   1e-09
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    63   1e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    63   1e-09
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    64   1e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    63   1e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    62   1e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    63   1e-09
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    63   1e-09
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    62   1e-09
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    63   1e-09
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    62   1e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    63   1e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    63   1e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   1e-09
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    63   1e-09
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    63   1e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    62   1e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    63   1e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    62   1e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    63   2e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               63   2e-09
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    62   2e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    62   2e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    62   2e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    62   2e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    62   2e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    63   2e-09
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    63   2e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    62   2e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    62   2e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    62   2e-09
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    62   2e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   2e-09
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    62   2e-09
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    63   2e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    63   2e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    63   2e-09
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    63   2e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    62   2e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    62   2e-09
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              63   2e-09
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              63   2e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    62   2e-09
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    61   2e-09
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    61   2e-09
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    62   2e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    62   2e-09
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    62   2e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    62   3e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               61   3e-09
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    61   3e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    62   3e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    62   3e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    61   3e-09
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    62   3e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    61   3e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    61   3e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    62   3e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    62   3e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    61   3e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    61   4e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    61   4e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    62   4e-09
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    62   4e-09
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    62   4e-09
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    61   4e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    61   4e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    61   4e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              61   4e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    61   4e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    62   4e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    62   4e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    61   4e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    61   4e-09
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    62   4e-09
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    62   4e-09
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    60   4e-09
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    61   5e-09
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    61   5e-09
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    60   5e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    61   5e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    60   5e-09
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    61   5e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    61   5e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    60   5e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    60   5e-09
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    61   5e-09
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    61   6e-09
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    61   6e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    60   6e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    61   6e-09
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    61   6e-09
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    61   6e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    60   6e-09
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    60   6e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    60   6e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    61   6e-09
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    61   7e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    61   7e-09
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    60   7e-09
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    60   7e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    60   7e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    60   8e-09
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    60   8e-09
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    60   8e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   8e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    60   8e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    61   8e-09
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    60   8e-09
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    60   8e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    61   8e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    60   9e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   9e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     60   9e-09
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    60   9e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    60   1e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   1e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    60   1e-08
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    60   1e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    60   1e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    60   1e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    60   1e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    60   1e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    59   1e-08
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    60   1e-08
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    60   1e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    60   1e-08
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    60   1e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    60   1e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    60   1e-08
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    60   1e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    59   1e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    59   1e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    60   1e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    60   1e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    60   1e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    60   1e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    60   1e-08
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    59   1e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    59   2e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    59   2e-08
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    59   2e-08
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    60   2e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    59   2e-08
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    59   2e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    59   2e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   2e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   2e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    59   2e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    59   2e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    59   2e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    59   2e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    59   2e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    59   2e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   2e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               59   2e-08
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    59   2e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    59   2e-08
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       59   2e-08
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    59   2e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    58   2e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    59   2e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               58   2e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    59   2e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    59   3e-08
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    59   3e-08
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    58   3e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     59   3e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   3e-08
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    59   3e-08
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    59   3e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    58   3e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    59   3e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    59   3e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    59   3e-08
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    59   3e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    59   3e-08
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    59   3e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     58   3e-08
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    58   3e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    59   3e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    58   3e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    58   3e-08
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    59   3e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    59   3e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      59   3e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               58   3e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    59   4e-08
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    59   4e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   4e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    58   4e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    58   4e-08
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    57   4e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    59   4e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    59   4e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    58   4e-08
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    58   4e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    58   4e-08
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    58   4e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   4e-08
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    58   4e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    58   5e-08
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    58   5e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    58   5e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    58   5e-08
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    57   5e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    58   5e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   5e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   5e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    57   5e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    57   6e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    58   6e-08
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    57   6e-08
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    58   6e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    57   6e-08
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    58   6e-08
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    58   6e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    58   6e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    58   6e-08
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    57   6e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    58   6e-08
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    57   7e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    57   7e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    57   7e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    57   7e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   7e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    57   7e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    57   7e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    57   7e-08
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    57   7e-08
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    57   7e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    57   7e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    57   7e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    57   8e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    57   8e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   8e-08
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    57   8e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    57   8e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    57   8e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    57   8e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    57   8e-08
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    57   8e-08
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    57   8e-08
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    57   9e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    57   9e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   9e-08
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     57   9e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    57   9e-08
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    57   9e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    57   9e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    57   9e-08
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    57   9e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    57   9e-08
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    56   1e-07
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    57   1e-07
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    57   1e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   1e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   1e-07
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    57   1e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    56   1e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    57   1e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    57   1e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   1e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    57   1e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    57   1e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    57   1e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    57   1e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    56   1e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    56   1e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    56   1e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    56   1e-07
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    56   1e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    56   1e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    57   1e-07
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    57   1e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    56   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    55   1e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    56   1e-07
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    55   2e-07
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    56   2e-07
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    56   2e-07
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    55   2e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    56   2e-07
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    56   2e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    56   2e-07
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    56   2e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    55   2e-07
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    56   2e-07
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    56   2e-07
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    56   2e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    56   2e-07
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    55   2e-07
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       56   2e-07
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    56   2e-07
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    56   2e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    55   2e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    56   2e-07
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    55   2e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    56   2e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    56   2e-07
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    56   2e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    56   2e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    56   2e-07
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    55   2e-07
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    55   2e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    56   2e-07
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    55   2e-07
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    56   2e-07
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    56   2e-07
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    55   2e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    55   3e-07
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    55   3e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    55   3e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    55   3e-07
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    55   3e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    55   3e-07
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    55   3e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   3e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    55   3e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    55   3e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    55   3e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   3e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    55   3e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    55   3e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    55   3e-07
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    55   3e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    55   3e-07
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    54   4e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    55   4e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    55   4e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    55   4e-07
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    54   4e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    55   4e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   4e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   4e-07
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    55   4e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    55   4e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    55   4e-07
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    55   4e-07
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     55   4e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    55   4e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    55   4e-07
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    55   4e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    55   5e-07
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    54   5e-07
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    54   5e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    54   5e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   5e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    54   5e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    51   5e-07
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    54   5e-07
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    55   6e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    55   6e-07
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    54   6e-07
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    54   6e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   6e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    54   6e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    54   6e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   6e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    54   6e-07
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    54   6e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    54   6e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    54   6e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              54   6e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    54   6e-07
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    54   7e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    54   7e-07
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    54   7e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    54   7e-07
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    54   7e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    54   7e-07
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    53   7e-07
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    54   7e-07
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    54   7e-07
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    53   8e-07
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    54   8e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     54   8e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    54   8e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    54   8e-07
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    54   9e-07
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    54   9e-07
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    54   9e-07
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    54   9e-07
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    54   9e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    54   9e-07
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    54   9e-07
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    53   9e-07
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    54   1e-06
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    54   1e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    54   1e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    53   1e-06
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    54   1e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    54   1e-06
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    53   1e-06
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    54   1e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     54   1e-06
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    54   1e-06
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    53   1e-06
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    52   1e-06
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    53   1e-06
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    53   1e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    53   1e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    53   1e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              54   1e-06
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    54   1e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    53   1e-06
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    54   1e-06
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    54   1e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    53   1e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    53   1e-06
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    53   1e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    53   1e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    53   1e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    53   1e-06
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    52   1e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              53   1e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    53   1e-06
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    52   2e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    53   2e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              54   2e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    53   2e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    53   2e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    53   2e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   2e-06
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    53   2e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    53   2e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    53   2e-06
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    52   2e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    53   2e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    53   2e-06
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    53   2e-06
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    52   2e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    53   2e-06
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    52   2e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   2e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   2e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    53   2e-06
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    52   2e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    53   2e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    52   2e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    53   2e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    53   2e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    53   2e-06
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    53   2e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    53   2e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    52   2e-06
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    52   2e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    52   2e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    52   2e-06
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    53   2e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    53   2e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    53   2e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    53   2e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    53   2e-06
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    52   2e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    52   2e-06
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    52   2e-06
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    52   2e-06
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    53   2e-06
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    52   2e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    52   2e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    52   2e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    52   2e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    52   2e-06
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    52   2e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   2e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   2e-06
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    53   2e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    52   2e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    52   3e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    51   3e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    53   3e-06
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    52   3e-06
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    52   3e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    52   3e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    52   3e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    52   3e-06
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    52   3e-06
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    52   3e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    52   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   3e-06
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    52   3e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   3e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    52   3e-06
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    52   3e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    52   3e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    52   3e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    52   3e-06
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    52   3e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    51   3e-06
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    51   3e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    52   3e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    52   3e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             52   3e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   3e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    52   3e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    52   3e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    52   3e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    52   3e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    52   3e-06
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    52   3e-06
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    51   3e-06
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    52   3e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   3e-06
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    52   3e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    52   3e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    52   3e-06
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    52   3e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    52   4e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    52   4e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    52   4e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   4e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    52   4e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    52   4e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   4e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    52   4e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    52   4e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    52   4e-06
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    51   4e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    52   4e-06
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    52   4e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    51   4e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    51   4e-06
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    52   4e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    52   4e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    52   4e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    52   4e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    51   4e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    52   4e-06
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    52   4e-06
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    52   5e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    51   5e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    51   5e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    51   5e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    51   5e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    51   5e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    52   5e-06
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    51   5e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    51   5e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    51   5e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    51   6e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    51   6e-06
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    51   6e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    51   6e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    50   6e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    51   6e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    51   6e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    51   6e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    51   6e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    51   6e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              51   6e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    51   6e-06
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    51   6e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    51   6e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    51   6e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    51   7e-06
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    51   7e-06
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    51   7e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    51   7e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    51   7e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    51   7e-06
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    51   7e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    50   7e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    51   7e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    51   7e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    50   7e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    51   7e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    50   7e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              51   7e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    51   7e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    51   8e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    50   8e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    50   8e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    51   8e-06
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    50   8e-06
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    51   8e-06
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    50   8e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    50   8e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    51   8e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    51   8e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              51   8e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    50   9e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    50   9e-06
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              50   9e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    51   9e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    51   9e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    50   1e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    50   1e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   1e-05
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    51   1e-05
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    51   1e-05
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    50   1e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    50   1e-05
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    49   1e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    50   1e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    51   1e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    50   1e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    50   1e-05
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    50   1e-05
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    49   1e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   1e-05
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    49   1e-05
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    50   1e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    50   1e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    50   1e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    49   1e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   1e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    50   1e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    50   1e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    50   1e-05
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    50   1e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    50   1e-05
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    50   1e-05
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    50   1e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    50   1e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   1e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    50   1e-05
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    49   1e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    50   1e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    49   1e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    50   1e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    50   1e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    49   1e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    49   1e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   1e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    50   1e-05
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    50   1e-05
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    50   1e-05
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    50   1e-05
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    50   1e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    50   2e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    50   2e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    50   2e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    50   2e-05
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    50   2e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    50   2e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    50   2e-05
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    49   2e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    50   2e-05
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    48   2e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     50   2e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   2e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   2e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    50   2e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   2e-05
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    49   2e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    50   2e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   2e-05
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    50   2e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    50   2e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   2e-05
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    50   2e-05
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    50   2e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    49   2e-05
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    49   2e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    50   2e-05
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    49   2e-05
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    49   2e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    49   2e-05
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     49   2e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    49   2e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    49   2e-05
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    49   2e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    49   2e-05
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    49   2e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    49   2e-05
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    49   2e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    49   2e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    49   2e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    49   2e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    49   2e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    49   2e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    49   2e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    49   2e-05
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    49   2e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    49   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    49   2e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   2e-05
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    49   2e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    49   2e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    49   2e-05
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    49   2e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    49   3e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    49   3e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   3e-05
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    49   3e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    49   3e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   3e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    49   3e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    49   3e-05
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    49   3e-05
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    49   3e-05
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    49   3e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    49   3e-05
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    49   3e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    49   3e-05
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    49   3e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    49   3e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   3e-05
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    49   3e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    49   3e-05
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    49   3e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    48   3e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    49   3e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    49   3e-05
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    49   3e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    49   3e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    48   3e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    49   3e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   3e-05
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    49   3e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    49   3e-05
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    49   3e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   3e-05
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    49   3e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    49   3e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    49   3e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    49   4e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    49   4e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    49   4e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    49   4e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    49   4e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               49   4e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    49   4e-05
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    48   4e-05
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    48   4e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   4e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    49   4e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    49   4e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    49   4e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    49   4e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    48   4e-05
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    48   4e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   4e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   4e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    49   4e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    48   4e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    49   4e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    48   4e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    48   4e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    47   4e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   5e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    48   5e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    48   5e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    48   5e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     48   5e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    48   5e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   5e-05
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    47   5e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    48   5e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    48   5e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    48   5e-05
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    48   5e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    48   5e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    48   5e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    48   5e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   5e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    47   5e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    48   5e-05
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    48   6e-05
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    48   6e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    48   6e-05
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    48   6e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    47   6e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    48   6e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    47   6e-05
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    48   6e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    48   6e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   6e-05
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    48   6e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    48   6e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    48   7e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    48   7e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    48   7e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     48   7e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    48   7e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    48   7e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    48   7e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    48   7e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    48   7e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   7e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    48   7e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    48   7e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   7e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    48   7e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    48   7e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   7e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    47   8e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    47   8e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    47   8e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      48   8e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    47   8e-05
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    47   8e-05
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    47   8e-05
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    48   8e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    47   8e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    48   9e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    47   9e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   9e-05
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    47   9e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    47   9e-05
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    47   9e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    47   9e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    47   9e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    47   9e-05
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    47   9e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   9e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   9e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    47   9e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    47   9e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               47   1e-04
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    47   1e-04
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    47   1e-04
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    47   1e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    47   1e-04
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    47   1e-04
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    47   1e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       47   1e-04
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    47   1e-04
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    47   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    47   1e-04
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    47   1e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    47   1e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    47   1e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    47   1e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    47   1e-04
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    47   1e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    47   1e-04
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    47   1e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    47   1e-04
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    46   1e-04
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    47   1e-04
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    47   1e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    46   1e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    47   1e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    47   1e-04
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    47   1e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    47   1e-04
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    47   1e-04
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    47   1e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   1e-04
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    47   1e-04
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    47   1e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    47   1e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   1e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   1e-04
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    47   1e-04
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    47   1e-04
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    47   1e-04
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    47   1e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    47   2e-04
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    47   2e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   2e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    47   2e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    46   2e-04
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    47   2e-04
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    47   2e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    47   2e-04
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    46   2e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    46   2e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    46   2e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    46   2e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    47   2e-04
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    46   2e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    47   2e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    46   2e-04
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    46   2e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    46   2e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    47   2e-04
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    46   2e-04
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    46   2e-04
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    46   2e-04
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    47   2e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    47   2e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    46   2e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    46   2e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    46   2e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   2e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    46   2e-04
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    46   2e-04
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    46   2e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   2e-04
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    46   2e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               46   2e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    45   2e-04
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    46   2e-04
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    45   2e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   2e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    46   2e-04
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    46   2e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    46   2e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   2e-04
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    46   2e-04
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    46   2e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    46   2e-04
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    46   3e-04
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    46   3e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    46   3e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    45   3e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    46   3e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    45   3e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    46   3e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    46   3e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    46   3e-04
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    45   3e-04
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    45   3e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      46   3e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    46   3e-04
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    46   3e-04
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    46   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   3e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    46   3e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    46   3e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    46   3e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    45   3e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    46   3e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     45   3e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    45   3e-04
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    45   3e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    45   3e-04
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    45   3e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   4e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    45   4e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    45   4e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    45   4e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    45   4e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    45   4e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    45   4e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    45   4e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    45   4e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    45   4e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    45   4e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    45   4e-04
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    45   4e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    45   4e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    45   4e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   4e-04
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    45   4e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   4e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     45   4e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    45   4e-04
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    45   4e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    45   4e-04
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    44   5e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    45   5e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    45   5e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   5e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    44   5e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    45   5e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    45   5e-04
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    45   5e-04
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    45   5e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    45   5e-04
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    45   5e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   6e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    45   6e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   6e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    44   6e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   6e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    45   6e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    45   6e-04
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    45   6e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    44   6e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    44   6e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    44   7e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    44   7e-04
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    44   7e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    44   7e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    44   7e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   8e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    44   8e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    44   8e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    44   8e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   8e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    44   8e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    44   8e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    44   8e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    44   9e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    44   9e-04
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    44   0.001
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    44   0.001
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    44   0.001
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    44   0.001
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    44   0.001
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    44   0.001
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    44   0.001
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    44   0.001
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    44   0.001
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    44   0.001
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    43   0.001
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    44   0.001
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    44   0.001
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    44   0.001
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    43   0.001
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    44   0.001
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    44   0.001
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    44   0.001
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    43   0.001
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.001
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    44   0.001
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    44   0.001
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    44   0.001
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    43   0.001
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    43   0.001
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    44   0.002
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    43   0.002
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    43   0.002
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    44   0.002
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    44   0.002
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.002
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    43   0.002
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    43   0.002
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    43   0.002
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    43   0.002
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    43   0.002
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               43   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    43   0.002
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    43   0.002
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    43   0.002
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    43   0.002
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    43   0.002
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    43   0.002
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    43   0.002
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    43   0.002
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    42   0.002
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    42   0.002
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    43   0.002
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    43   0.003
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    43   0.003
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.003
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    42   0.003
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    42   0.003
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    42   0.003
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    42   0.003
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.003
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.004
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    42   0.004
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    42   0.004
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.004
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    42   0.004
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.004
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    42   0.004
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.004
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.004
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    42   0.004
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    42   0.004
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    42   0.004
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     42   0.004
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    42   0.004
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    42   0.004
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    42   0.004
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.004
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    42   0.004
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.005
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    42   0.005
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.005
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    42   0.005
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    41   0.005
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.005
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    42   0.005
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    42   0.006
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    42   0.006
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    41   0.006
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    41   0.006
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.006
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    41   0.007
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    41   0.007
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    42   0.007
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.007
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    41   0.007
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    41   0.007
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    41   0.007
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    41   0.008
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    41   0.008
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    41   0.008
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    41   0.009
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    41   0.009
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    41   0.010
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    40   0.011
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    41   0.011
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    40   0.012
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    41   0.012
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    40   0.012
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    40   0.012
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    40   0.013
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    40   0.013
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.013
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    40   0.014
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    40   0.014
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    40   0.015
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    40   0.015
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    40   0.016
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    40   0.016
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    40   0.017
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    40   0.017
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    40   0.018
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    40   0.018
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    40   0.019
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    40   0.019
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    40   0.019
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    40   0.019
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    39   0.021
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    40   0.021
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    40   0.021
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               40   0.021
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    40   0.022
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    39   0.022
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    40   0.022
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    40   0.022
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    40   0.022
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    40   0.023
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    40   0.024
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    40   0.024
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    40   0.024
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.024
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    40   0.025
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    40   0.025
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    39   0.026
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.026
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    39   0.027
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    39   0.027
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.027
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 39   0.027
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    39   0.028
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    39   0.029
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    39   0.030
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.030
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    39   0.033
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    39   0.034
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    39   0.036
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    39   0.036
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    39   0.036
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    39   0.036
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    39   0.036
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    39   0.038
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    39   0.041
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    39   0.041
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.042
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.042
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    39   0.044
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    39   0.045
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    39   0.045
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.047
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    39   0.048
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    39   0.049
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    39   0.051
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.053
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    38   0.054
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    38   0.059
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    38   0.059
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    38   0.060
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    38   0.061
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    38   0.063
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    38   0.065
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    38   0.067
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    38   0.067
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    38   0.067
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               38   0.072
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    38   0.077
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    38   0.077
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    38   0.079
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               38   0.079
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    38   0.081
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    38   0.081
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    38   0.088
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    38   0.089
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               38   0.095
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    38   0.095
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    37   0.098
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    37   0.098
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               37   0.099
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    37   0.099
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.11 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    37   0.11 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    37   0.11 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.11 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    37   0.12 
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    37   0.12 
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    37   0.12 
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    37   0.12 
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    37   0.12 
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    37   0.13 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    37   0.13 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    37   0.13 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    37   0.14 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.14 
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    37   0.15 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    37   0.15 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    37   0.15 
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    37   0.15 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.15 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    37   0.16 
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    37   0.16 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    36   0.16 
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    37   0.17 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    37   0.18 
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    37   0.18 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    37   0.18 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.19 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    37   0.19 
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    37   0.19 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    37   0.19 
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    37   0.19 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.19 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    36   0.21 
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    36   0.21 
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    37   0.22 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    36   0.23 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    36   0.23 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    37   0.24 
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    36   0.24 
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      36   0.25 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    36   0.26 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    36   0.27 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    36   0.27 
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    36   0.27 
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    36   0.27 
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    36   0.29 
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    36   0.29 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    36   0.29 
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    36   0.33 
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    36   0.33 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    36   0.36 
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    36   0.40 
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    35   0.40 
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    35   0.45 
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    35   0.47 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    35   0.47 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    35   0.49 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      35   0.51 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    35   0.53 
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    35   0.53 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.54 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    35   0.55 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    35   0.58 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    35   0.59 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    35   0.59 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.63 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.70 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    35   0.71 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    34   0.75 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               34   0.76 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    35   0.85 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    34   0.88 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    34   0.99 
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    34   1.3  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    34   1.4  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    34   1.5  
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    33   1.7  
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    33   1.8  
KLTH0F13002g Chr6 complement(1073202..1076012) [2811 bp, 936 aa]...    33   1.8  
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    33   1.9  
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    33   2.1  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    33   2.4  
TPHA0B01840 Chr2 complement(412955..413563) [609 bp, 202 aa] {ON...    32   2.6  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    33   2.9  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    32   3.9  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    32   4.8  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   5.1  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    32   5.7  
Kwal_55.20890 s55 complement(599142..601958) [2817 bp, 938 aa] {...    32   5.7  
Kpol_387.10 s387 complement(24504..26423) [1920 bp, 639 aa] {ON}...    31   10.0 

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/592 (91%), Positives = 539/592 (91%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NISCPIINFYLKPNMTDASNNIQHLHSIMNNTNTSTXXXXXXXXXXXXXXXXXXXXXXXX 360
           NISCPIINFYLKPNMTDASNNIQHLHSIMNNTNTST                        
Sbjct: 301 NISCPIINFYLKPNMTDASNNIQHLHSIMNNTNTSTVQIQQQQLQLQLRQQQQVKVCRQQ 360

Query: 361 TPSQIEAPQLYMVTGSGDPLSNESLEGADMPVLSRSRSSGALKPMALNSHRKYYEHNLNN 420
           TPSQIEAPQLYMVTGSGDPLSNESLEGADMPVLSRSRSSGALKPMALNSHRKYYEHNLNN
Sbjct: 361 TPSQIEAPQLYMVTGSGDPLSNESLEGADMPVLSRSRSSGALKPMALNSHRKYYEHNLNN 420

Query: 421 QPQTPALPEKSQRQVLNKPIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPPNANKRLG 480
           QPQTPALPEKSQRQVLNKPIV                             LPPNANKRLG
Sbjct: 421 QPQTPALPEKSQRQVLNKPIVLEDIDLSSSSEDDDTEGSSIDDNIINSINLPPNANKRLG 480

Query: 481 GRRSVSIFNPKNDTDLKHITKANEKSKESSGPKKVFSKEEVRKRMMEKLKEKDKGKNTTE 540
           GRRSVSIFNPKNDTDLKHITKANEKSKESSGPKKVFSKEEVRKRMMEKLKEKDKGKNTTE
Sbjct: 481 GRRSVSIFNPKNDTDLKHITKANEKSKESSGPKKVFSKEEVRKRMMEKLKEKDKGKNTTE 540

Query: 541 PVSRSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRVQDISDAINSK 592
           PVSRSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRVQDISDAINSK
Sbjct: 541 PVSRSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRVQDISDAINSK 592

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  500 bits (1287), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/312 (73%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I TY  GT L VGSHQV+IIKY+T+GGFAQIY   ISP D F  +NIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMKLLRNN+ VVSYIDSHA+KS+F NG+YEVFLLMEYCE GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL ESEV++I   V+QG+AAMHALQPPL+HRDIKIENVL+SK+N++K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IRPP NPQEL  VQ+D+++NTTAQYRSPEMID  RG PIDEKSDIWA+GVFLYK+C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           YYTTPFEK+ GEA IL++RYE+P FP YS+RL+HLI  +L   P+ RPNIY V++E+S M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 KNISCPIINFYL 311
           +N+ CPI+NFYL
Sbjct: 301 QNVPCPIVNFYL 312

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  492 bits (1266), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/333 (67%), Positives = 267/333 (80%), Gaps = 1/333 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+I+KYLT+GGFAQ+Y   ISP DP S +NIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAM+LLRNNR VVSYIDSHAAK+   NG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E E++ IM  V+QGVAAMHALQPPL+HRDIKIENVL+S NNE+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP NPQEL+ VQ DI +NTTAQYRSPEM+D+ RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL+  +EFP +P YS++LR LI  +L   P  RPN+Y ++K +S M+
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NISCPIINFYLKPNMTDASNNIQHLHSIMNNTN 333
           N+ CPI +  + P   D+  N+  LH +    N
Sbjct: 301 NVPCPISDIQV-PQAPDSHLNLTELHQLSATQN 332

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  485 bits (1248), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 258/311 (82%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I  Y  GT LTVGSH  ++I YLT+GGFAQ+Y   I P D F  +N+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMKLLRNN+ VVSYIDSHAAKSSF NG+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL+E E++NIM  V+QG+AAMHALQPPL+HRDIKIENVL+S   ++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP NPQE A VQ+D+++NTTAQYRSPEMID+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL SR++FPA P YSDRL+ LI ++L   P+ RPN+  V++++S M+
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NISCPIINFYL 311
            I CP+ NFYL
Sbjct: 301 GIQCPVRNFYL 311

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 3/31 (9%)

Query: 554 PKGPPVPHKPDRLRPVLPSKPAFLSGKRVQD 584
           P+ PP   KP  LRP  P KPAFLSGK++ D
Sbjct: 604 PRAPP---KPAHLRPKPPPKPAFLSGKKMVD 631

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  485 bits (1248), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 262/314 (83%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I  Y  GT LTVGSH+VQ++KYLT+GGFAQIY   ISP D F+ TN+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVD MKLLRNN  VVSYIDSHAAK +   G+YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQ RL+E E++NIM  V+QG+AAMHAL PPL+HRDIKIENVLL+   E+K+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPPSN QE++ VQ+DIM+NTTAQYR+PEMID+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GEA IL + ++FP +P YSDRL+ LI+ +L  QP+ RPN Y V++E+S M+
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NISCPIINFYLKPN 314
           N+ CPI NFYL  N
Sbjct: 301 NVQCPIPNFYLMNN 314

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 18/112 (16%)

Query: 473 PNANKRLGGRRSVSIFNPKNDTDLKHITKANEKSKESSGPKKVFSKEEVRKRMMEKLK-E 531
           P++ K +  +  +S   P          K+N KS E +       K  ++++M+EKL   
Sbjct: 567 PDSTKPIASKSEISFAEPA--------VKSNSKSNEET-------KILIKQKMLEKLNAS 611

Query: 532 KDKGKNTTEPVSRSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRVQ 583
           +++ K  + P   SI     + PK P VP KP  LRP +P KPAFLS ++++
Sbjct: 612 QNQFKKKSIPDGDSIHKN-DQTPK-PKVPSKPAHLRPKVPKKPAFLSSQKIK 661

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  481 bits (1239), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/306 (70%), Positives = 257/306 (83%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   I+P DP S +++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAM+LL+NNR VVSYIDSHAAK+   NG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E E++ IM  V+QGVAAMHALQPPL+HRDIKIENVL+S NNE+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP N QEL+ VQ DI++NTTAQYRSPEMID  RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK G+  IL+ ++EFP +P YS++L+ LI  +L   P HRPN+Y ++K +S M+
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NISCPI 306
           N+ CPI
Sbjct: 301 NVPCPI 306

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  481 bits (1239), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 275/345 (79%), Gaps = 13/345 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   ISP DP + TN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAM+LL+NNR VVSYIDSHAAK+  QNG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E E++ I+  V+QGVAAMHALQPPL+HRDIKIENVL+S NNE+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IR P N QEL+ VQ DI++NTTAQYRSPEMID+ RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL+ ++EFP +P YS++L+ LI  +L   P HRP+++ ++K +S M+
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NISCPI--INFYLKP----NMTD-----ASNNIQHL--HSIMNNT 332
           N+ CPI  I     P    N+T+     A+ NIQ L  H +M N+
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNS 345

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  480 bits (1235), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 224/345 (64%), Positives = 274/345 (79%), Gaps = 13/345 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I TY  GT LTVGSHQV+IIKYLT+GGFAQ+Y   ISP DP + +N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLN LRAEVDAMKLLRNNR VVSYIDSHAAK++  NG+YEVF+LMEYCE GGLI+F
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL ESE++ IM  V+QGVAAMHALQPPL+HRDIKIENVL+S  NE+KLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP NPQEL+ V+ D+++NTTAQYRSPEM+D+ RG PIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL  ++EF  +P YS++LR+LI KLL   P+ RPN++ ++K++++M+
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NISCPIINF-----------YLKPNMTDASNNIQHL--HSIMNNT 332
           N   PI +             ++ +   A+ NIQ L  HSI  N+
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENS 345

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  478 bits (1229), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/312 (69%), Positives = 261/312 (83%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP ++ Y  GT L+VGSHQ +IIKYLT+GGFAQ+Y   ISPIDPF  ++I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMKLLRNN  VVSYIDSHAAK     G+YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E+E+++IM  VSQGVAAMHALQPPL+HRDIKIENVLL+    +KLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP+NPQE   VQ+DIM+NTTAQYRSPEMI++ +G PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GE  IL + ++FP FP YSDR++ LI   L VQP+ RPNIY +++E+S ++
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NISCPIINFYLK 312
           N+ CPI +FYL+
Sbjct: 301 NVPCPIPDFYLQ 312

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 263/315 (83%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP+   Y QGT LTVGSHQ +IIKYLT+GGFA IY   ISP DP S  N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLNVLRAEVDAMKLLR N+ VVSYIDSHAAKS  Q+G+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E+EV+ IM  ++QG+AAMHAL PPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP N QE + VQNDI++NTTAQYRSPEMID+ RG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK G+A IL SR++FPA+P YSDRL++LIS +L+  PN RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NISCPIINFYLKPNM 315
           N+ CP+ NFYL  +M
Sbjct: 301 NVPCPLRNFYLLRSM 315

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  479 bits (1232), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 264/315 (83%), Gaps = 1/315 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           M+QP + TYP GT LTVGSH+ +IIKYLT+GGFA IY   ISP DP S ++IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMKLL+ ++ VVSYIDSHAAKSS  NG+YEVFLLMEYC  GGLI+F
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRLKE EV+ IM  VSQGVAAMHALQPPL+HRDIKIENVL+S++  FK+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP NPQEL  VQ+DI++NTTAQYRSPEMID+ RG P+DEKSDIWALGVFLYK+C
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GE  IL S+++FPA+P YSD+L++LIS LL   P  RPNI  ++ E+S ++
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NISCPIINFYLKPNM 315
            + CP+ NFYL+  M
Sbjct: 300 GVPCPVKNFYLERKM 314

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  474 bits (1221), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 258/311 (82%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQPNI TYP GT LTVGSH  +IIKYLT+GGFAQIY T ISPI+P++ +  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK  LN LRAEVDAMKLL+NNR VVSYIDSHAA+S+   G YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E E++NI+    QGV+AMHALQP L+HRDIKIENVL+S   EFK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V   IRPP NPQELA VQ+D+++NTTAQYR+PEM+D+ RG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GEA IL SRY++PAFP Y+D+L++LI   L   P+ RPNI  +++E+S ++
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NISCPIINFYL 311
            I CPI NFYL
Sbjct: 301 GIPCPINNFYL 311

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  472 bits (1215), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/311 (69%), Positives = 252/311 (81%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I  Y  GT L VGSHQV+++KYL +GGFA +Y   ISP DP    N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLN LRAEVD+MK LR N+ +VSYIDSHA KS    G YEV+LLMEYC  GGLI+F
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL+E E++NIM  VSQGVAAMHALQPPL+HRDIKIENVLLSKN+EFKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IR P N +E   VQ DIM+NTTAQYR PEMID+ RG PIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GE+ IL S++EFPA+P YSDR+++LIS +L V P  RPNI  VV+E+S ++
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NISCPIINFYL 311
            I CPI NFYL
Sbjct: 301 GIPCPIKNFYL 311

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 266/325 (81%), Gaps = 1/325 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P I T+P G  LTVGSH  ++IKYLT+GG+AQ+Y+  ISP DP+  +NIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMKLL+NNR VVSYIDSHA+KS+  NG YEVF+LME+CE GGLI+F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +NSRLQ+RL E+E++ IM   SQG+AAMH LQP L+HRDIKIENVL+S+NNE+K+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G +RPP N QE   V +DIM+NTTAQYRSPEM+D+S+G PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           YYTTPFEK+ GEA IL +R+++P++P YSDRL++LI  +L+  P+ RPN+  V++E+S +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 KNISCPIINFYLKPNMTDASNNIQH 324
           + I CPI NFYL   M +    I+ 
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQ 325

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 555 KGPPVPHKPDRLRPVLPSKPAFLSGKRV 582
           K PPVP+K D L+P  P+KPAFLS + V
Sbjct: 719 KKPPVPYKRDSLKPTPPAKPAFLSSRPV 746

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/312 (70%), Positives = 257/312 (82%), Gaps = 3/312 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP+S  NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNG-TYEVFLLMEYCENGGLIN 119
           PDK  LN LRAEVDAMKLL+NN+ VVSYIDSHAAKS   NG  YEVF+LMEYCE GGLI+
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179
           F+N+RL+NRL+ESE+++IM    QG+AAMHALQPPL+HRDIKIENVL+S    +K+CDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239
           SVSG IRPP NPQE   VQ+DI+ NTTAQYRSPEMID+ RG PIDEKSDIWALGVFLYKI
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           CYYTTPFEK+GEA IL +RY++P+FP YSDRL++LI  +L   P+ RPNI  V++E+S +
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 KNISCPIINFYL 311
           +N  CPI NFYL
Sbjct: 299 QNRPCPIRNFYL 310

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  470 bits (1209), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/311 (68%), Positives = 258/311 (82%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQPNI  YP GT LTVG+H+  I KYLT+GGFAQIY   I+P+D +S +N+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           P K  LN LRAEVDAMKLL+NNR VVSYIDS+A KS+F NG+YEV LLMEYCE GGLI+F
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +NSRLQNRL E+E++NI+   +QGVA MHALQP L+HRDIKIENVL S N EFKLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP N QEL+ VQ+DI++NTTAQYR PEM+D+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GE  IL S++++PAFP YSDRL++LI  +L+  P  RPNI ++++E+S ++
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NISCPIINFYL 311
            + CPI NFYL
Sbjct: 301 GVPCPIQNFYL 311

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 530 KEKDKGKNTTEPVS--RSISTTPRKAPKGPPVPHKPDRLRPVLPSKPAFLS 578
           +EKD  + ++  ++    I ++P+KAP   P+P KP  LRP  P KP +LS
Sbjct: 670 REKDSLRYSSVVINPLEDIGSSPKKAP---PLPFKPHHLRPKPPPKPTYLS 717

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  468 bits (1203), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 258/316 (81%), Gaps = 4/316 (1%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I  Y  G  L VGSHQ +I+KYLT+GGFAQ+YQ  ISP D  SG+NIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKS----SFQNGTYEVFLLMEYCENGG 116
           PDK SLNV RAEV+AMKLLRNN+ VVSYIDSHAAKS       NG+YEVFLLMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176
           LI+F+N+RLQNRLKE E++NIM  VSQGVAAMHALQPPL+HRDIKIENVL+S  NEFKLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236
           DFGSV G IRPP+N  EL  VQ+DI++NTTAQYRSPEM+ +S+  PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
           YK+CYYTTPFEK GE  IL SRY++PA+P YSD L++LI  +L V P+ RPNI  VV+E+
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SDMKNISCPIINFYLK 312
           S ++ + CP+ NFYL+
Sbjct: 301 SRLQGVPCPLKNFYLE 316

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  469 bits (1206), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/321 (68%), Positives = 258/321 (80%), Gaps = 3/321 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP+S  NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNG-TYEVFLLMEYCENGGLIN 119
           P K  LN LRAEVDAMKLLRNN+ VVSYIDSHAA+S   NG  YEVF+LME+CE GGLI+
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179
           F+N+RLQNRL+ESE++ IM    QG+ AMHALQPPL+HRDIKIENVL+S +  +K+CDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239
           SVSG IRPP N QE   VQ+DI+ NTTAQYRSPEMID+ RG PIDEKSDIWALGVFLYKI
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           CYYTTPFEKSGEAGIL +RY++P+FP YSDRL++LI  +L   P+ RPNI  V++E+S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 KNISCPIINFYLKPNMTDASN 320
           +N  CPI NFYL   M   +N
Sbjct: 299 QNKPCPIRNFYLLRAMNQNAN 319

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  467 bits (1201), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/320 (68%), Positives = 258/320 (80%), Gaps = 3/320 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP++  NIACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGT-YEVFLLMEYCENGGLIN 119
           PDK  LN LRAEVDAMKLL+NN+ VVSYIDSHAAKS   NG  YEVF+LME+CE GGLI+
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179
           F+N+RLQNRL+ESE++ IM    QG+AAMHALQPPL+HRDIKIENVL+S N  +K+CDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239
           SVSG IRPP N QE   VQ+DI+ NTTAQYRSPEMID+ RG PIDEKSDIWALG+FLYKI
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           CYYTTPFEKSGEAGIL +RY++P FP YSDRL++LI  +L   P+ RPNI  V++E+S +
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 KNISCPIINFYLKPNMTDAS 319
           +   CPI NFYL   M+  +
Sbjct: 299 QIKPCPIRNFYLLRAMSQTA 318

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  463 bits (1191), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 212/312 (67%), Positives = 258/312 (82%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP+I TYPQG +L VG H   I+KYLT+GG+AQ+YQ  ISP D  +G++I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLN  RAEVDAMKLLRN   VVSYIDS+AAKS   NG YEV LLME+C  GGLI+F
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL+E E++NIM  V+QGVAAMH+L+PPL+HRDIKIENVL+S + E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP++ QE   VQ+DI++NTTAQYR+PEMID+SR  PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK+GEA IL SRYE+ A+P YSD L++LI  +LA QP+ RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NISCPIINFYLK 312
            I CPI NFYL+
Sbjct: 301 GIPCPIKNFYLE 312

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 532 KDKGK--NTTEPVSRSISTT---PRKAPKGPPVP-HKPDRLRPVLPSKPAFLSGKRVQD 584
           KD G+  N  E +  + S T   P+K  K  PVP  KP  LRP  P KP FL+GKR  D
Sbjct: 623 KDSGEEMNDKENIKTANSGTRNQPKKNKKEKPVPAKKPAHLRPQKPPKPTFLAGKRKLD 681

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  461 bits (1187), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 253/315 (80%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQ     Y  GT LTVGSH+ +IIKYLT+GGFA IY   I P D  S   IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLNVLRAEVDAMKLLR N+ VVSYIDSHAAKS   +G+YEVFLLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL+E EV+ I   ++QG+AAMHALQPPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP NPQE   VQ+DI++NTTAQYR+PEMID+ RG+PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GEA IL SR++FP++P YSD L+HLIS +L+  P  RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NISCPIINFYLKPNM 315
              CP+ NFY+   M
Sbjct: 301 GTPCPLRNFYVTRAM 315

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  458 bits (1178), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 215/336 (63%), Positives = 264/336 (78%), Gaps = 2/336 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P I TY  GT L+VG+H  +I+KY+ +GGFAQ+Y   + P D  +GTN  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           P+K  LN LRAEV+AMKLL+ ++ VV YIDSHAA+S  QNGTYEVFLLME+C  GGLI+F
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRLKE E++NIM  V+QG+AAMHALQPPL+HRDIKIENVL+S + E+K+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSGPIRPP NPQE A VQ+DI++NTTAQYRSPEMID+ R   IDEKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK G+  IL SRY+F A P YSDRL++LIS +L+ QP  RPNI  V++E+S M+
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NISCPIINFYLKPNM--TDASNNIQHLHSIMNNTNT 334
            +S P+ NFYL   M  T+ S +       M NTNT
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNT 336

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  460 bits (1184), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/312 (69%), Positives = 252/312 (80%), Gaps = 3/312 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP+S  N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNG-TYEVFLLMEYCENGGLIN 119
           PDK  LN LRAEVDAMKLL+NN+ VVSYIDSHAAKS   NG  YEVF+LME+CE GGLI+
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179
           F+N+RLQ+RL+ESE++ IM    QG+AAMH LQPPL+HRDIKIENVL+S +  +K+CDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239
           SVSG IRPP N QE   VQ+DI+ NTTAQYRSPEMID+ R  PIDEKSDIWALGVFLYKI
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           CYYTTPFEKSGEA IL SRY++P+FP YSDRL+ LI  +L   P+ RPNI  V++E+S +
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 KNISCPIINFYL 311
           +N  CPI NFYL
Sbjct: 299 QNEPCPIRNFYL 310

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  454 bits (1169), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/311 (67%), Positives = 253/311 (81%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP +     GT LTVG+H V+I+KYLT+GGFAQIY   I  +  F+G+N+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLN+LRAEVDAMKLL NN+ VVSYIDSHA +S   +GTYEVFLLMEYCE GGLI+F
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E E+++IM   +QG+A MHAL PPL+HRDIKIENVLLSK   +K+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IRPP N QEL  VQ+DIM+NTTAQYR PEM+D+ RG PIDEK+DIWALGVFLYK+C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL +R++FP+FP YSDRL++LI  +L   P+ RPN+  V++E+S M+
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NISCPIINFYL 311
           N+ CPI NFYL
Sbjct: 301 NVPCPIRNFYL 311

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  451 bits (1159), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 201/321 (62%), Positives = 261/321 (81%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MN P+I  Y  GTT+TVGSH V I+KYLT+GG+AQIY   I P D F GTN+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK  LN LRAEVDAMK L++++ +VSYIDSHAAKS + +GTYEVFL+MEYC  GGLI+F
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRL E+E++ I   +SQGVAAMH LQPPL+HRDIKIENVL+S ++++KLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IRPP  P+ELA V++DIM +TTAQYR+PEM+D+++GF +++KSDIWALGVFLYK+C
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFE++GEAGIL    EFP +P YSD ++ LI  +LA  P HRPNI+ +++ +S + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NISCPIINFYLKPNMTDASNN 321
           N++CPI N ++  +++ A +N
Sbjct: 301 NVNCPIPNIHVPTDISIAVSN 321

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  443 bits (1139), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 255/335 (76%), Gaps = 8/335 (2%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP+I  Y  GT L VG HQV IIKYLT+GGFAQIYQ  ++P +P +G N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           P+K  LN LRAEV+AM+LL+    VV YIDS+AA+S   +GTYEV  LME+C  GGLI+F
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N+RLQNRLKE EV+NIM  V+QG+ AMH+L PPL+HRDIKIENVL+S N E+K+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IRPP N +E   VQ DIM+NTTAQYR PEM+D+ RG PI+EKSDIWALGVFLYKIC
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFE  GE  IL +RY++P +P YS RL++LI  +L  +P  RPN+  V++E+S M+
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NISCPIINFYLKPNMTDASNNIQHLHSIMNNTNTS 335
            I CP+ NFYL+          Q    +MNNTN S
Sbjct: 301 GIPCPLPNFYLQRQ--------QATQLMMNNTNGS 327

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  432 bits (1111), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/324 (61%), Positives = 250/324 (77%), Gaps = 1/324 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQ        G  LTVGSH+V+II+YLT+GGFAQIY   +    P  G+ +ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDKPSLN LRAEVDAMK+L+ +R VVSYIDSHAAKS   +GTYEV+LLMEYC  GGLI+F
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +NSRLQ RL E EV+ IM  V+QG+ AMHAL PPL+HRDIKIENVL+S + +FK+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG IRPP N  E   VQ+DI++NTTAQYR+PEMID+ R  P+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           Y+TTPFEK GE  IL ++++FP++P Y+DRL++LIS +L+  P  RPNI  V++E+S ++
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NISCPIINFYLKPNMTDASNNIQH 324
            + CP+ NFYL+     A   + H
Sbjct: 300 GVPCPLPNFYLERMKHGACTPVHH 323

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  427 bits (1098), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/319 (59%), Positives = 252/319 (78%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQ  +  Y   T +TVGSH  +I+KYL +GG+AQ+Y   ++P+D    TNIACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           PDK SLN LRAEVDA+K+LRN + VVSYIDSHA+K S   G+YEVF+LMEYC  G LI+F
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           LN+RL+NRL+E E+++IM  V+ GVA MH LQP L+HRDIKIEN+L+S+N E+K+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           V G IRPP + +E+  +Q+DIM+NTTAQYRSPEM+D+++G+ I+EKSDIWALGVFL+K+C
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFEK GE  IL S++++PA+P YSD L+++I  LL+V P  RPNI  +++ELS ++
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NISCPIINFYLKPNMTDAS 319
            I  P+ NFYL   +  +S
Sbjct: 301 GIVPPMKNFYLSRALETSS 319

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  428 bits (1100), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/313 (63%), Positives = 251/313 (80%), Gaps = 3/313 (0%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGT-NIACLKRVI 59
           MNQ    ++  GT LTVGSH+V+++KYLT+GGFAQIY   +  I P S   ++ACLKRV 
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEV--ISPDSKVKDVACLKRVH 58

Query: 60  VPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLIN 119
           VPDK SLN LRAEVDAMKLLR N+ +VSYIDSHA+KS   NG+YEV LLMEYC  GGLI+
Sbjct: 59  VPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118

Query: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179
           F+N+RLQ+RLKE EV+ IM  V QG+ AMHALQPPL+HRDIKIENVL+++N + K+CDFG
Sbjct: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178

Query: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239
           SV G IRPP N  EL+ VQ+DI++NTTAQYR+PEMID+ RGF +DEKSDIWALGVFLYK+
Sbjct: 179 SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKL 238

Query: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           CYYTTPFEK+GE  IL + ++FP++P YS+RL++LI+ +LA  P HRPN   V++E+  +
Sbjct: 239 CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298

Query: 300 KNISCPIINFYLK 312
           +   CP+ NFYL+
Sbjct: 299 QGQPCPVKNFYLE 311

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  405 bits (1042), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 243/316 (76%), Gaps = 8/316 (2%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           MNQP I  YP G  + VGSHQ +I+KYLT+GGFAQIY   ISP D ++ +NIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           P+K  LNVLR EVDAMKLL+NNR VVSYIDS+AAKS F NG+YEVFLLMEYCE G L++F
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N++L+ RL+E EV+NIM  V QG+AAMH L PPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYK-- 238
           V G IRPP NPQEL  VQ+D+M+NTTAQYRSPEMID+ +GFPI+ K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --ICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
             + +YT  F +  E  IL  RY++PA+P YSDRL++++  LL+  P  RPNI  +++E+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SDMKNISCPIINFYLK 312
           S ++NI CPI NFYL+
Sbjct: 297 SKIQNIPCPIDNFYLE 312

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 550 PRKAPKGPPVPHKPDRLRPVLPSKPAFLSGKRV 582
           P K+   P VP KPD LRP  P KPA LS  ++
Sbjct: 719 PAKSKAPPVVPKKPDHLRPKPPKKPAHLSSLKI 751

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  419 bits (1077), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 197/340 (57%), Positives = 250/340 (73%), Gaps = 7/340 (2%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTN----IACLK 56
           MNQP I  Y +G  L +G+HQV I KYL  GGFAQ+Y   +  ID  +  N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58

Query: 57  RVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116
           RVIVPDK  LN LRAEVDAMKLL+ N+ +VSYIDSHA +S  + G YEVFLLMEYC  GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176
           +I+FLN+RL +RL+E E++ IM  V QGVAAMH LQPPL+HRDIKIENVL+S+N ++K+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236
           DFGS    +RPP  PQE A + +DIM NTTAQYRSPEMID   G+PIDEKSDIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
           YK+CYYTTPFEK GE  IL  +++FP++P YSD +R++I+ +L   P  RPNI  V++++
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SDMKNISCPIINFYL-KPNMTDASNNIQHLHSIMNNTNTS 335
           S ++ + CPI NF L +  + ++ NN     S+ + TN S
Sbjct: 299 SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNS 338

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  380 bits (976), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 177/328 (53%), Positives = 236/328 (71%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           M+Q     Y +GT L V SH+V I  YLT+GGFAQ+Y   I+         + CLKRVIV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
           P+K SLN+LRAEVDAMK+L+NN+ +VSYIDSHA +      +Y V LLMEYC   GL++F
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +N RL+ RLKE E++ IM  VSQGV  MH LQPPL+HRDIKIENVLLS +  FKLCDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           VSG +R P++ +E   +QNDI++NTTAQYRSPEM++++ GFPI+EKSDIWALG+ LYK+C
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           YYTTPFE+ G   I+  ++ +PA+P Y+D L+++I  LL+  P  RPNI  +++EL  ++
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 NISCPIINFYLKPNMTDASNNIQHLHSI 328
           + S P+ NFY++  M+    +    H I
Sbjct: 301 HKSSPLPNFYVQRAMSSLQMDTTQPHRI 328

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  313 bits (801), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 216/322 (67%), Gaps = 20/322 (6%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISP-IDPFSGTNI------------ 52
           I  +  G ++ VGSH V+I+KYLT GGFAQIY   ++  ++ F   +I            
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 53  --ACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
              CLKRV+V D+  L+ ++ EV+ MK LR    VV Y DS+A ++   NG +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
           YC N  L++++N RL  +L ESE++NIM+ ++ GV+ +H L  PL+HRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 NEFKLCDFGSVSGPIRPP--SNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSD 228
           N FKLCDFGS +  I PP  +  Q+++++ +DI  +TT QYRSPEMID+ R  P++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPN 288
           IWALGVFLYK+ +YTTPFE +G+  IL S+YE P    YS+RL +LI  +LA  PN RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 IYDVVKELSDMKNISCPIINFY 310
           IY V+ E+  + N+  PI + Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  302 bits (774), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 151/315 (47%), Positives = 204/315 (64%), Gaps = 9/315 (2%)

Query: 4   PNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI--------SPIDPFSGTNIACL 55
           P +     GT + VGSH+V+I+KYL  GGFA IY            +P       ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENG 115
           KRV+V D+  LN LR EV+ MK L+N+  +V Y DS+A++    +  YEV LLME C N 
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKL 175
            L++++N RL  +L E EV+ IM+ V++ VA MH L  PL+HRDIKIENVL+   N FKL
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVF 235
           CDFGS S      +  Q++AL+ N+I  +TT QYR+PEMID+ R  PIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKE 295
           LYK+ +YTTPFE +G+  IL S+Y+ PA   YS +L +LI  +LA  PN RPNIY V+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 LSDMKNISCPIINFY 310
           +  +  +  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  304 bits (778), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 213/320 (66%), Gaps = 11/320 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGT--------- 50
           +N PN   YP G  ++VG+H+V+I+ YL  GGFAQIY    +  ++ F            
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           +IACLKRVIV D+  LN +R EV+ MK L+++  +V Y DS+A++ +     +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
            C N  L++++N RL+ +L ESE++ IM+ VS G++ MH L  PL+HRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIW 230
           N FKLCD GS S    P  + Q++A++  +I  +TT QYR+PEMID+ R  PI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIY 290
           ALG+FLYK+ +YTTPFE +G+  IL S+Y+FP    YS ++ +LI  +LA  PN RPNI+
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 DVVKELSDMKNISCPIINFY 310
            VV  +  + N+  PI + Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  304 bits (779), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 21/326 (6%)

Query: 3   QPNI--STYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPID--------------- 45
           QPN     YP GT + VGSH+V++IKY+  GGFAQIY  T+  I+               
Sbjct: 91  QPNTLPGNYPAGTPVAVGSHKVEVIKYIAEGGFAQIY--TVKFIERLNEFASLPGGNQNQ 148

Query: 46  -PFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYE 104
            P    +IACLKRV+V D   LN +R EV+ M+ L+   CVV Y DS+A+  S     YE
Sbjct: 149 KPLQPGDIACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYE 208

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V LLME+C N  L++++N RL  RL E E++ IM+  + G+A +H L+ PL+HRDIKIEN
Sbjct: 209 VLLLMEFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIEN 268

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           VL+ + N FKLCDFGS S      +N +++A+   +I  NTT QYRSPEMID+ R  PID
Sbjct: 269 VLVDQENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPID 328

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPN 284
           EKSDIWALGVFLYK+ ++TTPFE++G+  IL S+YEFP    YS +L +LI  +LA  P+
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPS 387

Query: 285 HRPNIYDVVKELSDMKNISCPIINFY 310
            RPNIY V++ L  +     P+ + Y
Sbjct: 388 VRPNIYQVLQYLCSINGWKVPLNDKY 413

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  301 bits (772), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 162/341 (47%), Positives = 213/341 (62%), Gaps = 27/341 (7%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIYQ----------------TTISPIDPFSG-----T 50
           G  + VG H+V+IIKYL  GGFAQIY                 T  S ID F        
Sbjct: 22  GAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKLEPG 81

Query: 51  NIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           N+ACLKRV+VPD+  LN LR EV+ M+ L+    +V Y DS+A++    N  +EV LLME
Sbjct: 82  NLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLLLME 141

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
            C N  L++++N RL  +L E E++ IM+ V+ G++ MH LQ PL+HRDIKIENVL+  +
Sbjct: 142 LCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLVDSS 201

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIW 230
           N FKLCDFGS S      ++ QE+A++  +I  +TT QYRSPEMID+ R  PIDEKSDIW
Sbjct: 202 NNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKSDIW 261

Query: 231 ALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIY 290
           ALGVFLYK+ +YTTPFE +G+  IL S+YE P    YS RL +LI  +LA  PN RPNIY
Sbjct: 262 ALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPP-NNYSSRLINLIIIMLAENPNLRPNIY 320

Query: 291 DVVKELSDMKNISCPIINFY-LKP----NMTDASNNIQHLH 326
            V+ ++     I  PI + Y + P    N T   N +Q++ 
Sbjct: 321 QVMHQVCITIGIEPPIKDKYEMGPYDFENYTHFQNKLQNIQ 361

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  297 bits (761), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 205/314 (65%), Gaps = 10/314 (3%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT----ISPIDP-----FSGTNIACLK 56
           + +Y  GT + VG H+V+++KYL  GGFA+IY       +S +DP         +  CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116
           RV+V D   LN +R EV+ M+ L+   CVV Y DS+A++       YEV LLME C N  
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176
           L++++N RL  +L E E++ IM+ V+  VA MH L  PL+HRDIKIENVL+   N FKLC
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236
           DFGS S  +   S+ Q++A++  +I  +TT QYRSPEMID+ R  P++EKSDIWALGVFL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
           YK+ +YTTPFE++G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY V+ ++
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 SDMKNISCPIINFY 310
             +  I  P+ + Y
Sbjct: 325 CYISGIKNPMDDAY 338

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  299 bits (765), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 209/322 (64%), Gaps = 18/322 (5%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPF----SGTNI-------- 52
           I  + +G  L VG+H+V+I+ YLT GGFAQIY    I  ++ F    +G+N+        
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 53  ----ACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLL 108
               ACLKRV+V D+  LN +R EV+ MK LR    +V Y DS+A +S   N  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLS 168
           ME C N  L+N++N RL  +L E EV+ IM+ V+ GVA MH L+ PL+HRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 KNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSD 228
            NN FKLCDFGS +      +  Q++AL+  ++  +TT QYRSPEMID+ R  PI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPN 288
           IWALGVFLYK+ +YTTPFE +G+  +L S+++ PA   YS ++ +L+  +L+   N RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 IYDVVKELSDMKNISCPIINFY 310
           IY V+  +  +  +  PI++ Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  299 bits (765), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 205/326 (62%), Gaps = 25/326 (7%)

Query: 9   YPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGTN---------------- 51
           +P GT + VGSH+V+IIKY+  GGFAQIY    +  ++ F  +N                
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 52  -------IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYE 104
                  IACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V LLME C N  L++++N RL  +L E E++ IM+ ++  V+ MH L+ PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           VL+   N FKLCDFGS S  +   +  Q++AL+  +I  +TT QYRSPEMID+ R  PID
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPN 284
           EKSDIWALG+FLYK+ ++ TPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPN 322

Query: 285 HRPNIYDVVKELSDMKNISCPIINFY 310
            RPNIY V+  +  M N+  PI + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  298 bits (762), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 200/315 (63%), Gaps = 11/315 (3%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI----SPID------PFSGTNIACL 55
           +  +  G+T+ VG+ +V+I+KYLT GGFAQIY        +  D      P    ++ACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENG 115
           KRV+V D+  LN +R EV+ MKLL+    +V Y DS+A++       +EV LLME C N 
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 116 GLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKL 175
            L++F+N RL  +L E E++ IM  V+  VA MH L PPL+HRDIKIENVL+   N FKL
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 176 CDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVF 235
            DFGS S      S  Q++A++  DI  +TT QYRSPEMID+ +  PIDEKSDIWALG+F
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 236 LYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKE 295
           LYK+ +Y TPFE +G+  IL S+Y+FP    YS RL +LI  +L+  PN RPNIY V+ E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 296 LSDMKNISCPIINFY 310
           +  +      I + Y
Sbjct: 321 ICSISGTRLEITDKY 335

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  297 bits (760), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGT--------N 51
           M  P +  Y  G  + VG+H+V+I+ YL  GGFAQIY    +  ++ F  T        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
           C N  L++++N RL  +L ESE+V IM+ V+  ++ MH L  PL+HRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWA 231
            FKL DFGS S      +  Q++AL+  +I  +TT QYRSPEMID+ R  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYD 291
           LG+FLYK+ ++TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY 
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVKELSDMKNISCPIINFY 310
           V+  + D+ N   PI + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  296 bits (757), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT----ISPID-----PFSGTN 51
           M  P +  +  G  + VG+H+V++I YL  GGFAQIY       ++  D     P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
           C N  L++++N RL  +L ESE+V IM+ V   ++ MH L  PL+HRDIKIENVL+  NN
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWA 231
            FKL DFGS S      +  Q++AL+  +I  +TT QYRSPEMID+ R  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYD 291
           LG+FLYK+ ++TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY 
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVKELSDMKNISCPIINFY 310
           V+  L ++ NI  PI + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  292 bits (747), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 147/308 (47%), Positives = 198/308 (64%), Gaps = 10/308 (3%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIYQTTI---------SPIDPFSGTNIACLKRVIVPD 62
           G+ + VG+H+V+I+KYL  GGFA IY             +P         ACLKRV+V D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
           +  LN +R EV  MK L     +V Y DSHA++S      +EV LLME C N  L++++N
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            RL  +L E E++ IM+ V++ +A MH L  PL+HRD+KIENVL+  +N FKLCDFGS S
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 GPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYY 242
             +   +  QE+A++ N+I  +TT QYRSPEMID+ R  PIDEKSDIWALG+FLYK+ +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNI 302
           TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY ++  L  +  +
Sbjct: 272 TTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 SCPIINFY 310
             PI + Y
Sbjct: 331 ENPIEDKY 338

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  294 bits (752), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT----ISPID-----PFSGTN 51
           M  P +  Y  G  + VG+H+V+I+ YL  GGFAQIY       ++  D     P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+    VV Y DS+A++       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
           C N  L++++N RL  +L E+E+V IM+ V+  ++ MH L  PL+HRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWA 231
            FKL DFGS S      +  Q++AL+  +I  +TT QYRSPEMID+ R  PI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYD 291
           LG+FLYK+ ++TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY 
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVKELSDMKNISCPIINFY 310
           V+  L D+ N+  PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  293 bits (751), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 204/318 (64%), Gaps = 11/318 (3%)

Query: 3   QPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGT---------NI 52
           +PN   Y  GT + VG+H+V+IIKY+  GGFAQIY    I  ++ F            ++
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYC 112
           ACLKRV+V D+  LN +R EV+ MK L+    +V Y DS+A++       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 ENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNE 172
            N  L++++N RL  +L E E++ IM+ V+  V+ MH L  PL+HRDIKIENVL+   N 
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWAL 232
           FKLCDFGS S      +  Q++A++  +I  +TT QYRSPEMID+ R  PIDEKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
           G+FLYK+ ++TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY V
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 VKELSDMKNISCPIINFY 310
           +  +  +  +  PI + Y
Sbjct: 315 LHNICSISGMKVPIEDQY 332

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  290 bits (743), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 200/308 (64%), Gaps = 10/308 (3%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIY---------QTTISPIDPFSGTNIACLKRVIVPD 62
           G+ + VG+H+V+I+KYL  GGFA IY         +    P       ++ACLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
           +  LN +R EV  MK L     +V Y DSHA+++   +  +EV LLME C N  L++++N
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            RL  +L E E++ IM+ V++ +A MH L  PL+HRD+KIENVL+  N+ FKLCDFGS S
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYY 242
                 +  QE+A++ N+I  +TT QYRSPEMID+ R  PI+EKSDIWALG+FLYK+ +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNI 302
           TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY V+  L  +  +
Sbjct: 314 TTPFELTGQFAILHSKYEFPV-NNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 SCPIINFY 310
             P+ + Y
Sbjct: 373 KNPLEDKY 380

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  291 bits (745), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 204/322 (63%), Gaps = 16/322 (4%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQT------------TISPIDPFS 48
           + +P +  Y  GT + VG+ QV+II ++  GGFAQIY              + +P+ P  
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQP-- 71

Query: 49  GTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLL 108
             +IACLKRV+VPD+  L+ +R EV+ MK LR  + ++ Y DS+A++ +     YEV LL
Sbjct: 72  -GDIACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLL 130

Query: 109 MEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLS 168
           ME C N  L++++N RL  RL E E++ +M+  +  ++ MH L  PL+HRDIKIENVL+ 
Sbjct: 131 MELCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVD 190

Query: 169 KNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSD 228
             N FKLCDFGS S      +  Q++A++  +I  NTT QYRSPEMID+ R  PI+EKSD
Sbjct: 191 AQNNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSD 250

Query: 229 IWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPN 288
           IWALG+FLYK+ ++ TPFE +G+  IL S+YEFPA   YS +L +LI  +LA  P  RPN
Sbjct: 251 IWALGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPN 309

Query: 289 IYDVVKELSDMKNISCPIINFY 310
           IY V+  +  +     PI + Y
Sbjct: 310 IYQVMHHICSVIGCEVPIEDKY 331

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  291 bits (744), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 204/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGT--------N 51
           M  P +  Y  G  + VG+H+V+++ YL  GGFAQIY    +  ++ F  T        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+    +V Y DS+A++       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
           C N  L++++N RL  +L E+E+V IM+ V+  ++ MH L   L+HRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWA 231
            FKL DFGS S      +  Q++AL+  +I  +TT QYRSPEMID+ R  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYD 291
           LGVFLYK+ ++TTPFE +G+  IL S+YEFP    YS +L +LI  +LA  PN RPNIY 
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVKELSDMKNISCPIINFY 310
           V+  L ++ N+  PI + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  285 bits (730), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 203/317 (64%), Gaps = 11/317 (3%)

Query: 4   PNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI--------SPIDP--FSGTNIA 53
           PN       T + VG+H+ +I+++L  GGFA IY+           + ID       +IA
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCE 113
           CLKRVIVPD+  LN LR EV+ MK LR +  +V Y DS+A++    +  +E+ LLME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 114 NGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEF 173
              L++++N++L  +L E+E++ IM+ VS  +A MH L  PL+HRDIKIENVL+ K++ F
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 174 KLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALG 233
           KLCDFGS S      S  Q++A++ N+I  +TT QYRSPEMID+ R  PI+EKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 234 VFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
           +FLYK+ +YTTPFE +G+  IL S+YE P    YS +L +LI  +LA  P+ RPNIY V+
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 294 KELSDMKNISCPIINFY 310
             +  +     P  + Y
Sbjct: 323 HHVCSILKCDVPFTDKY 339

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  287 bits (734), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 201/307 (65%), Gaps = 9/307 (2%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIYQTTI----SPIDPFSGT----NIACLKRVIVPDK 63
           G+ L VG H+V+II+YL  GGFA IY+ +     + +D         +IACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  PSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNS 123
             LN LR EV+ MK L+    VV Y DS+A++ +     +EV LLME C NG L++++N 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSG 183
           RL  +L E EV+ IM+ +++G++ MH L+ PL+HRDIKIENVL+   N FKLCDFGS S 
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 PIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYT 243
            +   S  QE+A++ N+I  +TT QYRSPEMID+ R   I+EKSDIWALG+FLYK+ +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNIS 303
           TPFE +G+  IL S+Y+ P    +S +L +LI  +LA  P  RPNIY ++  +  +    
Sbjct: 271 TPFELTGQFAILHSKYDIPQ-NNFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPIINFY 310
            PI + Y
Sbjct: 330 VPIEDHY 336

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  287 bits (734), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 206/326 (63%), Gaps = 24/326 (7%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI-----------SP--IDPFSGTNI 52
           +  Y  G  + VGSH+V+I++Y+  GGFAQIY               SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGT--------YE 104
           ACLKRVIV D+  LN LR EV+ MK L     +V Y DS+A++   +NGT        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V LLME C N  L++++N RL  +L E E++ +M+ VS  +A MH L+ PL+HRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           VL+ + N FKLCDFGS S         +++A +  +I  +TT QYRSPEMID+ R  PID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPN 284
           EKSDIWALG+FLYK+ ++TTPFE++G+  IL S++EFP    YS +L +LI  +L+  PN
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQ-NNYSFKLINLIIVMLSENPN 311

Query: 285 HRPNIYDVVKELSDMKNISCPIINFY 310
            RPNIY V+ ++  +K +  PI + Y
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKY 337

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  289 bits (740), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 203/327 (62%), Gaps = 33/327 (10%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSGT-------------- 50
           I  Y QGT LTVG  +++I+KYLT GGFAQIY    I  ++ F                 
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  NIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGT-------- 102
           ++ACLKRV+VPD+  L+ +R EVD MK L N   +V Y DS+A+K    +          
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 103 -------YEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPL 155
                  +E+ LLMEYC N  L++F+N RL  +L E+E++  M  ++  V  MH L  PL
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 156 VHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP-SNPQELALVQNDIMRNTTAQYRSPEM 214
           +HRDIKIENVL+  NN FKL DFGS +  I+PP +  Q++A++  DI  NTT QYRSPEM
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTT-KIQPPITTHQDIAILNKDIYMNTTPQYRSPEM 275

Query: 215 IDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHL 274
           ID+ +  PIDEKSDIWALGV LYK+ +YTTPFE +G+  IL S+YEFPA   YS +  +L
Sbjct: 276 IDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINL 334

Query: 275 ISKLLAVQPNHRPNIYDVVKELSDMKN 301
           I  +LA  PN RPNI+ V+  L  + N
Sbjct: 335 IIIMLAENPNLRPNIFQVLYYLKSISN 361

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  288 bits (736), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 202/307 (65%), Gaps = 9/307 (2%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIYQTTI----SPIDP----FSGTNIACLKRVIVPDK 63
           G+T+ VG HQV++I+YL  GGFA IY+ +     + +D         +  CLKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  PSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNS 123
             LN LR EV+ MK LRN   +V Y DS+A++       YEV LLME C NG L++++N 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSG 183
           RL  +L E+EV+ IM+ ++ G++ MH  + PL+HRDIKIENVL+  +N FKLCDFGS S 
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 PIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYT 243
            +   ++ QE+A++ N+I  +TT QYRSPEMID+ R  PI+EKSDIWALG+FLYK+ +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNIS 303
           TPFE +G+  IL S+YE P   ++S +L +L+  +LA  P  RPN+Y V+  +  M    
Sbjct: 272 TPFELTGQFAILHSKYEIPR-NSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPIINFY 310
             I + Y
Sbjct: 331 VKIDDLY 337

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  287 bits (735), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 209/324 (64%), Gaps = 25/324 (7%)

Query: 3   QPNIST-YPQGTTLTVGSHQVQIIKYLTAGGFAQIY----------------QTTISPID 45
           QP I   +P G  +TVGSH+V+++ YL  GGFAQIY                ++   P+ 
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 46  PFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGT--- 102
           P S    ACLKRV+V D+  LN +R+EV+ MK L+    +V Y DS+A++    +G    
Sbjct: 149 PGSP---ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQ 205

Query: 103 -YEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIK 161
            +EV LLME C N  L++++N RL  +L E E+  IM+ ++  VA MH L  PL+HRDIK
Sbjct: 206 GFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265

Query: 162 IENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGF 221
           IENVL+  NN FKLCDFGS S      ++ Q++A++  D+  +TT QYRSPEMID+ +  
Sbjct: 266 IENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYI 325

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAV 281
           PI+EKSDIWALGVFLYK+ ++TTPFE++G+  +L S++EFP   +YS +L +LI  +LA 
Sbjct: 326 PINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAE 384

Query: 282 QPNHRPNIYDVVKELSDMKNISCP 305
            P+ RPNIY V+  LS++ N   P
Sbjct: 385 NPSLRPNIYQVLYYLSEVTNREVP 408

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  281 bits (720), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIY---------QTTISPIDPFSGTNIACLK 56
           I TY  G  + VG H+V+IIKYL  GGFA+IY         Q  I+ I      ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116
           RV+V D   LN +R EV  MK L     +V   DS+A++ +     YEV LLME C N  
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176
           L++++N RL  +L E E++ IM+ V+  VA MH L  PL+HRDIKIENVL+   N FKLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236
           DFGS S  +   +  +++A +  ++  +TT QYRSPEMID+ R   I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
           YK+ +Y TPFE++G+  IL S+YEFP   +YS +L +LI  +LA  PN RPNIY V+  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SDMKNISCPIINFY 310
             + NI  PI + Y
Sbjct: 395 CKIINIKTPIDDIY 408

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  283 bits (724), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 198/317 (62%), Gaps = 12/317 (3%)

Query: 4   PNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI----------SPIDPFSGTNIA 53
           P +  +  G  + VG+H+V+++ YL  GGFAQIY              S + P    ++A
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKV-PMKVGDVA 75

Query: 54  CLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCE 113
           CLKRV+V D+  L+ +R EV+ MK L   + +V Y DS+A +    N  +EV LLME C 
Sbjct: 76  CLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCP 135

Query: 114 NGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEF 173
           N  L++++N RL  +L E E++ IM+ VS  V+ MH L+ PL+HRDIKIENVL+   N F
Sbjct: 136 NKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSF 195

Query: 174 KLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALG 233
           KLCDFGS S      +  QE+A++  +I  +TT QYR PEMID+ R  PI+EKSDIWALG
Sbjct: 196 KLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALG 255

Query: 234 VFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
           +FLYK+ ++ TPFE +G+  IL S+YEFP    YS +L +LI  +LA  P  RPNIY V+
Sbjct: 256 IFLYKLLFFITPFEMTGQFAILHSKYEFPP-NHYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 KELSDMKNISCPIINFY 310
             +  M  +  PI + Y
Sbjct: 315 NHICTMIGVEVPIEDKY 331

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  276 bits (707), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 199/316 (62%), Gaps = 12/316 (3%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI-----------SPIDPFSGTNIAC 54
           I  Y  G  ++VG+HQV+I  YL  GGFAQIY+                ++     +IAC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCEN 114
           LKRV+V D+  LN +R EV+ MKLL+    +V Y DS+A + +     YE+ LLME C N
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFK 174
             L++++N RL+ +L E+E+V IM+  +  V+ MH L  PL+H+DIK+EN+L+  NN FK
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGV 234
           LCDFGS S      ++  ++A++  +I  +TT QYRSPEMID+ R  PI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           FLYK+ ++ TPFE++G+  IL ++++ P    Y  +L +LI  +L+   N RPNIY V+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPV-NNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 ELSDMKNISCPIINFY 310
           E+  + N   PI + Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 152/355 (42%), Gaps = 78/355 (21%)

Query: 13  TTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP--DKPSLNVLR 70
           +++ +      I + L  GGF+ +Y      +      ++  LK++  P  +  S++   
Sbjct: 19  SSVLINGQHYAIQRLLGEGGFSFVYL-----VQSRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDAMKLLRN---NRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
            EV++ K  R+     CV S +         Q+G+  VF+L+ Y   G L++ +N+ L +
Sbjct: 74  REVNSYKKFRSPYITHCVSSQVLQE------QDGSKTVFILLPYFPTGSLLDKINTHLLD 127

Query: 128 --RLKESEVVNIMWSVSQGVAAMH-------------ALQPPLVHRD------------- 159
              + E E+V I+ SV++G+  MH             ++   L +RD             
Sbjct: 128 GTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLL 187

Query: 160 ---------------------------IKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQ 192
                                      IK  N++ S +    +CD GS S      S+  
Sbjct: 188 NDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRS 247

Query: 193 ELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEK---- 248
           +L   Q     + T  +RSPE+++++    IDEK DIW+LG  LY +C+  +PFE+    
Sbjct: 248 QLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQL 307

Query: 249 SGEA---GILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300
           SG +    I T ++  P    YS  L  +I   + V    RP+I +++  L D++
Sbjct: 308 SGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 142/348 (40%), Gaps = 61/348 (17%)

Query: 12  GTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRA 71
           G  +++      +   L  G    +YQ    P    SG   A LK+V  P   +  V RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSGGVYA-LKKVTCPIGRADFVTRA 78

Query: 72  EVDAMKLLR-NNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL--QNR 128
             +     R N+  + + +D   A+    NGT  +++L+ Y   G L + +N+ +   + 
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMIIRGDS 136

Query: 129 LKESEVVNIMWSVSQGVAAMHA-------------------------------------L 151
           L ES VV +M  + +GV  MH                                      L
Sbjct: 137 LSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLL 196

Query: 152 QPPL--------VHRDIKIENVLLSKNNEFKLCDFGS-VSGPIRPPSNPQELALVQNDIM 202
            PPL        VH  +  EN++LS      + +  S V  P+   SN + L L Q  + 
Sbjct: 197 SPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASCVRAPLELTSNSKLLGL-QEWLN 255

Query: 203 RNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------GIL 255
            N+   Y  PE++D+     I  + DIW+LG   Y + Y  + F +  +         I 
Sbjct: 256 ENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHSIS 315

Query: 256 TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNIS 303
           T  + FP  P YS  L+ ++ + L + P+ RP+IY+ + +  ++ + S
Sbjct: 316 TGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQELLDTS 363

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 146/332 (43%), Gaps = 60/332 (18%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFA--QIYQTTISPIDPFSGTNIACLKRVIVPD 62
           I ++  G TL +GS  +VQ+    T G  A  ++   TI     F  +N+  +     PD
Sbjct: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI-----FQDSNVTSMVDNTTPD 69

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
                + R E+  MKLL N+  V+   D     S+       +++++EY E G L N L 
Sbjct: 70  ALPYGIER-EIVIMKLL-NHANVLRLYDVWETNSN-------LYMVLEYAEKGELFNLLV 120

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            R    L E+E +     +  G++  HAL   +VHRD+K EN+LL      K+ DFG   
Sbjct: 121 ER--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMA- 175

Query: 183 GPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYK 238
                       AL   D +  T+     Y +PE++    G P     SD+W+ GV LY 
Sbjct: 176 ------------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYA 220

Query: 239 ICYYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIY 290
           +     PF++  E G        +   ++E P     S   ++LISK+L V P  R    
Sbjct: 221 LLTGRLPFDE--EDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITAR 278

Query: 291 DVVKE--------LSDMKNI-SCPIINFYLKP 313
           D++K         + D K+I + P  + YL P
Sbjct: 279 DILKHPLLQKYPSIKDSKSIRNLPREDTYLHP 310

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 144/335 (42%), Gaps = 51/335 (15%)

Query: 11  QGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLR 70
           Q + ++V  H+  I + L  GGF+ +Y          +   I C    I    P++    
Sbjct: 15  QPSYVSVNGHRYHIKRLLGEGGFSFVYLVESRENGLMALKKIRCPFGSIGSISPAMK--- 71

Query: 71  AEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN--R 128
            EVD  +  ++   +   IDS   +   ++G+  V++L+ Y   G L + +N  L +  +
Sbjct: 72  -EVDNYQKFKSPY-IAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPP---------------------------------- 154
           + E EVV +   V++G+  +H   P                                   
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 155 -LVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPE 213
              H DIK  N+++S      + D GS S      ++ Q L   Q     + T  + +PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 214 MIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEK----SGEA---GILTSRYEFPAFPA 266
           ++D+     I EK D+W+ G  +Y +C+  +PFE+    SG +    + T +Y  P+   
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTN 307

Query: 267 YSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKN 301
           YS  L  ++ K L V P+ RP++ +++  L D+++
Sbjct: 308 YSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 116/261 (44%), Gaps = 46/261 (17%)

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN--RLKESEVVNIMWSVS 142
           +   +DS   +   ++G+  V++L+ Y   G L + +N  L +  ++ E +++ +   ++
Sbjct: 84  IAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDILRMALGIA 141

Query: 143 QGVAAMHALQP-----------------------------------PLVHRDIKIENVLL 167
           +G+  +H   P                                      HRD+K  N+++
Sbjct: 142 RGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRDVKPSNIMI 201

Query: 168 SKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKS 227
           S  +   + D GS S      ++ Q L   Q     N T  Y +PE++D+     I EK 
Sbjct: 202 SPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVKLNSVITEKC 261

Query: 228 DIWALGVFLYKICYYTTPFEK----SGEA---GILTSRYEFPAFPAYSDRLRHLISKLLA 280
           DIW+ G  +Y +C+  +PFE+    SG +    I T +Y  P   +YS  L  LI K L+
Sbjct: 262 DIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSLIELIGKCLS 321

Query: 281 VQPNHRPNIYDVVKELSDMKN 301
           V P  RP++ +++  L +++ 
Sbjct: 322 VNPEQRPSVNELIALLMELQG 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 116/241 (48%), Gaps = 44/241 (18%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E++  KL+  ++ ++S ID     ++       +++++E C  G L + +  R +  L+E
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKRSLRE 150

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNP 191
            E   +M  +   V  +H  +  +VH D+K+ N+L+  +N  +LCDFG            
Sbjct: 151 WEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH----------- 197

Query: 192 QELALVQNDIMRNT-----TAQYRSPEMIDMSRGFPIDEK--------SDIWALGVFLYK 238
              + V  DI  N+     T  Y SPE+I     F + +K        SDIW++G+ LY 
Sbjct: 198 ---SFVSTDIDNNSINKFGTPNYLSPEIIS---NFILSDKKDLYFPKESDIWSIGIVLYA 251

Query: 239 ICYYTTPFE----KSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           + +  TPFE    +S    I+  +Y F      S++++ LI  +L +QP  R  I ++V 
Sbjct: 252 MIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVS 311

Query: 295 E 295
           +
Sbjct: 312 D 312

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 129/276 (46%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +R+   VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L+  L  R    + E EV   M  +   + 
Sbjct: 152 QFIDC------FEDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   KN   K+ DFG               A++ ND  R  T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLA-------------AVLANDRERKYT 247

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV +Y +     PF+ S +  ++  R    
Sbjct: 248 VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNR 305

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     S+  + LI  +L+  P  RP+I +++
Sbjct: 306 DFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEII 341

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 92.0 bits (227), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 142/313 (45%), Gaps = 40/313 (12%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A L    +  + +   L +E+   K +++   VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKHQN-VV 142

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 143 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   +N   K+ DFG               A++ ND  R  T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLA-------------AVLANDRERKYT 238

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV LY +     PF+ S +   +  R    
Sbjct: 239 VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCC 296

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFYLKPNMTD 317
            + FP     S+  + LI  LL++ P  RP+I +++  +   + I  P I   +   + +
Sbjct: 297 DFSFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPPYIESTVMTEVPN 355

Query: 318 ASNNIQHLHSIMN 330
               + H  SI+N
Sbjct: 356 YDKTLTHQESIIN 368

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 144/328 (43%), Gaps = 49/328 (14%)

Query: 6   ISTYPQGTTLTVGSH-QVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKP 64
           I  +  G+ L  GS  +V + ++ T G  A +   + S     +  N + +     PD  
Sbjct: 23  IGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDLL 82

Query: 65  SLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSR 124
              + R E+  MKLL N+  V+   D    KS+       +++++EY E G L N L  R
Sbjct: 83  PYGIER-EIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFNLLVER 133

Query: 125 LQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGP 184
               L E+E V     +  G++  HAL   +VHRD+K EN+LL      K+ DFG     
Sbjct: 134 --GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA--- 186

Query: 185 IRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKIC 240
                     AL   D +  T+     Y +PE++    G P    +SD+W+ GV LY + 
Sbjct: 187 ----------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 233

Query: 241 YYTTPFE------KSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               PF+      +S    + +  YE P     S   + LI+K+L V P+ R    +++K
Sbjct: 234 TGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

Query: 295 E--------LSDMKNI-SCPIINFYLKP 313
                    + D K+I + P  + YL P
Sbjct: 294 HPLLQKYPSIKDSKSIRNLPREDTYLNP 321

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 127/278 (45%), Gaps = 39/278 (14%)

Query: 23  QIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV---LRAEVDAMKLL 79
           +I + L  G F ++Y     P    SG  I  LK +   +  + NV    + E+D    L
Sbjct: 119 EIGRKLGKGKFGKVYCVRHKP----SGL-ICALKVMNKMEIVNFNVQKQFKREIDIQYHL 173

Query: 80  RNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMW 139
            +      Y   H +K+        V+L+MEY   G L   L  +    + +    N ++
Sbjct: 174 NHKNLTKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVY 223

Query: 140 SVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQN 199
            ++  +  MH  +  ++HRD+K EN+L+  NN+ KL DFG     I  P+N +   L   
Sbjct: 224 QMTDALNYMH--KRKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-- 276

Query: 200 DIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAG----IL 255
                 T  Y SPE+I  SR +  DE  D+WALG+  Y++     PFE+  +      I 
Sbjct: 277 -----GTIDYLSPELIS-SREY--DENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 256 TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            S  +FP  P  S   R LI+ LL V P+ R N+  V+
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 124/275 (45%), Gaps = 37/275 (13%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A L    +  + +   L +E+   K +R+   +V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L+  L  R    L E EV      +  G+ 
Sbjct: 162 QFIDC------FEDET-NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   KN   K+ DFG               A++ ND  R  T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLA-------------AVLANDRERKYT 257

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSR 258
                 Y +PE++ M +      + DIW++GV +Y +     PF+      I        
Sbjct: 258 VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCD 316

Query: 259 YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
           + FP     S   R L+  LL++ P  RP+I +V+
Sbjct: 317 FVFPKEKYISSEARILVQDLLSLDPLERPSIMEVL 351

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 128/274 (46%), Gaps = 35/274 (12%)

Query: 28  LTAGGFAQIYQTTISPIDPFSGTNIACL---KRVIVPDKPSLNVLRAEVDAMKLLRNNRC 84
           L  GGFA+ +      I    G + AC    K+ I  ++    +L +E+   + LR +  
Sbjct: 99  LGEGGFARCFH-----IKDDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRYSH- 151

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQG 144
           +V ++D    + +       V++L+E C NG L++ L  R    L E+EV  +   V   
Sbjct: 152 IVKFMDCFEDELN-------VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGA 202

Query: 145 VAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRN 204
           +  MH+    ++HRD+K+ NV   KN   K+ DFG  +      SN  E           
Sbjct: 203 INYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAA----TLSNVSEKKYTMCG---- 252

Query: 205 TTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYE 260
            T  Y +PE+I +S+      ++DIW+LG+ +Y +     PF+      I       +YE
Sbjct: 253 -TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYE 310

Query: 261 FPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           FP     ++ ++ LI  LL + P+ RP I D++K
Sbjct: 311 FPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 125/272 (45%), Gaps = 26/272 (9%)

Query: 28  LTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVS 87
           L  G ++ +   T   ID      +  L +  +  +  +  +  E +A++ + N++ +V 
Sbjct: 185 LGDGAYSTVMLAT--SIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAA 147
              +   +SS       ++ L+EYC NG  ++ +  +    L E+        V   +  
Sbjct: 243 LFFTFQDESS-------LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA 207
           +H     ++HRDIK EN+LL K  + KL DFG  +  I   S   +  L+        TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFG--TAKILDSSTNNKFDLLTRSKSFVGTA 349

Query: 208 QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA 263
           +Y +PE+++ S    +D + D+WA G  LY++     PF+ + E      ++  +Y F A
Sbjct: 350 EYVAPELLNDSF---VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 264 -FPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
            FP     +R L+ K+L    N RP+I  + K
Sbjct: 407 GFPLI---IRDLVKKILVKDLNQRPSISQIEK 435

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 125/279 (44%), Gaps = 39/279 (13%)

Query: 23  QIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV---LRAEVDAMKLL 79
           +I K L  G F ++Y   +  I+  SG  +  LK +   D    N+    R EV+    L
Sbjct: 110 EIGKVLGKGKFGRVY--CVRHIE--SGF-VCALKAMEKKDIIQYNIEKQFRREVEIQSSL 164

Query: 80  RNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMW 139
           R+      Y   H  K         V+LLMEY  NG L   L  R  +   +      ++
Sbjct: 165 RHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVY 214

Query: 140 SVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQN 199
            ++  +  MH  +  ++HRDIK EN+++  NN  KL DFG     +  P   +   L   
Sbjct: 215 QMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG---WSVITPKGSKRKTLC-- 267

Query: 200 DIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRY 259
                 T  Y SPE+I   R    +EK D+WALGV  Y++   + PFE+  E+  LT + 
Sbjct: 268 -----GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEE--ESKELTYKR 317

Query: 260 EFP---AFPAYSD-RLRHLISKLLAVQPNHRPNIYDVVK 294
                  FP + D   RHLIS+LL   P  R  + +V K
Sbjct: 318 ILKRNLIFPDHVDTEARHLISRLLEYDPGDRIPLKEVKK 356

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 141/334 (42%), Gaps = 61/334 (18%)

Query: 13  TTLTVGSHQVQIIKYLTAGGFAQIY-----QTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           TT+ V   + +I + L  GG + +Y     + ++S  +  +   +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL-- 125
               E++  K  ++   V+  IDS   +   ++G+  +++++ Y   G L + +N RL  
Sbjct: 81  NGMREIENYKRFQSPY-VIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLKESEVVNIMWSVSQGVAAMH------------------------------------ 149
              + E+E V IM  V++G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDI 201
                   A      HRDI   N+L S +    + D GS S       N  +L+ +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------GI 254
             N T  Y +PE++++     +  K DIW++G   Y + +  +PFE+  +         I
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPN 288
            T +Y FP    +S+RL  +I + + V P  RP 
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPT 351

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 126/276 (45%), Gaps = 38/276 (13%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + + N L +E+   K +R+   +V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++    V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 159 HFIDC------FEDDI-NVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+    ++HRD+K+ N+   K+   K+ DFG               A++ N+  R  T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFGLA-------------AIINNENERKYT 254

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE+I   +      + DIW+LGV ++ +     PF+ + E   +  R    
Sbjct: 255 ICGTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ-AKEVSTIYDRIKHC 313

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            Y FP     S  ++ LI  +L++ P  RP I +++
Sbjct: 314 NYSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 142/313 (45%), Gaps = 40/313 (12%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A L    +  + +   L +E+   K ++N   +V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 144 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLA-------------AVLANDRERKYT 239

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV LY +     PF+ S +   +  R    
Sbjct: 240 VCGTPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCC 297

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFYLKPNMTD 317
            + FP     S   + LI  LL++ P  RP++ +++  +   + +  P I   +  N+ +
Sbjct: 298 DFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVW-FRGLFPPQIESDVMTNIPN 356

Query: 318 ASNNIQHLHSIMN 330
             N +    SI+N
Sbjct: 357 YDNQLTMEQSIVN 369

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 141/347 (40%), Gaps = 61/347 (17%)

Query: 13  TTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIAC-----LKRVIVPDKPSLN 67
           TT+ V   + +I + L  GG + +Y   +          +A      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL-- 125
               E++  K  ++   V+  IDS   +   ++G+  +++++ +   G L + +N RL  
Sbjct: 81  NGMREIENYKRFQSPY-VIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLKESEVVNIMWSVSQGVAAMH------------------------------------ 149
              + E+E V IM  V +G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 150 --------ALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDI 201
                          HRDI   N+L S +    + D GS S       N  +L  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------GI 254
             N T  Y +PE++ +     +D K DIW+LG   Y + +  +PFE+  +         I
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKN 301
            T +Y FP    +S+ L  +I K + V P  RP    ++  L D+++
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 125/286 (43%), Gaps = 45/286 (15%)

Query: 26  KYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV---LRAEVDAMKLLRNN 82
           K L  G F ++Y     P    SG  I  LK +   +    N+    R EV+    LR+ 
Sbjct: 112 KILGKGKFGKVYCVRHIP----SGF-ICALKAMEKKEIIQYNIEKQFRREVEIQSSLRHP 166

Query: 83  RCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVS 142
                Y   H  K         V+L+MEY  NG L   L  R  N   +      ++ ++
Sbjct: 167 NLTQLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYVYQMA 216

Query: 143 QGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIM 202
             +  MH  +  ++HRDIK EN+++  NN  KL DFG                +      
Sbjct: 217 GALDYMH--ERNILHRDIKPENIIIGFNNVIKLTDFGWS-------------VINSKGFK 261

Query: 203 RNT---TAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRY 259
           R T   T  Y SPE+I  SR +  DEK D+WALGV  Y++   + PFE+  E+  LT + 
Sbjct: 262 RKTLCGTVDYLSPELIK-SREY--DEKVDVWALGVLTYELLVGSPPFEE--ESKELTYKR 316

Query: 260 EFP---AFPAYSD-RLRHLISKLLAVQPNHRPNIYDVVKELSDMKN 301
                  FP + D   RHLIS+LL   P +R  + DV      +KN
Sbjct: 317 ILKRNLVFPDHIDPDARHLISRLLEYDPANRIALKDVRGHSWILKN 362

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 103/218 (47%), Gaps = 44/218 (20%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E+FL++EY + G L ++L SR   RL E E ++    + +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQ--NDIMRNTTA--QYRSPEMI--D 216
           N+LL K N+  K+ DFG              +A +Q  N ++  +     Y SPE++   
Sbjct: 187 NLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASPEIVMGK 232

Query: 217 MSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLR 272
              G P    SD+W+ G+ L+ +     PF       +L      +Y+ P   A S   +
Sbjct: 233 TYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQ 286

Query: 273 HLISKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFY 310
            LIS++L V PN R  I D+         +S P+I  Y
Sbjct: 287 DLISRILVVDPNKRITINDI---------LSHPLITKY 315

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 142/330 (43%), Gaps = 54/330 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFA--QIYQTTISPIDPFSGTNIACLKRVIVPD 62
           I  +  G TL +GS  +VQ+ +  + G  A  ++   T+      SGT+I        PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVG---STTPD 72

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
                + R E+  MKLL N+  V+   D     +       +++L++EY E G L N L 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNA-------DLYLVLEYAEKGELFNLLV 123

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            R    L E+E +     +  GV+  HAL   +VHRD+K EN+LL      K+ DFG   
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA- 178

Query: 183 GPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYK 238
                       AL     +  T+     Y +PE++    G P     SD+W+ GV L+ 
Sbjct: 179 ------------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 ICYYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
           +     PF E+ G    L        +E P+    S   + LIS++L V P  R    D+
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDI 283

Query: 293 VKE--------LSDMKNI-SCPIINFYLKP 313
           +K         + D K+I   P  + YL P
Sbjct: 284 LKHPLLQKYPSIKDSKSIRGLPREDTYLTP 313

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 144/337 (42%), Gaps = 57/337 (16%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKY-LTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKP 64
           I  +  G+TL VGS    ++ Y  T G  A +   + S  +    T I      ++P   
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLP--- 70

Query: 65  SLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSR 124
               +  E+  MKLL +   +  Y     +K        ++++++EY E G L N L  R
Sbjct: 71  --YGIEREIIIMKLLNHPNVLRLYDVWETSK--------DLYMVLEYVEKGELFNLLVER 120

Query: 125 LQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGP 184
               L E+E V     +  G++  HAL   +VHRD+K EN+LL      KL DFG     
Sbjct: 121 --GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMA--- 173

Query: 185 IRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKIC 240
                     AL   D +  T+     Y +PE++    G P    +SD+W+ GV LY + 
Sbjct: 174 ----------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 220

Query: 241 YYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
               PF++  E G        + + ++E P     S   + LI+++L V P  R    ++
Sbjct: 221 TGRLPFDE--EDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREI 278

Query: 293 VKE--------LSDMKNI-SCPIINFYLKPNMTDASN 320
           +K         + D K+I + P  + YL P   +  N
Sbjct: 279 LKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLEGGN 315

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 128/310 (41%), Gaps = 64/310 (20%)

Query: 8   TYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
            Y +G+ +  GSH V             +Y+   S    F+G  + C      P+K +  
Sbjct: 41  VYYRGSEINRGSHSV-------------VYKVFDSEDRIFAGKKVHC------PNKENKR 81

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYE-VFLLMEYCENGGLINFLNSRLQ 126
            +  E++  K++    C   +    A + +FQ G    ++++++YC N  L + L  R  
Sbjct: 82  KIIKELEIYKVI----CRSHHNHIVALRDAFQWGKESCIYMILDYCSNNSLQSILQYR-- 135

Query: 127 NRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
             L E E   +M  +  G+  +H     ++H D+K+ N+L  +  + K+CDFGS      
Sbjct: 136 GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSSFIATS 193

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR------------GFPIDEKSDIWALGV 234
            P  P E+           T  Y +PE +   +             FPI    DIW++G+
Sbjct: 194 SPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPI----DIWSMGI 240

Query: 235 FLYKICYYTTPFEKSGEA-----------GILTSRYEFPAFPAYSDRLRHLISKLLAVQP 283
            LY + Y   PF KS +             I +   EFP   A     + LI K+L+  P
Sbjct: 241 VLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNP 300

Query: 284 NHRPNIYDVV 293
             R  + ++V
Sbjct: 301 LERITLVEIV 310

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 142/330 (43%), Gaps = 54/330 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFA--QIYQTTISPIDPFSGTNIACLKRVIVPD 62
           I  +  G TL +GS  +VQ+ +  + G  A  ++    +      SGT+I      I PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVG---SITPD 72

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
                + R E+  MKLL N+  V+   D     +       +++L++EY E G L N L 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLV 123

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            R    L E+E +     +  GV+  HAL   +VHRD+K EN+LL      K+ DFG   
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA- 178

Query: 183 GPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYK 238
                       AL     +  T+     Y +PE++    G P     SD+W+ GV L+ 
Sbjct: 179 ------------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 ICYYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
           +     PF E+ G    L       ++E P+    S   + LI K+L V P  R    D+
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDI 283

Query: 293 VKE--------LSDMKNI-SCPIINFYLKP 313
           +K         + D K+I   P  + YL P
Sbjct: 284 LKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 131/302 (43%), Gaps = 58/302 (19%)

Query: 55  LKRVIVP--DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYC 112
           LKR+  P  +  S++    EVD  K  ++   +++ +DS   +   ++G+  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQSPY-IITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 ENGGLINFLNSRL--QNRLKESEVVNIMWSVSQGVAAMH--------------------- 149
             G L + +N  L     + E+E + IM  +++G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------VHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
                      PL                VHRDI++ N+L S      + D GS      
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
             S   +L  +Q+ +  N +  Y +PE++++     ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK----SGEA---GILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299
           E+    SG +    I   +Y FP    YS+ L  +I   L V P  RP+I +++  L D+
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 KN 301
           + 
Sbjct: 370 QT 371

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 135/332 (40%), Gaps = 61/332 (18%)

Query: 14  TLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIA-----CLKRVIVPDKPSLNV 68
           T+ V   + +I + L  GG + +Y   +S         IA      LK++I P   S++ 
Sbjct: 22  TIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISN 81

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL--Q 126
              E++  K  ++   V+  IDS   +   ++G+  +++++ Y   G L + +N RL   
Sbjct: 82  GMREIENYKRFQSPY-VIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEG 138

Query: 127 NRLKESEVVNIMWSVSQGVAAMH------------------------------------- 149
             + E+E V IM  V++G+  +H                                     
Sbjct: 139 TFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEM 198

Query: 150 -------ALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIM 202
                  A      HRDI   N+L S +    + D GS S       N  +L+ +Q  + 
Sbjct: 199 DMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVN 258

Query: 203 RNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------GIL 255
            N T  Y  PE++++     +  K DIW+LG   Y + +  +PFE+  +         I 
Sbjct: 259 DNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 256 TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRP 287
           T +Y FP    +S+ L  +I K + V P  RP
Sbjct: 319 TGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 97/199 (48%), Gaps = 19/199 (9%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY  NG L   L S       +    + ++ ++  +  MH+    ++HRDIK EN
Sbjct: 213 VYLLMEYLVNGELYKHLRS--HGPFNDIVASHFVYQMADALDYMHS--KHIIHRDIKPEN 268

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +LL   N  KL DFG     +   +N +   L         T  Y SPE+I  SR +  D
Sbjct: 269 ILLGFQNTLKLTDFG---WSVTNLNNSRRRTLC-------GTMDYLSPELIK-SREY--D 315

Query: 225 EKSDIWALGVFLYKICYYTTPF-EKSGEAGILTSRYEFPAFPAY-SDRLRHLISKLLAVQ 282
            K D+WALGV  Y++   T PF E S E      +     FP + S + R +ISKLL  +
Sbjct: 316 NKVDVWALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKFPDHISSQARDIISKLLEYE 375

Query: 283 PNHRPNIYDVVKELSDMKN 301
           PN R  + DV K    +KN
Sbjct: 376 PNARIALRDVKKHPWILKN 394

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 127/275 (46%), Gaps = 39/275 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A L    +  + +   L +E+   K +++   +V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKHPN-IV 150

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            + D       F++ T  V++L+E C NG ++  L  R    L E EV   M  +   + 
Sbjct: 151 QFTDC------FEDDT-NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K    K+ DFG               A++ ND  R  T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLA-------------AVLANDKERKYT 246

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++   +      + DIW++GV LY + +   PF+ + E   +  R    
Sbjct: 247 ICGTPNYIAPEVL-TGKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCR 304

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
            + FPA    S   ++LIS LL + P  RP++Y++
Sbjct: 305 DFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 103/217 (47%), Gaps = 20/217 (9%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++ L+EY  NG L+  L  +      E+  +     +   +  +H++   ++HRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLLSKNNEFKLCDFGSV----SGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRG 220
           +LL+K+ + KL DFG+             +     L++       TA+Y SPE++  S  
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRLRHLI 275
              D + DIWA G  L+++     PF+ + E      I+  +Y F A FP     LR LI
Sbjct: 449 --TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTI---LRDLI 503

Query: 276 SKLLAVQPNHRPNIYDVVKEL-SDMKNISCPIINFYL 311
            K+L   PN+R  I+ +   L    K+ S P   +YL
Sbjct: 504 KKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 100/196 (51%), Gaps = 25/196 (12%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++++EYC N  L ++L S+   R+   E   I   +   V   H+L    VHRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL K+N  KL DFG      R  S   +L  +        T  Y +PE++   +  G+
Sbjct: 160 NILLDKDNNAKLTDFGFT----RDFSKNTQLETICG------TTVYMAPELLRREKYDGY 209

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFE----KSGEAGILTSRYEFPAFPAYSDRLRHLISK 277
            I    DIWALG+ LY I   T PF+    K  E  I+++  ++     ++D    L+++
Sbjct: 210 KI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDN-KYFNDDSIDLVNR 264

Query: 278 LLAVQPNHRPNIYDVV 293
           LL+  P+ RP I  ++
Sbjct: 265 LLSKDPSMRPTIEQIL 280

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 128/279 (45%), Gaps = 39/279 (13%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K ++++  +V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID     ++       V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 156 QFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            +H+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLA-------------AVLANDRERKYT 251

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV +Y +     PF+ + +  ++  R    
Sbjct: 252 VCGTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLC 309

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
            Y +P     S     LI  +L++ P  RP I D++ ++
Sbjct: 310 KYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 106/231 (45%), Gaps = 43/231 (18%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           ++++++EY E G L N L  R    L E+E V     +  G++  HAL   +VHRD+K E
Sbjct: 102 DLYMVLEYVEKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRG 220
           N+LL      KL DFG               AL   D +  T+     Y +PE++    G
Sbjct: 158 NLLLDHKFNIKLADFGMA-------------ALESKDKLLETSCGSPHYAAPEIVS---G 201

Query: 221 FPIDE-KSDIWALGVFLYKICYYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRL 271
            P    +SD+W+ GV LY +     PF++  E G        + + +YE P     S   
Sbjct: 202 LPYHGFESDVWSCGVILYALLTGRLPFDE--EDGNIRNLLLKVQSGKYEIPGEDEISPEA 259

Query: 272 RHLISKLLAVQPNHRPNIYDVVKE--------LSDMKNI-SCPIINFYLKP 313
           R LI ++L V+P  R    +++K         + D K+I + P  + YL P
Sbjct: 260 RDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNP 310

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 126/276 (45%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L++ L  R    L E EV      +   V 
Sbjct: 140 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLA-------------AVLANDRERKYT 235

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++   +      + DIW+ GV +Y +     PF+ + E  I+  R    
Sbjct: 236 VCGTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCG 293

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            Y FP     S     LI  +L++ P  RP++ +++
Sbjct: 294 DYVFPRDKCISQEALTLIRDILSIDPLERPSLDEII 329

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 148/336 (44%), Gaps = 58/336 (17%)

Query: 9   YPQGTTLTVGSH-QVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           +  G TL +GS  +VQ+    T G  A I   + S  +     N A    +  PD     
Sbjct: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN----NNSAQSSSLTTPDALPYG 73

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
           + R E+  MKLL N+  V+   D     S+       +++++EY E G L N L  +   
Sbjct: 74  IER-EIIIMKLL-NHPNVLRLYDVWETNSN-------LYMVLEYAEKGELFNLLVEK--G 122

Query: 128 RLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRP 187
            L+E E +     +  G++  HAL   +VHRD+K EN+LL      K+ DFG        
Sbjct: 123 PLQEQEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA------ 174

Query: 188 PSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICYYT 243
                  AL   D +  T+     Y +PE++    G P     SD+W+ GV L+ +    
Sbjct: 175 -------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALLTGR 224

Query: 244 TPFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKE 295
            PF++  E G        + +  +E P+    S   + L++K+L V P  R    D++K 
Sbjct: 225 LPFDE--EDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH 282

Query: 296 --------LSDMKNI-SCPIINFYLKPNMTDASNNI 322
                   + D K+I + P  + YL P ++D ++ I
Sbjct: 283 PLLQKYPSIKDSKSIRNLPREDTYLNP-LSDNNSTI 317

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 142/330 (43%), Gaps = 54/330 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFAQIYQTTISPIDP--FSGTNIACLKRVIVPD 62
           I  +  G TL +GS  +VQ+ +  + G  A +   + +  +    SGT+I        PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSN---TPD 72

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
                + R E+  MKLL N+  V+   D     +       +++L++EY E G L N L 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLV 123

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            R    L E+E +     +  GV+  HAL   +VHRD+K EN+LL      K+ DFG   
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA- 178

Query: 183 GPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYK 238
                       AL     +  T+     Y +PE++    G P     SD+W+ GV L+ 
Sbjct: 179 ------------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 ICYYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
           +     PF E+ G    L        +E P+    S   + LISK+L V P  R    D+
Sbjct: 224 LLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDI 283

Query: 293 VKE--------LSDMKNI-SCPIINFYLKP 313
           +K         + D K+I   P  + YL P
Sbjct: 284 LKHPLLQKYPSIRDSKSIRDLPREDTYLTP 313

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 94/194 (48%), Gaps = 23/194 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY   G L   L S       +      ++ ++  +  +H  Q  ++HRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLLRS--HGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  NN  KL DFG     I  P   +   L         T  Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG---WSIINPRGVKRKTLC-------GTIDYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEA----GILTSRYEFPAFPAYSDRLRHLISKLLA 280
           +K D+WALGV  Y++   + PFE+  +      IL +  +FP     S  ++ LISKLL 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 281 VQPNHRPNIYDVVK 294
             P+ R ++ DV+K
Sbjct: 325 YNPSERISMRDVMK 338

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 128/288 (44%), Gaps = 43/288 (14%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV--LRAEVDAMKLLRNNRCVVSY 88
           G F  +Y+        +  TN  C  +V+  D     V  ++ EV  +  L+    +  Y
Sbjct: 28  GKFGIVYKGY------YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAM 148
                   S+ N T E++++MEYC  G L   L      ++ E  +  IM  +   +A M
Sbjct: 82  Y------GSYLNNT-ELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALM 129

Query: 149 HALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ 208
           H  +  ++HRDIK  NVL++ +   KLCDFG  +             L Q  I R T A 
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAG 177

Query: 209 ---YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAGILTSRYEFPA 263
              + +PE+I    G   D K DIW+LG+  Y+I     P+   ++  A  L ++ + P 
Sbjct: 178 TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPR 235

Query: 264 FPA--YSDRLRHLISKLLAVQPNHRPNIYDVVKE--LSDMKNISCPII 307
                +S  L+  I+  L   P  RP+  +++K   +   KN+S  I+
Sbjct: 236 LEGRQHSSALKEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASIL 283

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 122/255 (47%), Gaps = 40/255 (15%)

Query: 52  IACLKRVIVPDKPS--LNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLM 109
           I  ++R  + +K    L V R E++A+KLL +   V         +   QN  Y + +++
Sbjct: 91  IKLIRRDTLAEKKDQELKVYR-EINALKLLSHPNIV-------KLEDVLQNSKY-IGIVL 141

Query: 110 EYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSK 169
           EY   G    +L  +   RLKE    +    +  GVA +H+    LVHRD+K+EN+LL K
Sbjct: 142 EYASGGEFYKYLQRK--KRLKEPLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDK 197

Query: 170 NNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPID-EK 226
           ++   + DFG V+          E++   N +M+       Y +PE++  ++  P D  K
Sbjct: 198 HSNLVITDFGFVN----------EIS-TNNKLMKTPCGSPCYAAPELVLSTK--PYDARK 244

Query: 227 SDIWALGVFLYKICYYTTPFEKSGE---AGILTSRYEFPA-----FPAYSDRL-RHLISK 277
           +DIW+ GV LY +     P++   E      +   YE+       FP Y + L R LI K
Sbjct: 245 ADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRK 304

Query: 278 LLAVQPNHRPNIYDV 292
           +L +QP  R NI  V
Sbjct: 305 ILVIQPKSRLNIVQV 319

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 129/277 (46%), Gaps = 39/277 (14%)

Query: 26  KYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCV 85
           ++L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGV 145
           V +ID       F++    V++L+E C NG L+  +  R    + E EV   M  +  G+
Sbjct: 141 VQFIDC------FEDNV-NVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT 205
             MH+ +  ++HRD+K+ N+   ++   K+ DFG               A++ ND  R  
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLA-------------AVLANDRERKF 236

Query: 206 TA----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR--- 258
           T      Y +PE++ M +      + DIW++GV LY +     PF+ + +   +  R   
Sbjct: 237 TICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQ 294

Query: 259 --YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
             + +P     S   ++LI  +L++ P  RP+I +++
Sbjct: 295 RNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIM 331

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 94/197 (47%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L  +L   +Q+R+   E   +   +   V   H+LQ   VHRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL K    K+ DFG      R  +    L  V        T  Y +PE+I+     GF
Sbjct: 158 NILLDKKGRAKITDFGFT----RECATKTMLETVCG------TTVYMAPELIERKSYDGF 207

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRL-----RHLIS 276
            I    DIW+LGV LY + + T PF++  E    T        P Y+D +     + LIS
Sbjct: 208 KI----DIWSLGVILYTMIHGTMPFDEEDETK--TKWKIINEEPFYNDDVVSKDAKDLIS 261

Query: 277 KLLAVQPNHRPNIYDVV 293
           +LL   P+ RP +  V+
Sbjct: 262 QLLCKDPSQRPQLSQVL 278

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 145/334 (43%), Gaps = 62/334 (18%)

Query: 15  LTVGSHQVQIIKYLTAGGFAQIYQTT-ISPIDPFSG--TNIACLKRVIVP--DKPSLNVL 69
           L++   +  I K L    F+ IY    I  +   S   TN+  LKR+  P  +  S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR- 128
             EVD  K  ++   ++  +DS  A+   ++G+  V++L+ Y   G L +  +  L N  
Sbjct: 86  MKEVDNYKRFQSPY-IIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LKESEVVNIMWSVSQGVAAMH--------ALQ---------------------PPL--- 155
            + E+E + I+  +++G+  +H        A Q                      PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 156 -------------VHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIM 202
                         HRDIK  N+L S +    + + GS S      +   +L  +Q  + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 RNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEK----SGEA---GIL 255
            + T  Y +PE++ ++    +D K DIW+LG   Y + +  +PFE+    SG +    I 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 256 TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNI 289
           T  + FP+   YS+ L  LI+K L V P  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 124/275 (45%), Gaps = 37/275 (13%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A L    +  + +   L +E+   K +++   +V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L+  L  R Q  L E EV      +   + 
Sbjct: 206 QFIDC------FEDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   +N   K+ DFG               A++ ND  R  T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLA-------------AVLANDRERKFT 301

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSR 258
                 Y +PE++ M +      + D+W++GV +Y +     PF+      I        
Sbjct: 302 VCGTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCD 360

Query: 259 YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
           + FP     S   + L+  LL++ P  RP+I +++
Sbjct: 361 FIFPKEKPISHEAKVLVQDLLSLDPLERPSISEIM 395

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 99/198 (50%), Gaps = 16/198 (8%)

Query: 100 NGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRD 159
           N  Y ++++MEYC  G   + + +  +  L E++V  ++ SV  G+  +HA     +HRD
Sbjct: 82  NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRD 139

Query: 160 IKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR 219
           IK  N+LL+ +   K+ DFG VS  +R     +             T  + +PE++ M+ 
Sbjct: 140 IKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV---------GTPYWMAPEVV-MNE 188

Query: 220 GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS---RYEFPAFPAYSDRLRHLIS 276
           G   +EKSDIW+LG+  Y++     P  K     ++ +   R       AY++ ++H I+
Sbjct: 189 GMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIA 248

Query: 277 KLLAVQPNHRPNIYDVVK 294
             L   P  RP+  ++++
Sbjct: 249 TCLIKDPEKRPSASELLE 266

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 131/279 (46%), Gaps = 39/279 (13%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +++   +V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            ++D       F++ T  V++L+E C NG L++ +  R    L E EV      +   V 
Sbjct: 153 HFVDC------FEDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ N+  R  T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLA-------------AVLANNRERKYT 248

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV +Y +     PF+ + +  ++  R    
Sbjct: 249 VCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKAC 306

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
            Y +P     S   + LI+ +L V P  RP+I +++ ++
Sbjct: 307 QYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 142/329 (43%), Gaps = 59/329 (17%)

Query: 9   YPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDP--FSGTNI-ACLKRVIVPDKPS 65
           +  G TL +GS     + Y ++ G     Q  I  I    F+  N  A    ++ PD   
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG----QQAAIKVISKAVFNNDNANASDSALLTPDSLP 75

Query: 66  LNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL 125
             + R E+  MKLL N+  V+   D     S+       +++++EY E G L N L  R 
Sbjct: 76  YGIER-EIIIMKLL-NHPNVLRLYDVWETDSN-------LYMVLEYAEKGELFNLLVER- 125

Query: 126 QNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPI 185
              L E+E +     +  G++  HAL   +VHRD+K EN+LL      K+ DFG      
Sbjct: 126 -GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA---- 178

Query: 186 RPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICY 241
                    AL   D +  T+     Y +PE+I    G P    ++D+W+ G+ L+ +  
Sbjct: 179 ---------ALETEDKLLETSCGSPHYAAPEIIS---GLPYHGLETDVWSCGIILFALLT 226

Query: 242 YTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
              PF++  E G        + + ++E P     S   + LISK+L V P  R    +++
Sbjct: 227 GRLPFDE--EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREIL 284

Query: 294 KE--------LSDMKNI-SCPIINFYLKP 313
           K         + D K I + P  + YL P
Sbjct: 285 KHPLVQKYPSIKDSKTIRNLPREDTYLNP 313

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 105/236 (44%), Gaps = 38/236 (16%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +  E+  MKLLR+   V+S  D     S       ++++++EY E G L N L  R    
Sbjct: 77  IEREIIIMKLLRHPN-VLSLYDVWETNS-------KLYMILEYAEKGELFNLLVER--GP 126

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E E +     +  G++  HAL   +VHRD+K EN+LL      K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKLNIKIADFGMA------- 177

Query: 189 SNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICYYTT 244
                 AL   D M  T+     Y +PE++    G P    +SD+W+ GV L+ +     
Sbjct: 178 ------ALETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGRL 228

Query: 245 PF-EKSGEA-----GILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           PF E+ G        + +  YE P     S   + LI ++L V P  R    D++K
Sbjct: 229 PFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILK 284

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 144/321 (44%), Gaps = 39/321 (12%)

Query: 2   NQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP 61
           ++ N++   + +  +V  H  Q+I     G +  +Y+      D      +  +K V+  
Sbjct: 8   DRVNLTPIQRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEVVYE 59

Query: 62  DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFL 121
           +   LN + AE+  +K L +N  +V Y         F   +YE+++L+EYC NG L   +
Sbjct: 60  NDEELNDIMAEISLLKNLNHNN-IVKY-------HGFIRKSYELYILLEYCANGSLRRLI 111

Query: 122 NSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSV 181
            SR    L E+E    +     G+  +H     ++HRDIK  N+LLS +N  KL DFG  
Sbjct: 112 -SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-- 166

Query: 182 SGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICY 241
              +    N   L L         T  + +PE++  +RG      SDIW+LG  + ++  
Sbjct: 167 ---VSTIVNSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLT 213

Query: 242 YTTPFEKSGEAGILTSRYEFPAFP--AYSDRLRHLISKLLAVQPNHRPNIYDVVKE--LS 297
              P+    +A I  +      +P  ++S+ L+  +SK        RP    ++K   ++
Sbjct: 214 KNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWIN 273

Query: 298 DMKNISCPIINFYLKPNMTDA 318
             +N+    +N + K + TDA
Sbjct: 274 STENVKVDKLNKF-KEDFTDA 293

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 139/330 (42%), Gaps = 54/330 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFA--QIYQTTISPIDPFSGTNIACLKRVIVPD 62
           I  +  G TL +GS  +VQ+ +  + G  A  ++    +      SGT+I        PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVG---STTPD 72

Query: 63  KPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLN 122
                + R E+  MKLL N+  V+   D     +       +++L++EY E G L N L 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNT-------DLYLVLEYAEKGELFNLLV 123

Query: 123 SRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS 182
            R    L E E +     +  GV+  HAL   +VHRD+K EN+LL      K+ DFG   
Sbjct: 124 ER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMA- 178

Query: 183 GPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYK 238
                       AL     +  T+     Y +PE++    G P     SD+W+ GV L+ 
Sbjct: 179 ------------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFA 223

Query: 239 ICYYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
           +     PF E+ G    L        +E P+    S   + LI K+L V P  R    D+
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283

Query: 293 VKE--------LSDMKNI-SCPIINFYLKP 313
           +K         + D K+I   P  + YL P
Sbjct: 284 LKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 153/369 (41%), Gaps = 76/369 (20%)

Query: 11  QGTTLTVGSHQVQIIKYLTAGGFAQIYQTTI----------SPIDPFSGTNIACLKRVIV 60
           + TT+ VGS +  + K +  G FA +++  +          S +D  S  N  C    IV
Sbjct: 27  ERTTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIV 86

Query: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDS----HAAK-SSFQNGTYEVFLLMEYCENG 115
           P        R+++   KLL N    ++ +      H  K   F+  + + +L+MEYC  G
Sbjct: 87  P--------RSKLKNKKLLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLG 138

Query: 116 GLINFLNSRLQ----------------------NRLKESEVVNIMWSVSQGVAAMHALQP 153
            L   +  R Q                      N L ++ ++N +  +S  +  + +   
Sbjct: 139 DLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRS--K 196

Query: 154 PLVHRDIKIENVLLSK-----NNEFKLCDFGSV---SGPIRPPSNPQELALVQNDIMRNT 205
            LVHRDIK +N+LLS      N+     D G V   + PI   ++      + N  M  T
Sbjct: 197 NLVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSMAET 256

Query: 206 TAQ---YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL------T 256
                 Y +PE+++  +    + K+D+W++G  LY++CY   PF+ S    +        
Sbjct: 257 LCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAN 313

Query: 257 SRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFYLKPNMT 316
               FP +    + L+ LISKLL   P  R        E  +  N    ++N  L P  T
Sbjct: 314 DLIYFPTYIEIDNNLKSLISKLLTFDPQERI-------EFDEFFN--NELVNADLSPYET 364

Query: 317 DASNNIQHL 325
             +++IQ L
Sbjct: 365 RDNDDIQEL 373

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 137/334 (41%), Gaps = 63/334 (18%)

Query: 13  TTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIA-----CLKRVIVPDKPSLN 67
           TT+ V   + +I + L  GG + +Y   +          I       LK++I P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL-- 125
               E++  K  ++   V+  IDS   +   +NG+  +++++ Y   G L + +N RL  
Sbjct: 81  NGMREIENYKRFQSPY-VIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLKESEVVNIMWSVSQGVAAMH------------------------------------ 149
              + E+E V IM  V++G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS-GPIRPPSNPQELALVQND 200
                   A      HRDI   N+L S      + D GS S   IR  S  Q L+ +Q  
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQ-LSELQEW 256

Query: 201 IMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------G 253
           +  N T  Y +PE++++     +  K DIW++G   Y + +  +PFE+  +         
Sbjct: 257 VNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYA 316

Query: 254 ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRP 287
           I T +Y FP    +S+ L ++I K + V P  RP
Sbjct: 317 INTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 112/247 (45%), Gaps = 44/247 (17%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++L++EY E G L N L  R    L E E +     +   V+  HAL   +VHRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHAL--GIVHRDLKPEN 157

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA----QYRSPEMIDMSRG 220
           +LL  +   K+ DFG              +A +Q D     T+     Y +PE++    G
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVS---G 200

Query: 221 FPIDE-KSDIWALGVFLYKICYYTTPF-EKSGEAGILT-----SRYEFPAFPAYSDRLRH 273
            P +   SD+W+ GV L+ +     PF E++G    L       ++E P     S   + 
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 274 LISKLLAVQPNHRPNIYDVV--------KELSDMKNI-SCPIINFYLKPNMTDASNNIQH 324
           LISK+L V P  R  I D++        + + D K+I   P  + YL P + DA   I  
Sbjct: 261 LISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYP-LADAGAAID- 318

Query: 325 LHSIMNN 331
             SI+ N
Sbjct: 319 -DSILQN 324

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 109/238 (45%), Gaps = 44/238 (18%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++L++EY E G L N L  R    L E E V     +   ++  HAL   +VHRD+K EN
Sbjct: 94  LYLILEYAEKGELFNLLVDR--GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPEN 149

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA----QYRSPEMIDM--S 218
           +LL  +   K+ DFG              +A +Q D     T+     Y +PE++     
Sbjct: 150 LLLDNDYNIKIADFG--------------MAALQTDARLLETSCGSPHYAAPEIVSGLPY 195

Query: 219 RGFPIDEKSDIWALGVFLYKICYYTTPF-EKSGEAGILT-----SRYEFPAFPAYSDRLR 272
           RGF     SD+W+ GV L+ +     PF E +G    L       ++E P     S   +
Sbjct: 196 RGFA----SDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQ 251

Query: 273 HLISKLLAVQPNHRPNIYDVV--------KELSDMKNI-SCPIINFYLKPNMTDASNN 321
           +LIS++L V P  R    D++        + + D K+I + P  N YL P + DA N+
Sbjct: 252 NLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYP-LADAGNH 308

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 114/243 (46%), Gaps = 32/243 (13%)

Query: 9   YPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV 68
           +P  T +   S    I + +  G F  +Y+     ID  +G  +A     +   +  ++V
Sbjct: 23  HPPDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDDIDV 78

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           L  E+  +  LR    V +Y  ++    S       ++++ME+C  G   + L    ++R
Sbjct: 79  LAQEIYFLSELRAP-FVTTYYKTYVEDVS-------MWIVMEFCGGGSCADLLKHLPEHR 130

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E++V  I+  V  G+  +H+ +   +HRD+K  N+LL+   E KL DFG VSG I   
Sbjct: 131 LPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMAT 187

Query: 189 SNPQELALVQNDIMRNT---TAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTP 245
                       + RNT   T  + +PE+I    G+  DEK+DIW+LG+   ++     P
Sbjct: 188 ------------LKRNTFVGTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPP 233

Query: 246 FEK 248
           + K
Sbjct: 234 YAK 236

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 97/203 (47%), Gaps = 28/203 (13%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++EY   G    ++  + + RLKES    +   +  GV  MH+    LVH
Sbjct: 122 LQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LVH 176

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+LL KN    + DFG V+             L  N+ M+ +     Y +PE++
Sbjct: 177 RDLKLENLLLDKNENLVITDFGFVNE-----------FLPDNEYMKTSCGSPCYAAPELV 225

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSG---EAGILTSRYEFPA-----FPAY 267
             +R + +  K+D+W+ G+ LY +     P++      E   +   Y++       FP Y
Sbjct: 226 ISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEY 284

Query: 268 SDRL-RHLISKLLAVQPNHRPNI 289
              + R L+ K+L   PN R N+
Sbjct: 285 ITPIPRDLLRKILVPDPNKRVNM 307

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 97/199 (48%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY E G L ++L S+   +L ESE ++    + Q VA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSR 219
           N+LL K     K+ DFG               AL  +D +  T+     Y SPE++ + R
Sbjct: 204 NLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASPEIV-LGR 249

Query: 220 GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLI 275
            +     SD+W+ G+ L+ +     PF       +L    + +Y+ P +   S   + LI
Sbjct: 250 KYH-GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDLI 306

Query: 276 SKLLAVQPNHRPNIYDVVK 294
           S++L V PN R  I  +++
Sbjct: 307 SRILVVDPNRRITIDQILQ 325

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q      D F+   +A   +  +  + +   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID     S+       V++L+E C NG L+  L  R    L E EV      +   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG               A++ N+  R  T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANESERKYT 238

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW+LGV LY +     PF+ + +   +  R    
Sbjct: 239 ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCR 296

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     SD  + LI  +L++ P  RP++ +++
Sbjct: 297 DFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 100/205 (48%), Gaps = 17/205 (8%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           +FQ+    ++ L+EY  NG  ++ +  +    L E         +  G+  +H  +  ++
Sbjct: 271 TFQDEA-NLYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGII 325

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMID 216
           HRDIK EN+LL K+ + KL DFG+    +      +E  L         TA+Y SPE+++
Sbjct: 326 HRDIKPENILLDKSMKVKLTDFGTAK-LLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLN 384

Query: 217 MSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRL 271
            S    +D K DIWA G  L+++     PF+ + E      ++  +Y F A FP     +
Sbjct: 385 DSW---VDHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---V 438

Query: 272 RHLISKLLAVQPNHRPNIYDVVKEL 296
           R L+ ++L  +P HR  I  + K L
Sbjct: 439 RDLVKQILVKKPEHRLTIPQIEKHL 463

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 81/321 (25%), Positives = 143/321 (44%), Gaps = 39/321 (12%)

Query: 2   NQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP 61
           ++ N++   + +  +V  H  Q+I     G +  +Y+      D      +  +K ++  
Sbjct: 8   DRVNLTPIQRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYE 59

Query: 62  DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFL 121
           +   LN + AE+  +K L N+  +V Y         F   +YE+++L+EYC NG L   +
Sbjct: 60  NDEELNDIMAEISLLKNL-NHHNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI 111

Query: 122 NSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSV 181
            SR    L E+E    +     G+  +H     ++HRDIK  N+LLS +N  KL DFG  
Sbjct: 112 -SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-- 166

Query: 182 SGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICY 241
              +    N   L L         T  + +PE++  +RG      SDIW+LG  + ++  
Sbjct: 167 ---VSTIVNSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLT 213

Query: 242 YTTPFEKSGEAGILTSRYEFPAFP--AYSDRLRHLISKLLAVQPNHRPNIYDVVKE--LS 297
              P+    +A I  +      +P  ++S+ L+  +SK        RP    ++K   ++
Sbjct: 214 KNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHVWIT 273

Query: 298 DMKNISCPIINFYLKPNMTDA 318
             ++     +N + K N TDA
Sbjct: 274 STESTKADKLNKF-KENFTDA 293

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 100/202 (49%), Gaps = 37/202 (18%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E+FL++EY + G L ++L SR   RL E E ++    + +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQ--NDIMRNTTA--QYRSPEMIDMS 218
           N+LL K N+  K+ DFG              +A +Q  N ++  +     Y SPE++ M 
Sbjct: 187 NLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASPEIV-MG 231

Query: 219 R---GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRL 271
           +   G P    SD+W+ G+ L+ +     PF       +L      +Y+ P   + S   
Sbjct: 232 KNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGA 285

Query: 272 RHLISKLLAVQPNHRPNIYDVV 293
           + LIS++L V P+ R +I +++
Sbjct: 286 QDLISRILVVDPDKRISINEIL 307

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 119/252 (47%), Gaps = 28/252 (11%)

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +  L +  +  +  +  +  E +A++ L N+R +V    +   +SS       ++ L+EY
Sbjct: 210 VKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESS-------LYFLLEY 262

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
             NG  ++ +  +    L E         +  G+  +H+    ++HRDIK EN+LL K+ 
Sbjct: 263 APNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDM 318

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT----TAQYRSPEMIDMSRGFPIDEKS 227
           + K+ DFG  +  I  P N  E     N + R+     TA+Y SPE+++ S    +D + 
Sbjct: 319 KVKITDFG--TAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY---VDARC 373

Query: 228 DIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQ 282
           DIWA G  ++++     PF+ + E      ++  +Y F A FP     +R L+ ++L   
Sbjct: 374 DIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLKV 430

Query: 283 PNHRPNIYDVVK 294
           P  R  I  + K
Sbjct: 431 PEQRLTIPQIEK 442

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 97/201 (48%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY E G L ++L SR   +L E E V+    + QGV+  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLLSKNN-EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSR 219
           N+LL K N   K+ DFG               AL   D +  T+     Y SPE++   +
Sbjct: 197 NLLLDKKNLSVKIADFGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 220 --GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRH 273
             G P    SD+W+ G+ L+ +     PF       +L    + +Y+ P     S+  + 
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKD 297

Query: 274 LISKLLAVQPNHRPNIYDVVK 294
           LI+K+L V P  R  I +V++
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 129/280 (46%), Gaps = 30/280 (10%)

Query: 19  SHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKL 78
           +H   + + +  G F  +Y+     ID  +   +A     +      L VL  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIM 138
           L++   +++YI +    +S       ++++MEYC  G   + L     N L E +V  I 
Sbjct: 75  LKSP-YIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 WSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQ 198
             + +G+  +H  +   +HRDIK  N+LL++    KL DFG VSG ++         L +
Sbjct: 127 REILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLKS-------TLRR 176

Query: 199 NDIMRNTTAQYRSPEMIDMS-RGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILT- 256
             I+   T  + +PE+   +  G+  DEK DIW+LG+ ++++     P  K     +L  
Sbjct: 177 GTIV--GTPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLAN 232

Query: 257 -SRYEFPAFP-AYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
            SR   P    AYSD  +  ++  L   PN RP   D++K
Sbjct: 233 LSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 103/230 (44%), Gaps = 43/230 (18%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           +++++EY + G L N L  R    L E E +     +  G++  HAL   +VHRD+K EN
Sbjct: 107 LYMVLEYAQKGELFNLLVER--GPLPEKEAIRFFRQIVIGISYCHAL--GIVHRDLKPEN 162

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGF 221
           +LL      K+ DFG               AL   D +  T+     Y +PE++    G 
Sbjct: 163 LLLDHKFNIKIADFGMA-------------ALETEDKLLETSCGSPHYAAPEIVS---GI 206

Query: 222 PIDE-KSDIWALGVFLYKICYYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLR 272
           P     SD+W+ GV L+ +     PF+   E G        + + RYE P     S   +
Sbjct: 207 PYHGFASDVWSCGVILFALLTGRLPFD--DEDGNIRNLLLQVQSGRYEMPGDDEISPDAQ 264

Query: 273 HLISKLLAVQPNHRPNIYDVVKE--------LSDMKNI-SCPIINFYLKP 313
            LI+++L V P  R    D++K         ++D K+I + P  + YL P
Sbjct: 265 DLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHP 314

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 109/237 (45%), Gaps = 42/237 (17%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++L++EY E G L N L       L E E +N    +  G++  HAL   +VHRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA----QYRSPEMIDMSRG 220
           +LL      K+ DFG              +A +Q D     T+     Y +PE++    G
Sbjct: 158 LLLDSFYNIKIADFG--------------MAALQTDADLLETSCGSPHYAAPEIVS---G 200

Query: 221 FPIDE-KSDIWALGVFLYKICYYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRH 273
            P +   SD+W+ GV L+ +     PF E++G    L       ++E P     S   + 
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQD 260

Query: 274 LISKLLAVQPNHRPNIYDVV--------KELSDMKNI-SCPIINFYLKPNMTDASNN 321
           LI K+L V P  R  I D++        + + D K+I   P  N YL P + D++N+
Sbjct: 261 LIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP-LADSNNH 316

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 126/276 (45%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +++   +V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 156 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   +    K+ DFG               A + ND  R  T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLA-------------ATLANDRERKYT 251

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW++GV +Y +     PF+ S +   +  R    
Sbjct: 252 VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKCR 309

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     S   + LI  +L++ P  RP++ +++
Sbjct: 310 DFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIM 345

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 126/276 (45%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            ++D       F++ T  V++L+E C NG L++ L  R    L E EV      +   V 
Sbjct: 140 QFVDC------FEDDT-NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLA-------------AVLANDRERKYT 235

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++   +      + DIW+ GV +Y +     PF+ + E  I+  R    
Sbjct: 236 VCGTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCG 293

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     S     LI  +L++ P  RP++ +++
Sbjct: 294 DFVFPKDKFISPEALVLIKDILSIDPLERPSLDEII 329

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 124/286 (43%), Gaps = 60/286 (20%)

Query: 17  VGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP--DKPSLNVLRA--- 71
           VG++++Q  K +  G F ++Y  T  P            ++V++   DK   NV+R    
Sbjct: 39  VGNYKIQ--KQIGEGSFGKVYLATHRPTK----------QKVVLKTGDKSDPNVVREVFY 86

Query: 72  --EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRL 129
             + D   + +    +V+                +V++ +EYC    L + L S+  +RL
Sbjct: 87  HRQFDYPYITKLYEVIVTET--------------KVWMALEYCPGKELYDHLLSK--SRL 130

Query: 130 KESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPS 189
              E   +   ++  V   H L    VHRD+K+ENVLL KN   KL DFG      R   
Sbjct: 131 PTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFT----RESM 184

Query: 190 NPQELALVQNDIMRNTTAQYRSPEMIDMS--RGFPIDEKSDIWALGVFLYKICYYTTPFE 247
               L  V        T  Y +PEMI      GF +    DIW+LGV LY +     PF+
Sbjct: 185 TKAVLETVCG------TTVYMAPEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPFD 234

Query: 248 KSGEAGILTSRYEFPAFPAYSDRL-----RHLISKLLAVQPNHRPN 288
           +  +  +LT +      P   +R+     ++LI +LL+  P  RPN
Sbjct: 235 EDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPN 278

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 128/280 (45%), Gaps = 45/280 (16%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +R+   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            + D       F++ T  V++L+E C NG L++ L  R Q  L E EV      +   + 
Sbjct: 134 QFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLA-------------AVLANDRERKYT 229

Query: 207 A----QYRSPEMI---DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR- 258
                 Y +PE++        F +    D+W++GV +Y +     PF+ + E   +  R 
Sbjct: 230 ICGTPNYIAPEVLTGKHTGHSFEV----DVWSIGVMIYALLIGKPPFQ-AKEVNTIYERI 284

Query: 259 ----YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               + FP     S   + LI  +L++ P  RP++ ++++
Sbjct: 285 KVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIME 324

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/321 (25%), Positives = 144/321 (44%), Gaps = 39/321 (12%)

Query: 2   NQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP 61
           ++ N++   + +  +V  H  Q+I     G +  +Y+      D      +  +K ++  
Sbjct: 8   DRVNLTPIQRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYE 59

Query: 62  DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFL 121
               LN + AE+  +K L N+  +V Y         F   +YE+++L+EYC NG L   +
Sbjct: 60  SDEELNDIMAEISLLKNL-NHDNIVKY-------HGFIRKSYELYILLEYCANGSLRRLI 111

Query: 122 NSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSV 181
            SR    L E+E  + +     G+  +H     ++HRDIK  N+LLS +N  KL DFG  
Sbjct: 112 -SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-- 166

Query: 182 SGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICY 241
              +    N   L L         T  + +PE++  +RG      SDIW+LG  + ++  
Sbjct: 167 ---VSTIVNSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLT 213

Query: 242 YTTPFEKSGEAGILTSRYEFPAFP--AYSDRLRHLISKLLAVQPNHRPNIYDVVKE--LS 297
              P+    +A I  +      +P  ++S+ L+  +SK        RP    ++K   ++
Sbjct: 214 KNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWIT 273

Query: 298 DMKNISCPIINFYLKPNMTDA 318
             +N+    +N + K + TDA
Sbjct: 274 STENVKDDKLNKF-KEDFTDA 293

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 133/285 (46%), Gaps = 43/285 (15%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G F  +Y+     ID  +G  +A     +      + ++  E+  +  L++   + +YI 
Sbjct: 30  GNFGDVYKA----IDKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKSPY-ITNYIT 84

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +     S       ++++MEYC  G   + +       L E +V  I  +V +G+  +H 
Sbjct: 85  TMLEDVS-------MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TA 207
            +   +HRD+K  NVLL+ +   KL DFG VSG +R  +             RNT   T 
Sbjct: 138 QRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAK------------RNTFVGTP 182

Query: 208 QYRSPEMI-DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS---RYEFPA 263
            + +PE+I + S G+  +EK+DIW+LG+ +Y++     P+ K     ++ +   +     
Sbjct: 183 YWMAPEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDC 240

Query: 264 FPAYSDRLRHLISKLLAVQPNHRPNIYDVVKE-------LSDMKN 301
             ++SD  +  IS  L   P+ RP   +++++       ++D++N
Sbjct: 241 MVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIKITDLRN 285

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 121/273 (44%), Gaps = 41/273 (15%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV--LRAEVDAMKLLRNNRCVVSY 88
           G F  +Y+        ++ T   C  +V+  D     V  ++ E+  +  L+    +  Y
Sbjct: 28  GKFGVVYKGY------YTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAM 148
                   S+ N T +++++MEYC  G L   L      ++ E  +  IM  +    A M
Sbjct: 82  Y------GSYLNDT-KLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--TALM 129

Query: 149 HALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ 208
           H  +  ++HRDIK  NVL++ +   KLCDFG  +             L Q  I R T A 
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAG 177

Query: 209 ---YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAGILTSRYEFPA 263
              + +PE+I    G   D K DIW+LG+  Y+I     P+   ++  A  L ++ + P 
Sbjct: 178 TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPR 235

Query: 264 FPA--YSDRLRHLISKLLAVQPNHRPNIYDVVK 294
                +S  L+ +I+  L   P  RP+  D++K
Sbjct: 236 LEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 31/200 (15%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L SR   RL E E V+    + QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLLS-KNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA--QYRSPEMI--DMS 218
           N+LL  KN+  K+ DFG  +              V N +++ +     Y SPE++     
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHL 274
            G P    SD+W+ G+ L+ +     PF       +L    + +Y+ P     S   + L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--NLSKEAQDL 347

Query: 275 ISKLLAVQPNHRPNIYDVVK 294
           I+K+L V P  R    ++++
Sbjct: 348 IAKILTVNPAKRLTTEEILR 367

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 141/328 (42%), Gaps = 53/328 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKP 64
           I  +  G TL VGS  +V + + +  G  A +   + S  +    T +      ++P   
Sbjct: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP--- 73

Query: 65  SLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSR 124
               +  E+  MKLL N+  V+   D     +       ++++++EY E G L N L  R
Sbjct: 74  --YGIEREITIMKLL-NHPNVLRLYDVWETST-------DLYMVLEYVEKGELFNLLIER 123

Query: 125 LQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGP 184
               L E+E V     +  G++  HAL   +VHRD+K EN+LL      KL DFG     
Sbjct: 124 --GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMA--- 176

Query: 185 IRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKIC 240
                     AL   D +  T+     Y +PE++    G P    +SD+W+ GV LY + 
Sbjct: 177 ----------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 223

Query: 241 YYTTPF-EKSGEAGIL-----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               PF E  G    L     +  +E P     S   + LI+K+L V P+ R    +++K
Sbjct: 224 TGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283

Query: 295 E--------LSDMKNI-SCPIINFYLKP 313
                    + D K+I + P  + YL P
Sbjct: 284 HPLLKKYPSIKDSKSIRNLPREDTYLNP 311

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 126/276 (45%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +++   +V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 137

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID       F++ T  V++L+E C NG L++ L  R    L E EV      +   + 
Sbjct: 138 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG               A++ ND  R  T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANDRERKYT 233

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++   +      + DIW++GV +Y +     PF+ + E  I+  R    
Sbjct: 234 VCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSG 291

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            Y FP     S  +  LI  +L++ P  RP++ +++
Sbjct: 292 DYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 327

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 109/237 (45%), Gaps = 42/237 (17%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++L++EY E G L N L  R    L E E +     +   ++  HAL   +VHRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHAL--GIVHRDLKPEN 157

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDI-MRNTTA---QYRSPEMIDMSRG 220
           +LL  +   K+ DFG              +A +Q D  M  T+     Y +PE++    G
Sbjct: 158 LLLDNSYNIKIADFG--------------MAALQTDAGMLETSCGSPHYAAPEIVS---G 200

Query: 221 FPIDE-KSDIWALGVFLYKICYYTTPF-EKSGEA-----GILTSRYEFPAFPAYSDRLRH 273
            P +   SD+W+ GV L+ +     PF E++G        +   ++E P     S   + 
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 274 LISKLLAVQPNHRPNIYDVV--------KELSDMKNI-SCPIINFYLKPNMTDASNN 321
           LI ++L V P  R  I D++        + + D K+I   P  N YL P + DA N+
Sbjct: 261 LIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP-LADADNH 316

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 128/280 (45%), Gaps = 45/280 (16%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +++   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            + D       F++ T  V++L+E C NG L++ L  R Q  L E EV      +   + 
Sbjct: 134 QFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+   K+   K+ DFG               A++ ND  R  T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLA-------------AVLANDRERKYT 229

Query: 207 A----QYRSPEMI---DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR- 258
                 Y +PE++        F +    DIW++GV +Y +     PF+ + E   +  R 
Sbjct: 230 ICGTPNYIAPEVLTGKHTGHSFEV----DIWSIGVMIYALLIGKPPFQ-AKEVNTIYERI 284

Query: 259 ----YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               + FP     S   + LI  +L++ P  RP++ ++++
Sbjct: 285 KVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIME 324

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 134/298 (44%), Gaps = 43/298 (14%)

Query: 6   ISTYPQGTTLTVGSH-QVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKP 64
           +  +  G TL  GS  +V++ K +  G  A I    I P      TN +        + P
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMETGKLAAI---KIVPKKVVRSTNASKKSNAANGNLP 114

Query: 65  SLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSR 124
               +  E+  MKL+ +   +  Y         ++N + E+FL++EY E G L ++L S+
Sbjct: 115 Y--GIEREIIIMKLISHPNIMALY-------EVWENKS-ELFLVLEYVEGGELFDYLVSK 164

Query: 125 LQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLS-KNNEFKLCDFGSVSG 183
              +L E E V+    + QGVA  H     + HRD+K EN+L+  KN++ K+ DFG    
Sbjct: 165 --GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPENLLVDKKNHQIKIADFGMA-- 218

Query: 184 PIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
                      AL   + +  T+     Y SPE++ M + +     SD+W+ G+ L+ + 
Sbjct: 219 -----------ALETTNKLLETSCGSPHYASPEIV-MGKNYH-GSPSDVWSCGIILFALL 265

Query: 241 YYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               PF       +L    + +Y  P     S   + LISK+L V P  R  I +V++
Sbjct: 266 TGHLPFNDDNIKKLLLKVQSGKYHMPQ--NISSEAQDLISKILIVDPRGRITINEVLQ 321

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 124/264 (46%), Gaps = 36/264 (13%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G F  +Y+      D  +G  +A     +   +  +++L  E+  +  LR+   + +YI 
Sbjct: 24  GNFGDVYKA----FDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRSPY-ITNYIT 78

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +     S       ++++MEYC  G   + + +   N L E++V  I   V +G+  +H 
Sbjct: 79  TMIEDVS-------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHD 131

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TA 207
            +   +HRDIK  N+LL+   + KL DFG VSG IR              + R T   T 
Sbjct: 132 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRAT------------MKRGTFVGTP 176

Query: 208 QYRSPEMIDM-SRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAF 264
            + +PE+++  S G+  +EK+DIW+LG+ +Y++     P  K     ++ S  R + P  
Sbjct: 177 YWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKL 234

Query: 265 PA-YSDRLRHLISKLLAVQPNHRP 287
              YSD  +  ++  L   PN RP
Sbjct: 235 HGQYSDVAKGFVAACLVKDPNLRP 258

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 118/263 (44%), Gaps = 39/263 (14%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           +FQ+    ++ L+EY  +G  +  +  +    L E         +   V ++HA+   ++
Sbjct: 192 TFQDEA-SLYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--II 246

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQE----LALVQNDIMRNTTAQYRSP 212
           HRDIK EN+LL K+ + KL DFG+       PSN  +      L         TA+Y SP
Sbjct: 247 HRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSP 306

Query: 213 EMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAY 267
           E+++ S     D + DIWA G  LY++     PF+ + E      ++  +Y F A FP  
Sbjct: 307 ELLNDSY---TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLI 363

Query: 268 SDRLRHLISKLLAVQPNHRPNI---------YDVVKELSDMKNISCPIINFY------LK 312
           +   + L+ KLL  +PN R  +         + V  E   + +   P I  Y      +K
Sbjct: 364 A---KDLVKKLLVREPNDRLTVEQIKAHVFFHGVHFEDGSVWDDDAPEIQPYKVSAEAMK 420

Query: 313 P----NMTDASNNIQHLHSIMNN 331
           P    + TDA+  +  LH   NN
Sbjct: 421 PLPKISETDAATKLASLHLASNN 443

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 127/267 (47%), Gaps = 27/267 (10%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G F  +Y+     ID  +   +A     +      +++L  E+  +  L+++  +++YI 
Sbjct: 25  GNFGDVYKA----IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSDY-IINYIT 79

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +     S       ++++M+YC  G   + +     N + E +V  I+ +V  G+  +H 
Sbjct: 80  TIMEDVS-------MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLH- 131

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYR 210
            +   +HRDIK  N+LL+ + + KL DFG VSG I+        A ++ D    T   + 
Sbjct: 132 -EQKKIHRDIKAANILLTDDGQVKLGDFG-VSGQIK--------ATLKRDTFVGT-PYWM 180

Query: 211 SPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFPA-Y 267
           +PE+I+       DEK DIW+LG+  Y++     P  K     ++TS  + + P     Y
Sbjct: 181 APEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPY 240

Query: 268 SDRLRHLISKLLAVQPNHRPNIYDVVK 294
           +D  +  IS  L   P  RPN+ +++K
Sbjct: 241 NDFTKSFISFCLIKDPKLRPNVQNLLK 267

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 105/223 (47%), Gaps = 22/223 (9%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E +A++ L N+R +V    +   +SS       ++ L+EY  NG  ++ +  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESS-------LYFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNP 191
                    +   +  +H+    +VHRDIK EN+LL K+ + KL DFG+       P+  
Sbjct: 266 DCACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTT 323

Query: 192 QELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE 251
               L+        TA+Y SPE+++ +    +D + DIWA G  L+++     PF+ + E
Sbjct: 324 DSYDLLSRSKSFVGTAEYVSPELLNDNY---VDYRCDIWAFGCILFQMIAGKPPFKATNE 380

Query: 252 ----AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQPNHRPNI 289
                 ++  +Y F A FP     +R L+  +L  QP  R  I
Sbjct: 381 YLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTI 420

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 108/238 (45%), Gaps = 42/238 (17%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +  E+  MKLLR+   V+S  D     S+       +++++EY E G L N L  +    
Sbjct: 81  IEREIIIMKLLRHAN-VLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEK--GP 130

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E E V     +  G++  HAL   +VHRD+K EN+LL      K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 189 SNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICYYTT 244
                 AL   D +  T+     Y +PE++    G P    +SD+W+ GV L+ +     
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 245 PFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           PF++  E G        + + ++E P     S   + LIS++L V P  R    +++K
Sbjct: 233 PFDE--EDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 152/349 (43%), Gaps = 75/349 (21%)

Query: 2   NQPNISTYPQGTTLTVGSH-QVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60
           N+  +  +  G TL  GS  +V++ K + +G  A I    I P            KR + 
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAI---KIVP------------KRNVR 98

Query: 61  PDKPSLNVL----RAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116
            ++  +  L      E+  MKL+ +   +  Y         ++N + E++L++EY E G 
Sbjct: 99  HNQKQVTALPYGIEREIIIMKLITHPNIMALY-------EVWENKS-ELYLVLEYVEGGE 150

Query: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNE-FKL 175
           L ++L +R   +L E E ++    + QGV+  H     + HRD+K EN+LL K N+  K+
Sbjct: 151 LFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKI 206

Query: 176 CDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSR--GFPIDEKSDIW 230
            DFG               AL   + +  T+     Y SPE++   +  G P    SD+W
Sbjct: 207 ADFGMA-------------ALETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVW 249

Query: 231 ALGVFLYKICYYTTPFEKSGEAGILT----SRYEFPAFPAYSDRLRHLISKLLAVQPNHR 286
           + G+ L+ +     PF       +L      RY+ P+    S   + LISK+L V P  R
Sbjct: 250 SCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKR 307

Query: 287 PNIYDVVKELSDMK-------NISCPIINFYLKPNMTDASNNIQHLHSI 328
             +  +++    +K        ++CP+     +P + D       +HSI
Sbjct: 308 ITVDKILEHPLLVKYDNPGKGGLACPLEKPEERPKVLD-------IHSI 349

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 111/222 (50%), Gaps = 38/222 (17%)

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQG 144
           ++S+ +  A    ++N + E++L++EY + G L ++L S+   +L E E ++    + +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLVHRDIKIENVLLSKNN-EFKLCDFGSVSGPIRPPSNPQELALVQ--NDI 201
           V+  H+    + HRD+K EN+LL K N   K+ DFG              +A ++  N +
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG--------------MAALELPNKL 270

Query: 202 MRNTTA--QYRSPEMIDMSR---GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL- 255
           ++ +     Y SPE++ M R   G P    SD+W+ G+ L+ +     PF       +L 
Sbjct: 271 LKTSCGSPHYASPEIV-MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
              + +Y+ P+    S   R LISK+L + P  R    +++K
Sbjct: 326 KVQSGKYQMPS--NLSSEARDLISKILVIDPEKRITTQEILK 365

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q      + F+   +A   +  +  + +   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID     S+       V++L+E C NG L+  L  R    L E EV      +   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG               A++ N+  R  T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANESERKYT 238

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW+LGV LY +     PF+ + +   +  R    
Sbjct: 239 ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCR 296

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     SD  + LI  +L++ P  RP++ +++
Sbjct: 297 DFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 98/198 (49%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L SR   +L E E V+    + QGVA  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSR 219
           N+LL K N+  K+ DFG               AL  +D + +T+     Y SPE++ M +
Sbjct: 229 NLLLDKKNKIIKIADFGMA-------------ALEVSDKLLSTSCGSPHYASPEIV-MGK 274

Query: 220 GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLI 275
            +     +D+W+ G+ L+ +     PF       +L    +  Y  P+    S   + LI
Sbjct: 275 SYH-GSPTDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPS--DLSPDAKDLI 331

Query: 276 SKLLAVQPNHRPNIYDVV 293
           SK+L V P+ R    +++
Sbjct: 332 SKILVVDPDKRLTTTEIL 349

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q      + F+   +A   +  +  + +   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            +ID     S+       V++L+E C NG L+  L  R    L E EV      +   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG               A++ N+  R  T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANESERKYT 238

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW+LGV LY +     PF+ + +   +  R    
Sbjct: 239 ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCR 296

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     SD  + LI  +L++ P  RP++ +++
Sbjct: 297 DFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 27  YLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVV 86
           +L  GGFA+ +Q      + F+   +A   +  +  + +   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVA 146
            ++D     S+       V++L+E C NG L+  L  R    L E EV      +   + 
Sbjct: 143 QFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG               A++ N+  R  T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLANESERKYT 238

Query: 207 A----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSR---- 258
                 Y +PE++ M +      + DIW+LGV LY +     PF+ + +   +  R    
Sbjct: 239 ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCR 296

Query: 259 -YEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
            + FP     SD  + LI  +L++ P  RP++ +++
Sbjct: 297 DFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1121

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 135/288 (46%), Gaps = 32/288 (11%)

Query: 14  TLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEV 73
           T++ G +  +  + +  G ++ +   T   I+      +  L +  +  +  +  +  E 
Sbjct: 235 TISKGINDFKFGEVIGDGSYSTVMLAT--SIESNQKYAVKVLNKEYLIRQKKVKYVNVEK 292

Query: 74  DAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESE 133
           + ++ L N+R VV          +FQ+  + ++ L+EY  NG  ++ +  +    L E  
Sbjct: 293 NTLQRLNNSRTVVKLF------FTFQDEAH-LYFLLEYAPNGDFLSVM--KKYGTLNEEC 343

Query: 134 VVNIMWSVSQGVAAMHALQPP-LVHRDIKIENVLLSKNNEFKLCDFGS--VSGPIRPPSN 190
                +  +Q + A+H +    ++HRDIK EN+LL  + + KL DFG+  +  P+   +N
Sbjct: 344 AC---YYGAQIIDAIHFIHSKGIIHRDIKPENILLDGDMKVKLTDFGTAKILDPVTKVNN 400

Query: 191 PQELALVQNDIMRNT----TAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
                   + + R+     TA+Y +PE+++ S     D + DIWA G  L+++     PF
Sbjct: 401 NNSKTATFDLLTRSKSFVGTAEYVTPELLNDSY---TDYRCDIWAFGCILFQMIAGKPPF 457

Query: 247 EKSGE----AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQPNHRPNI 289
           + + E      ++  +Y F A FP     +R L+ K+L  QP+ R  I
Sbjct: 458 KATNEYLTFQKVMKVQYAFTAGFPVV---IRDLVKKILLKQPSQRLTI 502

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 91/197 (46%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L + L S   +R+   E   +   +S  V   H++    VHRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL KN   KL DFG      R       L  V        T  Y +PE+I+     GF
Sbjct: 162 NILLDKNGNAKLTDFGFT----RECMTKTTLETVCG------TTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYS-----DRLRHLIS 276
            I    DIW+LGV LY +   + PF+   E  + T        P Y      D  + LIS
Sbjct: 212 KI----DIWSLGVILYTLITGSLPFDDDDE--VKTKWKIVNEEPNYDSTLIPDDAKDLIS 265

Query: 277 KLLAVQPNHRPNIYDVV 293
           +LLA  P  RP++  V+
Sbjct: 266 RLLAKNPKERPSLPQVL 282

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 90/199 (45%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L  + +     R+   E   +   +S  V   H++    VHRD+K+E
Sbjct: 106 KVWMALEYCPGKEL--YDHLLSLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL KN   KL DFG      R       L  V        T  Y +PE+I+     GF
Sbjct: 162 NILLDKNGNAKLTDFGFT----RECMTKTTLETVCG------TTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS------RYEFPAFPAYSDRLRHLI 275
            I    DIW+LGV LY +     PF+   EA           +Y+    P   D  R LI
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIP---DDARDLI 264

Query: 276 SKLLAVQPNHRPNIYDVVK 294
           S+LLA  P  RP++  V++
Sbjct: 265 SRLLAKNPGERPSLSQVLR 283

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 132/285 (46%), Gaps = 43/285 (15%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G F  +Y+      +  SG  +A     +      +N+L  E+  +  L++   + +YI 
Sbjct: 26  GNFGDVYKAC----EKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKSPY-ITNYIT 80

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +     S       ++++MEYC  G   + L +     L ES+   I   V +G+  +H 
Sbjct: 81  TMTEDVS-------MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TA 207
            +   +HRDIK  N+LL+   + KL DFG VSG IR              + R T   T 
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRAT------------LKRGTFVGTP 178

Query: 208 QYRSPEMIDM-SRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAF 264
            + +PE++   S G+  DEK+DIW+LG+ +Y++   + P  K     ++ +  + + P  
Sbjct: 179 FWMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVL 236

Query: 265 PA-YSDRLRHLISKLLAVQPNHRPNIYDVVK-------ELSDMKN 301
              YS   +H ++  L   P +RP+  +++        ++SD+K+
Sbjct: 237 HGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQISDLKS 281

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 118/266 (44%), Gaps = 51/266 (19%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +  E+  MKLL N+  V+   D     SS       +++++EY E G L N L  R    
Sbjct: 84  IEREIIIMKLL-NHPNVLRLYDVWETNSS-------LYMVLEYVEKGELFNLLVDR--GP 133

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E+E V     +  G++  HAL   +VHRD+K EN+LL      K+ DFG         
Sbjct: 134 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA------- 184

Query: 189 SNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICYYTT 244
                 AL   D +  T+     Y +PE++    G P    +SD+W+ G+ L+ +     
Sbjct: 185 ------ALESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRL 235

Query: 245 PFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKE- 295
           PF++  E G        + + ++E P     S   + LI+K+L V P  R     ++K  
Sbjct: 236 PFDE--EDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHP 293

Query: 296 -------LSDMKNI-SCPIINFYLKP 313
                  + D K+I + P  + YL P
Sbjct: 294 LLQKYPSIKDSKSIRNLPREDTYLNP 319

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 108/231 (46%), Gaps = 31/231 (13%)

Query: 28  LTAGGFAQI----YQTTISPIDPFSGTNIACLKRVIVPDKPSLNV-LRAEVDAMKLLRNN 82
           L  G F ++     +T+ S +D      I  ++R  +P      V +  E++A+K L + 
Sbjct: 46  LGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVKIYREINALKHLNHP 105

Query: 83  RCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVS 142
             V         +   QN  Y + +++EY   G    ++  +   RLKES    +   + 
Sbjct: 106 NIV-------RLEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLI 155

Query: 143 QGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIM 202
            GV  MH+    LVHRD+K+EN+LL KN    + DFG V+          E  L +N++M
Sbjct: 156 SGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVN----------EF-LPENELM 202

Query: 203 RNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE 251
           + +     Y +PE++  +R +    K+DIW+ GV +Y +     P++   E
Sbjct: 203 KTSCGSPCYAAPELVVTARPYEA-RKADIWSCGVIMYAMLAGYLPWDDDPE 252

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 108/238 (45%), Gaps = 42/238 (17%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +  E+  MKLL N+  V+   D     S       +++L++EY E G L N L  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWETNS-------DLYLVLEYAEKGELFNMLVER--GP 125

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E+E V     +  G++  H+L   +VHRD+K EN+LL      K+ DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMA------- 176

Query: 189 SNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKICYYTT 244
                 AL   D +  T+     Y +PE+I    G P +   SD+W+ GV L+ +     
Sbjct: 177 ------ALESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 245 PFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           PF++  E G        +    +E P     +   + L+++LL V P+ R  I +++K
Sbjct: 228 PFDE--EDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 112/222 (50%), Gaps = 38/222 (17%)

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQG 144
           ++S+ +  A    ++N + E++L++EY + G L ++L SR   +L E E ++    + +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLVHRDIKIENVLLS-KNNEFKLCDFGSVSGPIRPPSNPQELALVQ--NDI 201
           V+  H+    + HRD+K EN+LL  KN + K+ DFG              +A ++  N +
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG--------------MAALELPNKL 270

Query: 202 MRNTTA--QYRSPEMIDMSR---GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL- 255
           ++ +     Y SPE++ M R   G P    SD+W+ G+ L+ +     PF       +L 
Sbjct: 271 LKTSCGSPHYASPEIV-MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
              + +Y+ P     S   R+LISK+L + P  R    ++++
Sbjct: 326 KVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILE 365

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 93/195 (47%), Gaps = 23/195 (11%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++  EYC    L + + S LQ R+  S  + +   +   V   H+L    VHRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHVLS-LQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMI--DMSRGF 221
           N+LL KN   KL DFG      R       L  +        T  Y +PE+I  +   GF
Sbjct: 159 NILLDKNGNAKLTDFGFT----RECMTKTSLETICG------TTVYMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGI-LTSRYEFPAF--PAYSDRLRHLISKL 278
            I    DIW+LGV LY +   + PF++  E         E P F     S+  + L+ KL
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LAVQPNHRPNIYDVV 293
           L+  PN RP++ +++
Sbjct: 265 LSKDPNERPSMQEIL 279

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 108/226 (47%), Gaps = 25/226 (11%)

Query: 75  AMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEV 134
           A++ L N+R ++    +   ++S       ++ L+EY  NG L++ +  +    L E   
Sbjct: 225 ALQRLNNSRSIIRLFFTFQDEAS-------LYFLLEYAPNGDLLSLM--KKFGSLNEECC 275

Query: 135 VNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS-GPIRPPSNPQE 193
                 +   +  MH+    ++HRDIK EN+LL K+ + K+ DFG+      +PP    +
Sbjct: 276 CYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYD 333

Query: 194 LALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE-- 251
           L       +   TA+Y SPE+++ +     D +SDIWA G  ++++     PF+ + E  
Sbjct: 334 LLTRSKSFV--GTAEYVSPELLNDNY---TDARSDIWAFGCIVFQMIAGKPPFKATNEYL 388

Query: 252 --AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
               ++  +Y F A FP     +R L+ ++L   P  R  I  + K
Sbjct: 389 TFQKVMKVQYAFTAGFPTV---VRDLVKRILIKAPEQRLTIEAIEK 431

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 96/195 (49%), Gaps = 23/195 (11%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E+FL++EY + G L ++L SR   +L E E V+    + +GV+  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLLSKN-NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFP 222
           N+LL K  N  K+ DFG  +  +     P +L      +    +  Y SPE++ M + + 
Sbjct: 249 NLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIV-MGKSYH 297

Query: 223 IDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLISKL 278
               SD+W+ G+ L+ +     PF       +L    + +++ P     S     LIS++
Sbjct: 298 -GSPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQ--NISLEAEDLISRI 354

Query: 279 LAVQPNHRPNIYDVV 293
           L V P  R  I D++
Sbjct: 355 LVVDPEKRIQINDIL 369

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 20/209 (9%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           +FQ+    ++ L+EY  +G  +  +  +    L E+        +   V ++H +   ++
Sbjct: 192 TFQDEA-SLYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--II 246

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQE----LALVQNDIMRNTTAQYRSP 212
           HRDIK EN+LL KN + KL DFG+       PSN  +      L         TA+Y SP
Sbjct: 247 HRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSP 306

Query: 213 EMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAY 267
           E+++ +     D + DIWA G  LY++     PF+ + E      ++  +Y F A FP  
Sbjct: 307 ELLNDNY---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI 363

Query: 268 SDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
              ++ L+ KLL   PN R  I  +   L
Sbjct: 364 ---VKDLVKKLLVRDPNDRLTIKQIKAHL 389

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 110/222 (49%), Gaps = 38/222 (17%)

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQG 144
           ++S+ +  A    ++N + E++L++EY + G L ++L S+   +L E E ++    + +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLVHRDIKIENVLLSKNN-EFKLCDFGSVSGPIRPPSNPQELALVQ--NDI 201
           V+  H+    + HRD+K EN+LL K N   K+ DFG              +A ++  N +
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG--------------MAALELPNKL 270

Query: 202 MRNTTA--QYRSPEMIDMSR---GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL- 255
           ++ +     Y SPE++ M R   G P    SD+W+ G+ L+ +     PF       +L 
Sbjct: 271 LKTSCGSPHYASPEIV-MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
              + +Y+ P     S   R LISK+L + P  R    +++K
Sbjct: 326 KVQSGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILK 365

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 96/197 (48%), Gaps = 20/197 (10%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHAL-QPPLVHRDIKIE 163
           ++ L+EY  NG  ++ +      R          +  +Q + A+H L +  ++HRD+K E
Sbjct: 276 LYFLLEYAPNGDFLSVMK-----RFGTLSEECTKYYGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSN-PQELALVQNDIMRNTTAQYRSPEMIDMSRGFP 222
           N+LL K  + KL DFG+     R   N P +L       +   TA+Y SPE+++ +    
Sbjct: 331 NILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY--- 385

Query: 223 IDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRLRHLISK 277
           +D + DIWA G  L+++     PF+ + E      ++  +Y F A FP     LR LI +
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQ 442

Query: 278 LLAVQPNHRPNIYDVVK 294
           LL  +P  R  I  + K
Sbjct: 443 LLVKKPEQRLTILQIEK 459

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 102/226 (45%), Gaps = 45/226 (19%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           +++++EY E G L N L  +    L E+E V     +  G++  HAL   +VHRD+K EN
Sbjct: 118 LYMVLEYAEKGELFNLLVEK--GPLAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPEN 173

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGF 221
           +LL   +  K+ DFG               AL   D +  T+     Y +PE++    G 
Sbjct: 174 ILLDHKSNIKIADFGMA-------------ALETEDKLLETSCGSPHYAAPEIVS---GL 217

Query: 222 PIDE-KSDIWALGVFLYKICYYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLR 272
           P +  ++DIW+ GV L+ +     PF++  E G        +    +E P     S   +
Sbjct: 218 PYNGLETDIWSCGVILFALLTGRLPFDE--EDGNIRNLLLKVQKGEFEMPGSDELSLEAQ 275

Query: 273 HLISKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFYLKPNMTDA 318
            LI K+L V P  R    +++K          P++  Y  PN+ D+
Sbjct: 276 DLIGKILTVNPKQRIKTREILKH---------PLLQKY--PNIKDS 310

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 90/197 (45%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L   L   + +R+   E   +   +   V   H+L    VHRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL KN   KL DFG     +   S    L  +        T  Y +PE+I      GF
Sbjct: 158 NILLDKNGNAKLTDFGFTRECVSKSS----LETICG------TTVYMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRL-----RHLIS 276
            I    DIW+LGV LY +   T PF++  E    T       FP ++D       + LI 
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETK--TKWKIVNDFPNFNDNFVSHEAKDLIK 261

Query: 277 KLLAVQPNHRPNIYDVV 293
           +LLA  P+ RP +  ++
Sbjct: 262 RLLAKCPSERPTMEQIL 278

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 94/198 (47%), Gaps = 27/198 (13%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L + + S   +R+   E V +   +  GV   H+L    VHRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL K+ + KL DFG      R       L  +        T  Y +PE+I+     GF
Sbjct: 159 NILLDKSGDAKLTDFGFT----RECMTKTTLETICG------TTVYMAPELIERKSYDGF 208

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRL-----RHLIS 276
            I    DIW+LGV LY +   + PF++  E    T        P  ++ +     + LI 
Sbjct: 209 KI----DIWSLGVILYTMINGSMPFDEDDETK--TEWKIVHQTPQLNENIVTADAKDLIL 262

Query: 277 KLLAVQPNHRPNIYDVVK 294
           +LLA  PN RP +  ++K
Sbjct: 263 RLLAKNPNDRPTVEQILK 280

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 106/234 (45%), Gaps = 35/234 (14%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E++A+KLL +   V         +   QN  Y + +++E+   G    +L  +   RLKE
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYLQRK--RRLKE 152

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNP 191
                +   +  GV  MH+    LVHRD+K+EN+LL KN    + DFG V+         
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVNE-------- 202

Query: 192 QELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKS 249
                  N++M+ +     Y +PE++  +  +    K DIW+ G+ LY +     P++  
Sbjct: 203 ---FFGSNELMKRSCGSPCYAAPELVLSTEPYRA-RKVDIWSCGIILYAMLAGYLPWDDD 258

Query: 250 GE---AGILTSRYEFPA-----FPAYSDRL-RHLISKLLAVQPNHRPNIYDVVK 294
            +      +   Y++       FPAY   L R LI K+L   P+ R +I  + K
Sbjct: 259 SQNPNGDDIGKLYQYITKTALKFPAYISPLARDLIRKILTANPSRRISISYICK 312

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 33/193 (17%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L S+   +L ESE V+    +  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA--QYRSPEMIDMSR- 219
           N+LL K     K+ DFG  +              V N +++ +     Y SPE++ M + 
Sbjct: 265 NLLLDKKRRIIKIADFGMAA------------LQVSNRLLQTSCGSPHYASPEIV-MGKC 311

Query: 220 --GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRH 273
             G P    SDIW+ G+ L+ +     PF       +L      RY+ P++   S   ++
Sbjct: 312 YNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKN 365

Query: 274 LISKLLAVQPNHR 286
           LIS++L V P+ R
Sbjct: 366 LISRILVVDPSKR 378

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 98/203 (48%), Gaps = 17/203 (8%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           +FQ+    ++ L+EY  NG  ++ +  +    L +   V     +   +  +H  Q  ++
Sbjct: 230 TFQDEA-SLYFLLEYAPNGDFLSVI--KKYGSLNQDCSVYYSAQILDAIDYLH--QKGVI 284

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMID 216
           HRDIK EN+LL K+ + KL DFG+    +      Q   L++       TA+Y SPE+++
Sbjct: 285 HRDIKPENILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLN 343

Query: 217 MSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRL 271
            +    +D K DIWA G  L+++     PF+ + E      ++  +Y F A FP     +
Sbjct: 344 DNY---VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---I 397

Query: 272 RHLISKLLAVQPNHRPNIYDVVK 294
           R LI ++L   P  R +   V K
Sbjct: 398 RDLIKQILVKNPEQRLDTLQVKK 420

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 101/210 (48%), Gaps = 30/210 (14%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLN-----SRLQNRLKESEVVNIMWSVSQGVAAMHAL 151
           +FQ+    ++ L+EY  +G  +  +      + +  R   S++++        V ++H++
Sbjct: 192 TFQDEA-SLYFLLEYAPHGDFLGLIKKYGSLNEICARYYASQIID-------AVDSLHSI 243

Query: 152 QPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQE----LALVQNDIMRNTTA 207
              ++HRDIK EN+LL K+ + KL DFG+       PSN  +      L         TA
Sbjct: 244 --GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTA 301

Query: 208 QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA 263
           +Y SPE+++ S     D + DIWA G  LY++     PF+ + E      ++  +Y F A
Sbjct: 302 EYVSPELLNDSY---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA 358

Query: 264 -FPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
            FP     ++ L+ KLL   PN R  I  +
Sbjct: 359 GFPQI---VKDLVKKLLVRDPNDRLAIEQI 385

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 93/194 (47%), Gaps = 27/194 (13%)

Query: 105 VFLLMEYCENGGLINFLNSRL-QNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           V+LLMEY  NG L   L S    N +  S  V+ M   +  +  MH+    ++HRDIK E
Sbjct: 196 VYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQM---ADALNYMHS--KNILHRDIKPE 250

Query: 164 NVLLSKNNEFKLCDFG-SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFP 222
           N+LL   N  KL DFG SVS       N +   L         T  Y SPE+I  SR + 
Sbjct: 251 NILLGFQNTLKLTDFGWSVSN----VGNSKRKTLC-------GTMDYLSPELIK-SREY- 297

Query: 223 IDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRHLISKL 278
            D K D+WALGV  Y++   + PFE+  +      I+     FP     S   R LIS+L
Sbjct: 298 -DNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFP--DQVSPHARDLISRL 354

Query: 279 LAVQPNHRPNIYDV 292
           L   P +R  + DV
Sbjct: 355 LEYDPQNRIPLKDV 368

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 96/208 (46%), Gaps = 23/208 (11%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
           FQ+  + V+L+MEY  NG L   L +       +    N ++ ++  +  MH+    ++H
Sbjct: 242 FQDEIF-VYLIMEYLINGELYKSLKNN-NGPFNDILASNYIYQIADALKYMHSKH--IIH 297

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDM 217
           RDIK EN++L  NN+ KL DFG     I  P N +   +         T  Y +PE++  
Sbjct: 298 RDIKPENIVLGFNNKIKLADFG---WSICTPPNLRRKTIC-------GTIDYLAPELVTF 347

Query: 218 SRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRH 273
                 D   DIWALG+  Y++     PFE+  +      I+     FP     S   R 
Sbjct: 348 KE---YDYNVDIWALGILTYELIVGNPPFEEETKDLTYKRIINVDLNFPQ--TVSMDARD 402

Query: 274 LISKLLAVQPNHRPNIYDVVKELSDMKN 301
           LI++LL   P+ R  + DV+K     KN
Sbjct: 403 LITRLLRFDPSKRMPLVDVMKHPWITKN 430

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 109/226 (48%), Gaps = 27/226 (11%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E +A++ L N+R ++    +   ++S       ++ L+EY  NG  ++ +  +    L E
Sbjct: 218 EKNALQRLNNSRGIIRLYFTFQDEAS-------LYFLLEYAPNGDFLSIM--KKYGSLNE 268

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS---VSGPIRPP 188
                    +   +  +H  Q  ++HRDIK EN+LL K  + KL DFG+   + G  +  
Sbjct: 269 ECTCYYSAQIIDAIKFLH--QRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQAS 326

Query: 189 SNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEK 248
               +L       +   TA+Y SPE+++ +    +D + DIWA G  ++++     PF+ 
Sbjct: 327 GETYDLHTRSKSFV--GTAEYVSPELLNDNW---VDYRCDIWAFGCIVFQMIAGKPPFKA 381

Query: 249 SGE----AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQPNHRPNI 289
           + E      ++  +Y F A FP     +R L+ ++L  QP+ R +I
Sbjct: 382 TNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLRQPDQRLSI 424

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 122/285 (42%), Gaps = 58/285 (20%)

Query: 23  QIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV--PDKPSLNVLRA-----EVDA 75
           +I+K +  G F ++Y  +  P            ++V++   DK   NV+R      + D 
Sbjct: 38  KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKNDPNVVREVFYHRQFDY 87

Query: 76  MKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVV 135
           + + R    +V+                +V++ +EYC    L   L +    R+   E  
Sbjct: 88  LYITRLYEVIVTET--------------KVWMALEYCPGKELYEHLLA--LKRISLDECS 131

Query: 136 NIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELA 195
            +   +   +   H+L    VHRD+K+EN+LL K    KL DFG     +         +
Sbjct: 132 RLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV---------S 180

Query: 196 LVQNDIMRNTTAQYRSPEMIDMSR--GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAG 253
             Q D +  TT  Y +PE+ +     GF I    DIWALGV LY +   + PF++  EA 
Sbjct: 181 KSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDEDDEAK 235

Query: 254 ILTSRYEFPAFPAYSDRL-----RHLISKLLAVQPNHRPNIYDVV 293
             T        P  ++ L     + LI +LLA  PN RP+I  ++
Sbjct: 236 --TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 110/221 (49%), Gaps = 38/221 (17%)

Query: 85  VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQG 144
           ++S+ +  A    ++N + E++L++EY + G L ++L S+   +L E E ++    + +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VAAMHALQPPLVHRDIKIENVLLSKNN-EFKLCDFGSVSGPIRPPSNPQELALVQ--NDI 201
           V+  H+    + HRD+K EN+LL K N + K+ DFG              +A ++  N +
Sbjct: 227 VSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG--------------MAALELPNKL 270

Query: 202 MRNTTA--QYRSPEMIDMSR---GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL- 255
           ++ +     Y SPE++ M R   G P    SD+W+ G+ L+ +     PF       +L 
Sbjct: 271 LKTSCGSPHYASPEIV-MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLL 325

Query: 256 ---TSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
              + +Y+ P     S   R LISK+L + P  R    +++
Sbjct: 326 KVQSGKYQMPM--NLSAEARDLISKILVINPEKRITTQEIL 364

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 95/205 (46%), Gaps = 37/205 (18%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQ---- 152
           +FQ+    ++ L+EY  NG  ++              V+    S+SQ  A  ++ Q    
Sbjct: 225 TFQDEA-SLYFLLEYAPNGDFLS--------------VIKKFGSLSQECAVYYSAQILDA 269

Query: 153 ------PPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTT 206
                   +VHRDIK EN+LL K+ + KL DFG+    +      Q   L++       T
Sbjct: 270 IDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGT 328

Query: 207 AQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFP 262
           A+Y SPE+++ +    +D K DIWA G  L+++     PF+ + E      ++  +Y F 
Sbjct: 329 AEYVSPELLNDNY---VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFT 385

Query: 263 A-FPAYSDRLRHLISKLLAVQPNHR 286
           A FP     +R LI K+L   P  R
Sbjct: 386 AGFPLV---IRDLIKKILVKSPEQR 407

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 97/205 (47%), Gaps = 20/205 (9%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           +FQ+    ++ L+EY  +G  +  +  +    L E         +   V ++H +   ++
Sbjct: 191 TFQDEA-SLYFLLEYAPHGDFLALI--KKYGSLNEQCARYYASQIIDAVDSLHTI--GII 245

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQE----LALVQNDIMRNTTAQYRSP 212
           HRDIK EN+LL K+ + KL DFG+       PSN  +      L         TA+Y SP
Sbjct: 246 HRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSKSFVGTAEYVSP 305

Query: 213 EMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAY 267
           E+++ S     D + DIWA G  L+++     PF+ S E      ++  +Y F A FP  
Sbjct: 306 ELLNDSY---TDSRCDIWAFGCILFQMVAGKPPFKASNEYLTFQKVMKIQYAFTAGFPQI 362

Query: 268 SDRLRHLISKLLAVQPNHRPNIYDV 292
              ++ L+ KLL  +PN R  I  +
Sbjct: 363 ---IKDLVKKLLVKEPNDRLTIEQI 384

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 91/199 (45%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L + L S   +R+   E   +   +S  V   H++    VHRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL KN   KL DFG      R       L  V        T  Y +PE+I      GF
Sbjct: 162 NILLDKNGNAKLTDFGFT----RECMTKTTLETVCG------TTVYMAPELIGRKTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS------RYEFPAFPAYSDRLRHLI 275
            I    D W+LGV LY +   + PF+   EA           +Y+    P   D  + LI
Sbjct: 212 KI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIP---DDAKDLI 264

Query: 276 SKLLAVQPNHRPNIYDVVK 294
           S+LLA  P  RP++  V++
Sbjct: 265 SRLLAKNPGERPSLPQVLR 283

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 125/277 (45%), Gaps = 37/277 (13%)

Query: 26  KYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCV 85
           ++L  GGFA+ +Q        F+   +A   ++ +  + +   L +E+   K +++   +
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGV 145
           V ++D       F++    V++L+  C NG L+  L  R    L E EV      +   +
Sbjct: 202 VQFVDC------FEDHI-NVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT 205
             MH+ +  ++HRD+K+ N+   +N   K+ DFG               A++ ND  R  
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLA-------------AVLANDRERKY 297

Query: 206 TA----QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILT----S 257
           T      Y +PE++ + +      + DIW++GV ++ +     PF+      I +    S
Sbjct: 298 TVCGTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNS 356

Query: 258 RYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
            Y FP   + S   + LI  +L   P  RP+I ++++
Sbjct: 357 EYTFPINKSISQEAKTLIQDILINDPIARPSINEIME 393

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 98/206 (47%), Gaps = 28/206 (13%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++EY   G    ++  + + RLKE+    +   +  GV  MH+    LVH
Sbjct: 118 LQNSKY-IGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMHS--KGLVH 172

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+LL K+    + DFG V+             L  ND+M+ +     Y +PE++
Sbjct: 173 RDLKLENLLLDKHENLVITDFGFVNE-----------FLKDNDLMKTSCGSPCYAAPELV 221

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFE---KSGEAGILTSRYEFPA-----FPAY 267
             ++ +    K+DIW+ G+ LY +     P++   ++ E   +   Y F       FP Y
Sbjct: 222 ISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEY 280

Query: 268 SDRL-RHLISKLLAVQPNHRPNIYDV 292
              + R L+ +LL   P  R NI  +
Sbjct: 281 ISPIPRDLLRRLLVSDPRKRLNIRQI 306

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 90/201 (44%), Gaps = 23/201 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+L+MEY   G L   L S       +      ++ ++  +  +H  +  ++HRD+K EN
Sbjct: 227 VYLIMEYLVYGELYKLLRS--HGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPEN 282

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  NN  KL DFG     I  P   +   L         T  Y SPEMI   R    D
Sbjct: 283 ILIGFNNVLKLTDFG---WSIINPKGVKRKTLC-------GTIDYLSPEMI---RSREYD 329

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEA----GILTSRYEFPAFPAYSDRLRHLISKLLA 280
           +  D+WALGV  Y++     PFE+  +      IL     FP     S  +R LIS+LL 
Sbjct: 330 DTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFPG--TVSQDVRDLISRLLK 387

Query: 281 VQPNHRPNIYDVVKELSDMKN 301
             P  R  + +V+     M+N
Sbjct: 388 NDPKERILLKEVMVHPWIMRN 408

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 110/230 (47%), Gaps = 29/230 (12%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           ++FL++EY + G L ++L S+   +L E E V+    + +GVA  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--- 219
           N+LL K N+  K+ DFG  +  +  P+   E +          +  Y SPE++ M +   
Sbjct: 245 NLLLDKKNKIIKIADFGMAA--LELPNKLLETSC--------GSPHYASPEIV-MGKPYH 293

Query: 220 GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLI 275
           G P    SD+W+ G+ L+ +     PF       +L    + R+  P     S   + LI
Sbjct: 294 GGP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPR--NISLEAQDLI 347

Query: 276 SKLLAVQPNHRPNIYDVVKELSDMKNISCPIINFYLKPNMTDASNNIQHL 325
           +K+L V P  R  I D++K     K      + F   PN +  + N +H+
Sbjct: 348 AKILVVNPRQRIKISDILKHPLITKYRQFFKVKFNQVPNPSATNLNSEHM 397

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 94/193 (48%), Gaps = 33/193 (17%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L SR   +L E E V+    + QGV+  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA--QYRSPEMIDMSR- 219
           N+LL K N+  K+ DFG  +              V N +++ +     Y SPE++ M R 
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIV-MGRP 318

Query: 220 --GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRH 273
             G P    SD+W+ G+ L+ +     PF       +L    + ++  P     S   + 
Sbjct: 319 YHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ--NLSAEAKD 372

Query: 274 LISKLLAVQPNHR 286
           L+SK+L V P  R
Sbjct: 373 LMSKILVVNPFKR 385

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 120/257 (46%), Gaps = 40/257 (15%)

Query: 52  IACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           I  +KR  +   PS    +  E++A+K L +   V         +   QN  Y + +++E
Sbjct: 96  IKLIKRDFITKDPSKETKIYREINALKHLSHPNIV-------KLEEVLQNSKY-IGIVLE 147

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPP-LVHRDIKIENVLLSK 169
           Y   G    F+  +   RLKE+    +    SQ ++A+H +    LVHRD+K+EN+LL  
Sbjct: 148 YAAGGEFYKFIQRK--RRLKENHACRLF---SQLISAVHYIHSKGLVHRDLKLENLLLDN 202

Query: 170 NNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPID-EK 226
                + DFG V+  +R           QN +M+ +     Y +PE++  +R  P D  K
Sbjct: 203 EENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELVVSNR--PYDARK 249

Query: 227 SDIWALGVFLYKICYYTTPFE---KSGEAGILTSRYEFP-----AFPAYSDRL-RHLISK 277
           +D W+ G+ L+ +     P++   K+ +   ++  Y +       FP Y + + R L+ K
Sbjct: 250 ADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPEYINPVPRDLLRK 309

Query: 278 LLAVQPNHRPNIYDVVK 294
           +L + P  R NI  + K
Sbjct: 310 ILVIDPKKRINIRSIEK 326

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 99/198 (50%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L S+   +L E E V+    + QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--- 219
           N+LL K N+  K+ DFG  +  +  P+   E +          +  Y SPE++ M +   
Sbjct: 256 NLLLDKKNKVIKIADFGMAA--LELPNKLLETSC--------GSPHYASPEIV-MGKPYH 304

Query: 220 GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHLI 275
           G P    SD+W+ G+ L+ +     PF       +L      R++ P  P  ++  + LI
Sbjct: 305 GGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLI 358

Query: 276 SKLLAVQPNHRPNIYDVV 293
           +++L   P  R  I +++
Sbjct: 359 TRILVTNPEKRLTINEIL 376

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 145/325 (44%), Gaps = 47/325 (14%)

Query: 2   NQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVP 61
           ++ N++   + +  +V  H  Q+I     G +  +Y+      D      +  +K ++  
Sbjct: 8   DRVNLTPIQRASEKSVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYE 59

Query: 62  DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFL 121
           +   LN + AE+ ++    NN  +V Y         F   +YE+++L+EYC NG L   L
Sbjct: 60  NDEELNDIMAEI-SLLKNLNNNNIVKY-------HGFIRKSYELYILLEYCANGSL-RRL 110

Query: 122 NSRLQNRLKESE----VVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCD 177
            SR    L E+E    V   +W    G+  +H     ++HRDIK  N+LLS +N  KL D
Sbjct: 111 VSRSPTGLSENESKTYVTQTLW----GLKYLHG--EGVIHRDIKAANILLSADNTVKLAD 164

Query: 178 FGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLY 237
           FG     +    N   L L         T  + +PE++  +RG      SDIW+LG  + 
Sbjct: 165 FG-----VSTIVNSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVV 209

Query: 238 KICYYTTPFEKSGEAGILTSRYEFPAFP--AYSDRLRHLISKLLAVQPNHRPNIYDVVKE 295
           ++     P+    +A I  +      +P  A+S+ L+  +SK        RP    ++K 
Sbjct: 210 ELLTKNPPYHNLTDANIYYAVENDTYYPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKH 269

Query: 296 --LSDMKNISCPIINFYLKPNMTDA 318
             ++  +N+    +N + K + +DA
Sbjct: 270 AWITSTENVKVDKLNKF-KEDFSDA 293

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 100/228 (43%), Gaps = 31/228 (13%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
            R EV+    L +     SY   H  K         V+LLMEY  NG +   L  RL   
Sbjct: 149 FRREVEIQTSLNHPNLTKSYGYFHDEK--------RVYLLMEYLVNGEMYKLL--RLHGP 198

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
             +    + ++ ++  +  MH  +  ++HRDIK EN+L+  NN  KL DFG     I PP
Sbjct: 199 FNDILASDYIYQIANALDYMH--KKNIIHRDIKPENILIGFNNVIKLTDFG--WSIINPP 254

Query: 189 SNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEK 248
            N ++            T  Y SPEM++ SR +  D   D WALGV  +++     PFE+
Sbjct: 255 ENRRKTVC--------GTIDYLSPEMVE-SREY--DHTIDAWALGVLAFELLTGAPPFEE 303

Query: 249 SGE----AGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
             +      I     + P+    S   + LI KLL   P  R  + DV
Sbjct: 304 EMKDTTYKRIAALDIKMPS--NISQDAQDLILKLLKYDPKDRMRLGDV 349

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 95/202 (47%), Gaps = 29/202 (14%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
           F +    V+LLMEY  NG L   L +R      +    + ++ ++  +  MH  Q  ++H
Sbjct: 182 FFHDDKRVYLLMEYLVNGELYKVLKAR--GPFNDIVASHYVYQMADALDFMH--QKNIIH 237

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSPEM 214
           RD+K EN+L+   N  KL DFG                +    + R T   T  Y SPE+
Sbjct: 238 RDVKPENILMGFGNVVKLTDFGWS-------------IISARGVRRKTLCGTIDYLSPEL 284

Query: 215 IDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAG----ILTSRYEFPAFPAYSDR 270
           I  SR +  D+K D+WALGV  Y++   + PFE+  +      I++   +FP     S  
Sbjct: 285 I-TSREY--DDKVDVWALGVLTYELIVNSPPFEEDSKDSTYKRIVSGDLKFP--DTISSD 339

Query: 271 LRHLISKLLAVQPNHRPNIYDV 292
            + LI KLL  +   R ++ DV
Sbjct: 340 AQDLIRKLLRHKAKDRISLQDV 361

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 123/271 (45%), Gaps = 36/271 (13%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G F  +Y+      D   G  +A     +   +  +++L  E+  +  LR+   + +YI 
Sbjct: 24  GNFGDVYKAC----DKVEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAELRS-PFITNYIT 78

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +     S       ++++MEYC  G   + +     N + E +V  I   V +G+  +H 
Sbjct: 79  TLTEDVS-------MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH- 130

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TA 207
            +   +HRDIK  N+LL+     KL DFG VSG IR              + R T   T 
Sbjct: 131 -EQKKIHRDIKAANILLTDEGTVKLGDFG-VSGQIRAT------------LKRGTFVGTP 176

Query: 208 QYRSPEMIDMSR-GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAF 264
            + +PE++     G+  DEK+DIW+LG+ +Y++     P  K     ++ +  + + PA 
Sbjct: 177 YWMAPEVVSKENDGY--DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPAL 234

Query: 265 PA-YSDRLRHLISKLLAVQPNHRPNIYDVVK 294
              YS   ++ +S  L   P  R + Y++V+
Sbjct: 235 HGHYSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 105/206 (50%), Gaps = 25/206 (12%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + L     N L E +V  I+  V+ G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSPEMIDMS-RG 220
           +LL++    KL DFG VSG +R            + + R+T   T  + +PE++     G
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR------------STMKRDTFVGTPYWMAPEVVCCEVDG 188

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFP-AYSDRLRHLISK 277
           +  +EK+DIW+LG+  Y++     P  K     ++T+  + + P    ++SD  +  ++ 
Sbjct: 189 Y--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 278 LLAVQPNHRPNIYDVVKELSDMKNIS 303
            L   P  RP+ YD++     +KN++
Sbjct: 247 CLVKVPADRPSAYDLLS-FEFIKNVT 271

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 106/231 (45%), Gaps = 31/231 (13%)

Query: 28  LTAGGFAQI----YQTTISPIDPFSGTNIACLKRVIVPDKPSLNV-LRAEVDAMKLLRNN 82
           L  G F ++     +T+ S +D      I  ++R  +P      + +  E++A+K L + 
Sbjct: 46  LGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINALKHLNHP 105

Query: 83  RCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVS 142
             V         +   QN  Y + +++EY   G    ++  +   RLKE     +   + 
Sbjct: 106 NIV-------RLEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLI 155

Query: 143 QGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIM 202
            GV  MH+    LVHRD+K+EN+LL KN    + DFG V+             L +N++M
Sbjct: 156 SGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVNE-----------FLPENELM 202

Query: 203 RNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE 251
           + +     Y +PE++  +R +    K+D+W+ GV LY +     P++   E
Sbjct: 203 KTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPE 252

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 25/206 (12%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + L     N L E +V  I+  V+ G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSPEMIDMS-RG 220
           +LL++    KL DFG VSG IR            + + R+T   T  + +PE++     G
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR------------STLKRDTFVGTPYWMAPEVVCCEVDG 193

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFPA-YSDRLRHLISK 277
           +  +EK+DIW+LG+  Y++     P  K     ++T+  + + P     +SD  +  ++ 
Sbjct: 194 Y--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAG 251

Query: 278 LLAVQPNHRPNIYDVVKELSDMKNIS 303
            L   P  RP+ Y+++     +KNI+
Sbjct: 252 CLVKTPADRPSAYNLL-SFEFVKNIT 276

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 118/270 (43%), Gaps = 38/270 (14%)

Query: 52  IACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           I  ++R  VP      V +  E++A+K L +   V         +   QN  Y + +++E
Sbjct: 77  IKLIRRDTVPKNSDKEVKIYREINALKHLTHPNIV-------RLEEVLQNSKY-IGIVLE 128

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
           Y   G    ++  +   RLKE     +   +  GV  MH+    LVHRD+K+EN+LL KN
Sbjct: 129 YASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHS--KGLVHRDLKLENLLLDKN 184

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSD 228
               + DFG V+          E    +N++M+ +     Y +PE++  ++ +    K+D
Sbjct: 185 ENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPELVVTTKPYEA-RKAD 232

Query: 229 IWALGVFLYKICYYTTPFEKSG---EAGILTSRYEFPA-----FPAYSDRL-RHLISKLL 279
           IW+ GV +Y +     P++      E   +   Y +       FP Y + + R L+ ++L
Sbjct: 233 IWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRDLLRRIL 292

Query: 280 AVQPNHRPNIYDVVKELSDMKNISCPIINF 309
              P  R N+  V  E        CP +  
Sbjct: 293 VSNPKKRLNLRQV--EQHQWLQPHCPFLTI 320

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 103/206 (50%), Gaps = 25/206 (12%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + L     N L E +V  I+  V+ G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSPEMIDMS-RG 220
           +LL++    KL DFG VSG IR            +   R+T   T  + +PE++     G
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR------------STFKRDTFVGTPYWMAPEVVCCEVDG 193

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFPA-YSDRLRHLISK 277
           +  +EK+DIW+LG+  Y++     P  K     ++T+  + + P     +S+  +  ++ 
Sbjct: 194 Y--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSEAAKEFVAG 251

Query: 278 LLAVQPNHRPNIYDVVKELSDMKNIS 303
            L   P  RP+ YD++     +KNI+
Sbjct: 252 CLVKTPADRPSAYDLL-SFEFIKNIT 276

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/366 (20%), Positives = 149/366 (40%), Gaps = 82/366 (22%)

Query: 13  TTLTVGSHQVQIIKYLTAGGFAQIYQ---------------------TTISPIDPFSGTN 51
           + +T+ + + QI++ L+    +  YQ                     + ++ ID +    
Sbjct: 25  SLITINARKYQIVRLLSESELSLTYQVKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPT 84

Query: 52  IACLKRVIVP--DKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLM 109
              +++++ P  D  S++    E+D  +  ++   ++  +DS   +   ++G+  V +L+
Sbjct: 85  DMVVRQIMCPFGDIESVSNALKEIDNYRYFKSPY-IMQCLDSQVIQR--RDGSKTVLILL 141

Query: 110 EYCENGGLINFLNSRLQN--RLKESEVVNIMWSVSQGVAAMH------------------ 149
            Y   G L + ++  L +  R+ ESEV+ +M    +G+  +H                  
Sbjct: 142 PYLPLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGM 201

Query: 150 -ALQPPL----------------------------VHRDIKIENVLLSKNNEFKLCDFGS 180
            A+   L                             H +IK  N+L S +    + + GS
Sbjct: 202 DAVSMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGS 261

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240
           +        N + L  ++     + T  Y  PE++++  G  +D   DIW+LG  LY + 
Sbjct: 262 LQKLDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLL 321

Query: 241 YYTTPFEKSGEA-------GILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVV 293
           +  +PF++  +        GI  +RY FP    YS +L  +I   L V P  RP + +++
Sbjct: 322 FGISPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELL 381

Query: 294 KELSDM 299
            +L D+
Sbjct: 382 GQLQDI 387

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 18/193 (9%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + L     N L E +V  I+  V+ G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMS-RGFPI 223
           +LL++    KL DFG VSG IR        + ++ D     T  + +PE++     G+  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 224 DEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFP-AYSDRLRHLISKLLA 280
           +EK+DIW+LG+  Y++     P  K     ++T+  + + P    ++S+  +  ++  L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGCLV 249

Query: 281 VQPNHRPNIYDVV 293
             P  RP+ YD++
Sbjct: 250 KAPADRPSAYDLL 262

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMH-ALQPPLVHRDIKIE 163
           V++ +EYC    L  +L ++    L+E   +      SQ V A++ A     VHRD+K+E
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL-----FSQIVGAVYYAHSMKCVHRDLKLE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMS--RGF 221
           N+LL K    KL DFG      R  +    L  +        T  Y +PE+I+     G+
Sbjct: 158 NILLDKKGHAKLTDFGFT----RECATKGILETICG------TTVYMAPELIERKPYEGY 207

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAF-PAYSDRL-----RHLI 275
            I    D W+LG+ LY + + T PF++  E   + ++Y+   + P Y +       + LI
Sbjct: 208 KI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKELI 260

Query: 276 SKLLAVQPNHRPNIYDVVK 294
           S+LL   PN RP++  V++
Sbjct: 261 SQLLEKDPNQRPSLTQVLQ 279

>YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC
           family protein kinase and functional ortholog of
           mammalian S6 kinase; phosphorylated by Tor1p and
           required for TORC1-mediated regulation of ribosome
           biogenesis, translation initiation, and entry into G0
           phase; involved in transactivation of
           osmostress-responsive genes; regulates G1 progression,
           cAPK activity and nitrogen activation of the FGM
           pathway; integrates nutrient signals and stress signals
           from sphingolipids to regulate lifespan
          Length = 824

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 122/294 (41%), Gaps = 31/294 (10%)

Query: 8   TYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           TY Q      G    ++++ L  G F Q+YQ             +   K ++  ++ +  
Sbjct: 398 TYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHT 457

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
           +    +      +++  +V        K SFQ  T +++L+ +Y   G L  F + + + 
Sbjct: 458 IGERNILVTTASKSSPFIV------GLKFSFQTPT-DLYLVTDYMSGGEL--FWHLQKEG 508

Query: 128 RLKESEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
           R  E       + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++
Sbjct: 509 RFSEDRA---KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK 565

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
             +N               T +Y +PE++    G+   +  D W+LGV ++++C   +PF
Sbjct: 566 DRTN-----------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPF 612

Query: 247 ----EKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
                +     I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 613 FAENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHRLGAIDDGREL 665

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 101/213 (47%), Gaps = 31/213 (14%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           SF +    ++++MEY   G L   L S       +    N ++ ++  +  +H  Q  ++
Sbjct: 167 SFFHDEKRIYIVMEYLIQGELYKLLQS--HGPFNDVLASNYVYQIADALDYLH--QKHII 222

Query: 157 HRDIKIENVLLSKNNEFKLCDFG-SVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSP 212
           HRDIK EN+L+  NN  KL DFG S+  P                I R T   T  Y SP
Sbjct: 223 HRDIKPENILIGFNNTVKLTDFGWSIINP--------------KGIRRKTLCGTIDYLSP 268

Query: 213 EMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEA----GILTSRYEFPAFPAYS 268
           E+I  S+ +  D   DIWALGV  Y++   +  FE+  +      I+    +FP      
Sbjct: 269 EIIT-SKEY--DHTVDIWALGVLAYELVVGSPAFEEETKEMTYKRIVKGELKFPEH--LP 323

Query: 269 DRLRHLISKLLAVQPNHRPNIYDVVKELSDMKN 301
           + +R LI ++L ++P+ R ++ ++ +    +KN
Sbjct: 324 NIVRDLIQRILVIEPSKRMSLKEIKRHPWILKN 356

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 125/282 (44%), Gaps = 39/282 (13%)

Query: 28  LTAGGFAQI---YQTTISPIDPFSGTNIACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNR 83
           L  G F ++   +    SP +      I  ++R  +P      + +  E++A+K L +  
Sbjct: 50  LGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEIKIYREINALKHLSHPN 109

Query: 84  CVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQ 143
            V         +   QN  Y + +++EY   G    ++  +   RLKE+    +   +  
Sbjct: 110 IV-------KLEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEAVACRLFAQLIS 159

Query: 144 GVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMR 203
           GV  MH+    LVHRD+K+EN+LL K+    + DFG V+                +++M+
Sbjct: 160 GVQYMHSKG--LVHRDLKLENLLLDKHENLVITDFGFVNE-----------FFAHSELMK 206

Query: 204 NTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFE---KSGEAGILTSR 258
            +     Y +PE++  S+ +    K+DIW+ GV LY +     P++   K+ +   +   
Sbjct: 207 TSCGSPCYAAPELVVSSKPYEA-RKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKL 265

Query: 259 YEFPA-----FPAYSDRL-RHLISKLLAVQPNHRPNIYDVVK 294
           Y++       FP Y   L R L+ ++L   P  R ++  + K
Sbjct: 266 YQYITRTPLKFPEYITPLPRDLLRRILYPDPKRRISMRSIQK 307

>Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W
           (REAL)
          Length = 824

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 122/294 (41%), Gaps = 31/294 (10%)

Query: 8   TYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           TY Q      G    ++++ L  G F Q+YQ             +   K ++  ++ +  
Sbjct: 398 TYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHT 457

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
           +    +      +++  +V        K SFQ  T +++L+ +Y   G L  F + + + 
Sbjct: 458 IGERNILVTTASKSSPFIV------GLKFSFQTPT-DLYLVTDYMSGGEL--FWHLQKEG 508

Query: 128 RLKESEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
           R  E       + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++
Sbjct: 509 RFSEDRA---KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK 565

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
             +N               T +Y +PE++    G+   +  D W+LGV ++++C   +PF
Sbjct: 566 DRTN-----------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPF 612

Query: 247 ----EKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
                +     I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 613 FAENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHRLGAIDDGREL 665

>TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON}
           Anc_4.384 YHR205W
          Length = 969

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 121/286 (42%), Gaps = 35/286 (12%)

Query: 18  GSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMK 77
           G    ++++ L  G F Q+YQ             +   K+VIV      + L  E + + 
Sbjct: 550 GPEDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLS-KKVIVRKNEVAHTL-GERNILA 607

Query: 78  LLRNNRC--VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVV 135
               N C  +VS       K SFQ    +++L+ +Y   G L  F + + + R  E    
Sbjct: 608 HTATNSCPFIVSL------KFSFQT-PIDLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 657

Query: 136 NIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQEL 194
              + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++  +N    
Sbjct: 658 --KFYIAELVVALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTN---- 711

Query: 195 ALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF----EKSG 250
                      T +Y +PE++    G+   +  D W+LGV ++++C   +PF     +  
Sbjct: 712 -------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 762

Query: 251 EAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
              I   + +FP     S   R  +  LL   PNHR    D  +EL
Sbjct: 763 YQKIAFGKVKFPR-DILSAEGRSFVKGLLNRNPNHRLGSVDDGREL 807

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 93/188 (49%), Gaps = 18/188 (9%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + +    +  L E++   I   V +G+  +H  +   +HRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR-GFPI 223
           +LL+ +   KL DFG VSG I+        A ++ D     T  + +PE++     G+  
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIK--------ATLKKDTFVG-TPYWMAPEVVKKDESGY-- 191

Query: 224 DEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFPA-YSDRLRHLISKLLA 280
           +EK+DIW+LG+ +Y++     P  K     ++ S  +   P     YS+  +  IS  L 
Sbjct: 192 NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLI 251

Query: 281 VQPNHRPN 288
             PN RPN
Sbjct: 252 KDPNARPN 259

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 45/242 (18%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNR-LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +++++EY E G L N L   ++N  L E+E V     +  GV+  HAL   +VHRD+K E
Sbjct: 107 LYMVLEYAEKGELFNLL---VENGPLPENEAVCFFRQIIIGVSYCHALG--IVHRDLKPE 161

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRG 220
           N+LL  +   K+ DFG               AL   D +  T+     Y +PE++    G
Sbjct: 162 NLLLDHDLNIKIADFGMA-------------ALETEDKLLETSCGSPHYAAPEIVS---G 205

Query: 221 FPIDE-KSDIWALGVFLYKICYYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRL 271
            P     SDIW+ GV  + +     PF++  E G        + + ++E P     S   
Sbjct: 206 IPYHGFASDIWSCGVIFFALLTGRLPFDE--EDGNIRNLLLKVQSGKFEMPDDDEISPEA 263

Query: 272 RHLISKLLAVQPNHRPNIYDVVKE--------LSDMKNI-SCPIINFYLKPNMTDASNNI 322
           + L++K+L V P  R    +++K         +SD K+I + P  + YL P     S+ +
Sbjct: 264 QDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLSDSGSSEV 323

Query: 323 QH 324
             
Sbjct: 324 DQ 325

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 106/233 (45%), Gaps = 33/233 (14%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +R E+  +  L+    +  Y  S+   +       +++++MEYC  G L   L   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           ++E  +  IM  +   + ++H  +  ++HRDIK  N+L++ N   KLCDFG  +      
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAA------ 160

Query: 189 SNPQELALVQNDIMRNTTAQ---YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTP 245
                  L Q+ + R T A    + +PE+I    G   D K DIW+LG+  Y+I     P
Sbjct: 161 ------QLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPP 212

Query: 246 F--EKSGEAGILTSRYEFPAFPA--YSDRLRHLISKLLAVQPNHRPNIYDVVK 294
           +   ++  A  + ++ + P      YS  L+  I+  L   P  RP   ++ K
Sbjct: 213 YCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFK 265

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 97/208 (46%), Gaps = 32/208 (15%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++EY   G    ++  +   RLKE     +   +  GV  MH+    LVH
Sbjct: 107 LQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEPIACKLFAQLVSGVYYMHS--KGLVH 161

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+LL KN    + DFG V+             L  N++M+ +     Y +PE++
Sbjct: 162 RDLKLENLLLDKNENLIITDFGFVNE-----------FLQNNELMKTSCGSPCYAAPELV 210

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE-----------AGILTSRYEFPAF 264
             S  +    K+D+W+ G+ L+ +     P++   +             I TS  +FP++
Sbjct: 211 VTSNPYKA-RKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYITTSPLKFPSY 269

Query: 265 PAYSDRLRHLISKLLAVQPNHRPNIYDV 292
              S   R L+ K+L   PN R ++ ++
Sbjct: 270 --ISAIPRDLLRKILVANPNQRLSLREI 295

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 131/290 (45%), Gaps = 29/290 (10%)

Query: 9   YPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV 68
           + + T +  G    +    L  G ++Q++  T S  D      +  L +  +  +  +  
Sbjct: 105 FRRQTIIRKGIKDFKFGDMLGDGSYSQVFLAT-SKTDSSKTYAVKVLNKEYLIKQKKVKY 163

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           +  E  A++ L++   V++         +FQ+    ++ L+EY  NG  ++ +  +    
Sbjct: 164 VNIEKTALQNLKSVTGVINL------SFTFQDEA-NLYFLLEYAPNGDFLSLI--KKFGT 214

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           L E   +     +   + +MH+    ++HRDIK EN+LL  N + KL DFG  +  +   
Sbjct: 215 LNEECTIYYSAQIIDAIGSMHS--HGIIHRDIKPENILLDGNMKIKLTDFG--TAKLLQK 270

Query: 189 SNPQELALVQNDIMRNT----TAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTT 244
            + +      N + R++    TA+Y SPE+  +S  +  D K DIWA G  +Y++     
Sbjct: 271 KSDKNGKPHYNLLTRSSSFVGTAEYVSPEL--LSDNY-TDYKCDIWAFGCLVYQMIAGKP 327

Query: 245 PFEKSGE----AGILTSRYEFPA-FPAYSDRLRHLISKLLAVQPNHRPNI 289
           PF+ + E      ++  ++ F A FP     +R L+  +L  QP  R  I
Sbjct: 328 PFKATNEYLTFQKVMKVQFAFTAGFPTI---IRDLVKNILVKQPEKRLTI 374

>Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W
           (REAL)
          Length = 835

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 122/294 (41%), Gaps = 31/294 (10%)

Query: 8   TYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           TY Q      G    ++++ L  G F Q+YQ             +   K ++  ++ +  
Sbjct: 409 TYKQTKKRHYGPQDFEVLRLLGRGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHT 468

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
           +    +      +++  +V        K SFQ  T +++L+ +Y   G L  F + + + 
Sbjct: 469 IGERNILVTTASKSSPFIV------GLKFSFQTPT-DLYLVTDYMSGGEL--FWHLQKEG 519

Query: 128 RLKESEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
           R  E       + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++
Sbjct: 520 RFSEDRA---KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK 576

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
             +N               T +Y +PE++    G+   +  D W+LGV ++++C   +PF
Sbjct: 577 DRTN-----------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPF 623

Query: 247 ----EKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
                +     I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 624 FAENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHRLGAIDDGREL 676

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 23/202 (11%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
           F + +  V+L+MEY  NG L + L  +      +    N ++ ++  +  +H  +  ++H
Sbjct: 192 FFHDSKRVYLIMEYIYNGELYSIL--KKNGPFNDIVASNFVFQLTNAIRYLH--KKRIIH 247

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDM 217
           RD+K EN+L+  NN  K+ DFG     +   +  +   L         T  Y SPE+I+ 
Sbjct: 248 RDLKPENILIDFNNVIKITDFG---WSVYNEAGNKRKTLCG-------TIDYLSPELIN- 296

Query: 218 SRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRH 273
           S+ +  D   D+WALG+  Y++   T PFE+  +      I      FPA    S   ++
Sbjct: 297 SKEY--DGLIDVWALGIIAYELIVGTPPFEEDTKELTYKRIKNCDLNFPA--HVSQDAKN 352

Query: 274 LISKLLAVQPNHRPNIYDVVKE 295
           LIS LL + P+ R  + DV+K 
Sbjct: 353 LISSLLKLNPSERITLTDVLKH 374

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 124/278 (44%), Gaps = 37/278 (13%)

Query: 29  TAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNRCVVS 87
           +A G   +Y T   PI+      I  ++R  +   P   + +  E++A+K L +   V  
Sbjct: 92  SANGLG-LYATPALPIEVPKQVAIKLIRRDTISKDPRREIKIYREINALKQLTHPNIV-- 148

Query: 88  YIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAA 147
                      QN  Y + +++EY   G    ++  +   RLKE+    +   +  GV  
Sbjct: 149 -----KLDEVLQNSKY-IGIVLEYASGGEFYKYIQRK--KRLKETIACKLFAQLISGVNY 200

Query: 148 MHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA 207
           +H+    L+HRD+K+EN+LL KN    + DFG V+             +  N++M+ +  
Sbjct: 201 IHS--KGLIHRDLKLENILLDKNENLIITDFGFVNE-----------FVTSNELMKTSCG 247

Query: 208 Q--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE--AGILTSRYEFP- 262
              Y +PE++  S+ +    K DIW+ G+ L+ +     P++   E  +G   ++  F  
Sbjct: 248 SPCYAAPELVISSQPYEA-RKVDIWSCGIILFAMLAGYLPWDDDPENPSGENIAKLYFYI 306

Query: 263 -----AFPAYSDRL-RHLISKLLAVQPNHRPNIYDVVK 294
                 FP Y   + R L+ ++L   P  R ++  ++K
Sbjct: 307 TTTPLKFPEYITAIPRDLLRRILIADPKKRVDLRYILK 344

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 119/273 (43%), Gaps = 26/273 (9%)

Query: 31  GGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYID 90
           G ++ +   T   ID      +  L +  +  +  +  +  E  A++ L N+R ++    
Sbjct: 179 GAYSTVLLAT--SIDSGKKYAVKVLNKEYLIRQKKVKYVNIEKIALQRLNNSRSIIRLFF 236

Query: 91  SHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHA 150
           +   ++S       ++ L+EY  NG  ++ +  +    L E         +   +  MH 
Sbjct: 237 TFQDEAS-------LYFLLEYAPNGDFLSVM--KKYGSLNEECACYYGAQILDAIGFMHT 287

Query: 151 LQPPLVHRDIKIENVLLSKNNEFKLCDFGS--VSGPIRPPSNPQELALVQNDIMRNTTAQ 208
               ++HRDIK EN+L+ K+ + K+ DFG+  +       +N     L+        TA+
Sbjct: 288 RG--IIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSFVGTAE 345

Query: 209 YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA- 263
           Y SPE+++ +     D + DIWA G  LY++     PF+ + E      ++  +Y F A 
Sbjct: 346 YVSPELLNDNYS---DSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG 402

Query: 264 FPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
           FP     +R LI ++L   P  R  I  +   L
Sbjct: 403 FPTI---IRDLIKRILLKVPEQRLTIGQIKSHL 432

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 129/280 (46%), Gaps = 30/280 (10%)

Query: 19  SHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMKL 78
           S   ++ + +  G F  +Y+     ID  +G  +A     +      +++L  E+  +  
Sbjct: 31  SELYEVQECVGKGNFGDVYKA----IDKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAE 86

Query: 79  LRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIM 138
           L ++  + +Y  +     S       ++++MEYC  G   + L    +  L E +V  I 
Sbjct: 87  L-HSPYITNYFSTFVEDVS-------MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFIT 138

Query: 139 WSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQ 198
             + +G+  +H+ +   +HRDIK  N+LL+ + + KL DFG VSG        Q +A  +
Sbjct: 139 REILRGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSG--------QMMATRR 187

Query: 199 NDIMRNTTAQYRSPEMIDMS-RGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILT- 256
            D    T   + +PE+I  S +G+  +EK+DIW+LG+ ++++     P  +     +L  
Sbjct: 188 RDTFVGTPF-WMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVLMS 244

Query: 257 --SRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVK 294
             SR        YS  +R  +S  L   P  RP   +++K
Sbjct: 245 IPSRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 87/197 (44%), Gaps = 19/197 (9%)

Query: 98   FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            F++  Y    L  + E G +  F    L+  + E E   I   +  G+  +H     +VH
Sbjct: 870  FEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVH 927

Query: 158  RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDM 217
            RDIK ENV++  N   KL DFGS +      + P E+ +         T  Y +PE++  
Sbjct: 928  RDIKDENVIVDSNGFVKLIDFGSAA---YTKTGPFEVFV--------GTIDYAAPEIL-- 974

Query: 218  SRGFPIDEK-SDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLIS 276
              G P   K  DIWALGV LY + Y   PF    E  IL  +  F      +     LI 
Sbjct: 975  -GGNPYKGKPQDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIR 1031

Query: 277  KLLAVQPNHRPNIYDVV 293
             +L    N RP+I ++V
Sbjct: 1032 WILTKSVNDRPSIDEIV 1048

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 96/192 (50%), Gaps = 24/192 (12%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           ++++MEYC  G   + +       + ES+V  I+    +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT---TAQYRSPEMID-MSRG 220
           +LL+   + KL DFG VSG IR              + R T   T  + +PE+I+   +G
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRAT------------MKRGTFVGTPYWMAPEVINKQCKG 190

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS--RYEFPAFPA-YSDRLRHLISK 277
           +  +EK+DIW+LG+  Y++     P  K     ++ +  + + P     YS++ ++ +S 
Sbjct: 191 Y--NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSL 248

Query: 278 LLAVQPNHRPNI 289
            L   P  RP+I
Sbjct: 249 CLIKDPKQRPSI 260

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 115/253 (45%), Gaps = 37/253 (14%)

Query: 52  IACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           I  ++R  VP      + +  E++A+KLL +   V         +   QN  Y + ++++
Sbjct: 77  IKLIRRDTVPKNSEKEIKIYRELNALKLLSHPNIV-------RLEEVLQNSKY-IGIVLQ 128

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
           Y   G    ++  +   RLKE     +   +  GV  +H     L HRD+K+EN+LL ++
Sbjct: 129 YASGGEFYKYIQKK--RRLKEPPACRLFAQLISGVHYIHYKG--LAHRDLKLENLLLDEH 184

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSD 228
               + DFG V+               +ND+MR +     Y +PE++  S+ +   +K+D
Sbjct: 185 ENLIITDFGFVN------------EFHKNDLMRTSCGSPCYAAPELVVSSKPYSA-QKAD 231

Query: 229 IWALGVFLYKICYYTTPFE---KSGEAGILTSRYEFPA-----FPAYSDRL-RHLISKLL 279
           +W+ GV LY +     P++   ++ E   +   Y++       FP Y   + R L+ ++L
Sbjct: 232 VWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSLKFPEYIKPIPRDLLKRIL 291

Query: 280 AVQPNHRPNIYDV 292
              P  R  + D+
Sbjct: 292 VSNPEVRLTVADI 304

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 133/279 (47%), Gaps = 32/279 (11%)

Query: 21  QVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPS-LNVLRAEVDAMKLL 79
           Q +I++ +  G F  +Y+         +   I  +K V + D    +++L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMW 139
           R+      YI ++  K++F      ++++MEYC  G     L    ++++ E +   I+ 
Sbjct: 74  RS-----PYITNY--KTAFLVDV-SMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 SVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQN 199
            V  G+  +H+ +   +HRDIK  N+LL+ N   KL DFG VSG        Q +   + 
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRKR 174

Query: 200 DIMRNTTAQYRSPEMIDMSR-GFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS- 257
           D    T   + +PE+ID ++ G+  +E +DIW+LG+ + ++     P +K      L + 
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKQGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAI 231

Query: 258 -RYEFPAFPA-YSDRLRHLISKLLAVQPNHRPNIYDVVK 294
            + + P     +S   R  +++ L   P+ RP   +++K
Sbjct: 232 PKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 123/272 (45%), Gaps = 43/272 (15%)

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +  +K++ +  +P   ++  E+  MK  R+N  VV++I++H +K +       ++++MEY
Sbjct: 542 LVAIKQMDLEKQPKKELILNEIIVMKESRHNN-VVNFINAHLSKGN-------LWIVMEY 593

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNN 171
            E G L + +   L   L E ++  +     +G+  +H+    ++HRDIK +NVLLS   
Sbjct: 594 MEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKG 648

Query: 172 EFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ-----YRSPEMIDMSRGFPIDEK 226
           + KL DFG                   NDI  N T       + +PE++      P   K
Sbjct: 649 DIKLTDFG--------------FCAQINDIDLNRTTMVGTPYWMAPEVVSRKEYGP---K 691

Query: 227 SDIWALGVFLYKICYYTTPF--EKSGEAGILTSRYEFPAFPA---YSDRLRHLISKLLAV 281
            DIW+LG+ + ++     P+  E   +A  L +    P        SD   + + + L V
Sbjct: 692 VDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPKLKEPENLSDVFSNFLDRCLRV 751

Query: 282 QPNHRPNIYDVVKELSDMKNISCPIINFYLKP 313
           +P  R +    ++ L+D   ++C      L P
Sbjct: 752 EPEERAS---AIELLADEFVVACAEPTISLAP 780

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 135/280 (48%), Gaps = 34/280 (12%)

Query: 21  QVQIIKYLTAGGFAQIYQTTISPIDPFSGTN-IACLKRVIVPDKPS-LNVLRAEVDAMKL 78
           Q +I++ +  G F  +Y+        +  TN I  +K V + D    +++L  E+  +  
Sbjct: 19  QYEILQCIGRGNFGDVYKAR------YLATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSE 72

Query: 79  LRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIM 138
           LR+      YI ++  K++F      ++++MEYC  G     L    +++L E +   I+
Sbjct: 73  LRS-----PYITNY--KTAFLVDV-SMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIV 124

Query: 139 WSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQ 198
             V  G+  +H+ +   +HRDIK  N+LL+ N   KL DFG VSG        Q +   +
Sbjct: 125 SEVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRK 173

Query: 199 NDIMRNTTAQYRSPEMIDMS-RGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS 257
            D    T   + +PE+ID + +G+  +E +DIW+LG+ + ++     P +K      L +
Sbjct: 174 RDTFVGTPF-WMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMA 230

Query: 258 --RYEFPAFPA-YSDRLRHLISKLLAVQPNHRPNIYDVVK 294
             + + P     +S   +  +++ L   P+ RP   +++K
Sbjct: 231 IPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 124/266 (46%), Gaps = 35/266 (13%)

Query: 54  CLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCE 113
            +K++ +  +P   ++  E+  MK  ++   +V++IDS+  K        +++++MEY E
Sbjct: 677 AIKQMNLEKQPKKELIINEIIVMKESKHEN-IVNFIDSYLLKG-------DLWVIMEYME 728

Query: 114 NGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEF 173
            G L + +   L   L E++V  +      G+  +H+    ++HRDIK +N+LLS   + 
Sbjct: 729 GGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS--KGVIHRDIKSDNILLSMRGDI 783

Query: 174 KLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALG 233
           KL DFG         +   EL L +  ++   T  + +PE++      P   K DIW+LG
Sbjct: 784 KLTDFGFC-------AQINELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLG 831

Query: 234 VFLYKICYYTTPF--EKSGEAGILTSRYEFPAF---PAYSDRLRHLISKLLAVQPNHRPN 288
           + + ++     P+  E    A  L +    P+     A SD L + +   L V P+ R +
Sbjct: 832 IMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPEALSDALNNFLGWCLKVNPDERAS 891

Query: 289 IYDV-----VKELSDMKNISCPIINF 309
             D+     + E++D      P++  
Sbjct: 892 AKDLLLDPFITEIADSNESLAPLVKL 917

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 90/186 (48%), Gaps = 23/186 (12%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY   G L  FL +     L E+     ++ ++  +  MH+    ++HRDIK EN
Sbjct: 173 VYLLMEYVYYGELYKFLKN--NGPLNETLASYFVYQMANALDYMHS--KNILHRDIKPEN 228

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  NN  KL DFG     +      +   L         T  Y SPE+I  SR +  +
Sbjct: 229 ILIGFNNTIKLTDFG---WSVYNEDGQKRKTLC-------GTIDYLSPELIK-SREY--N 275

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEA----GILTSRYEFPAFPAYSDRLRHLISKLLA 280
            K D+WALGV  Y++   + PFE+  +      IL    +FP     S + R LI +LL 
Sbjct: 276 NKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCDLKFPL--NVSPQARDLIVRLLQ 333

Query: 281 VQPNHR 286
            +P+ R
Sbjct: 334 FEPSKR 339

>TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}
           Anc_4.384 YHR205W
          Length = 754

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 123/286 (43%), Gaps = 35/286 (12%)

Query: 18  GSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMK 77
           G    ++++ L  G F Q+YQ  +   D      +  L + ++  K  +     E + + 
Sbjct: 342 GPSDFEVLRLLGKGTFGQVYQ--VKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 399

Query: 78  LLRNNRC--VVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVV 135
              +  C  +VS       K SFQ  T +++L+ +Y   G L  F + + + R  E    
Sbjct: 400 HSASKTCPFIVSL------KFSFQTPT-DLYLVTDYMSGGEL--FWHLQKEGRFTEDRA- 449

Query: 136 NIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQEL 194
              + ++Q V A+  L    +V+RD+K EN+LL  N    LCDFG     ++  +N    
Sbjct: 450 --KFYIAQLVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTN---- 503

Query: 195 ALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF----EKSG 250
                      T +Y +PE++    G+   +  D W+LGV ++++C   +PF     +  
Sbjct: 504 -------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 554

Query: 251 EAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
              I   + +FP     S   R  +  LL   PNHR    D  +EL
Sbjct: 555 YQKIAFGKVKFPR-DILSPEGRSFVKGLLNRNPNHRLGSIDDGREL 599

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 105/228 (46%), Gaps = 24/228 (10%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E  A++ L N+  VV         S+FQ+ +  ++ L+EY  NG  ++ +  +    L E
Sbjct: 229 EKTALQKLNNSHSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKNGSLDE 279

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS--GPIRPPS 189
           +        +   +  +H+    ++HRDIK EN+LL +    KL DFG+          +
Sbjct: 280 NCACYYGAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSST 337

Query: 190 NPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKS 249
           + Q+  L         TA+Y SPE+++ S     D + DIWA G  L+++     PF+ +
Sbjct: 338 SKQKYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPFKAT 394

Query: 250 GE----AGILTSRYEF-PAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
            E      ++  +Y F P FP     +R L+ K+L    + R  I  +
Sbjct: 395 NEYLTFQKVMKVQYAFTPGFPLI---IRDLVKKILIKNLDQRLTISQI 439

>Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205W
           (REAL)
          Length = 815

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 121/294 (41%), Gaps = 31/294 (10%)

Query: 8   TYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLN 67
           TY Q      G    ++++ L  G F Q+YQ             +   K ++  ++ +  
Sbjct: 389 TYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHT 448

Query: 68  VLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQN 127
           +    +      +++  +V        K SFQ    +++L+ +Y   G L  F + + + 
Sbjct: 449 IGERNILVTTASKSSPFIV------GLKFSFQTPA-DLYLVTDYMSGGEL--FWHLQKEG 499

Query: 128 RLKESEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIR 186
           R  E       + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++
Sbjct: 500 RFSEDRA---KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK 556

Query: 187 PPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
             +N               T +Y +PE++    G+   +  D W+LGV ++++C   +PF
Sbjct: 557 DRTN-----------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPF 603

Query: 247 ----EKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
                +     I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 604 FAENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHRLGAIDDGREL 656

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 96/192 (50%), Gaps = 31/192 (16%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           E++L++EY + G L ++L S+   +L E E V+    + QGV+  H+    + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 164 NVLLSKNNE-FKLCDFGSVSGPIRPPSNPQELALVQ--NDIMRNTTA--QYRSPEMIDMS 218
           N+LL K N+  K+ DFG              +A ++  N +++ +     Y SPE++ M 
Sbjct: 266 NLLLDKKNKSIKIADFG--------------MAALELPNKLLQTSCGSPHYASPEIV-MG 310

Query: 219 RGFPIDEKSDIWALGVFLYKICYYTTPFEKSGEAGIL----TSRYEFPAFPAYSDRLRHL 274
           + +     SD+W+ G+ L+ +     PF       +L      ++  P+    S   + L
Sbjct: 311 KSYH-GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQDL 367

Query: 275 ISKLLAVQPNHR 286
           IS++L + P+ R
Sbjct: 368 ISRILVIDPSKR 379

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 91/195 (46%), Gaps = 23/195 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V++ +EYC    L ++L   L+ R+   E   +   +   V   H+LQ   VHRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMI--DMSRGFP 222
           +LL KN    L DFG      R  +   +L  V        T  Y +PE+I  +   G+ 
Sbjct: 159 ILLDKNGYAMLTDFGFT----RECATKTQLETVCG------TTVYMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWALGVFLYKICYYTTPFEKSG--EAGILTSRYEFPAFPAYSD-RLRHLISKLL 279
           +    D W+LG+ LY + +   PF++      G+     E      Y+  + + LI +LL
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 AVQPNHRPNIYDVVK 294
                 RPN+ +V++
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 133/305 (43%), Gaps = 42/305 (13%)

Query: 6   ISTYPQGTTLTVGSHQVQIIKYLTAGGFAQI----YQTTISPIDPFSGTNIACLKRVIVP 61
           IS  P+   +T G + V     L  G F ++     +   S ++      I  ++R  +P
Sbjct: 25  ISAKPRKRHVTFGPYIVG--STLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIP 82

Query: 62  DKPSLNV-LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120
                 V +  E++A+K L +   V         +   QN  Y + +++EY   G    +
Sbjct: 83  KNSEKEVKIYREINALKHLSHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYKY 134

Query: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180
           +  +   RLKE+    +   +  GV  MH+    LVHRD+K+EN+LL K+    + DFG 
Sbjct: 135 IQRK--RRLKEAIACRLFAQLVSGVNYMHSKG--LVHRDLKLENLLLDKHENLVITDFGF 190

Query: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYK 238
           V+             +  N++M+ +     Y +PE++  ++ +    KSD+W+ GV LY 
Sbjct: 191 VNE-----------FVSHNELMKTSCGSPCYAAPELVVSTKPYEA-RKSDVWSCGVILYA 238

Query: 239 ICYYTTPFE---KSGEAGILTSRYEFPA-----FPAYSDRL-RHLISKLLAVQPNHRPNI 289
           +     P++   K+ +   +   Y +       FP Y   L R L+ ++L   P  R  +
Sbjct: 239 MLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFPEYITPLSRDLLRRILVSDPKKRITL 298

Query: 290 YDVVK 294
             + K
Sbjct: 299 RSIHK 303

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 94/198 (47%), Gaps = 26/198 (13%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +++++MEYC  G L   L      ++ E  +  IM  +   VA ++  +  ++HRDIK  
Sbjct: 97  KLWIIMEYCAGGSLRTLLRP---GKIDEKYIGVIMRELL--VALLYIHKDNVIHRDIKAA 151

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRG 220
           NVL++ +   KLCDFG  +             L Q+++ R T A    + +PE+I    G
Sbjct: 152 NVLITNDGRVKLCDFGVAA------------QLTQSNVRRQTMAGTPYWMAPEVI--MEG 197

Query: 221 FPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAGILTSRYEFPAFPA--YSDRLRHLIS 276
              D K DIW+LG+  Y+I     P+   ++  A  L ++ + P      YS  L+  I+
Sbjct: 198 VYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSPLLKEFIA 257

Query: 277 KLLAVQPNHRPNIYDVVK 294
             L   P  R    D++K
Sbjct: 258 LCLDEDPKERLAAEDLLK 275

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 114/253 (45%), Gaps = 37/253 (14%)

Query: 52  IACLKRVIVPDKPSLNV-LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLME 110
           I  ++R  +P      V +  E++A+K L +   V         +   QN  Y + ++++
Sbjct: 97  IKLVRRDTIPKHSEKEVKIYREINALKHLNHPNIV-------RLEEVLQNSKY-IGIVLQ 148

Query: 111 YCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKN 170
           Y   G    ++  +   RLKE     +   +  GV  MH     L HRD+K+EN+LL ++
Sbjct: 149 YASGGEFYKYIQKK--RRLKEPPACRLFAQLISGVYYMH--HKGLAHRDLKLENLLLDEH 204

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSD 228
               + DFG V+               +ND+M+ +     Y +PE++  +R +    K+D
Sbjct: 205 ENLMITDFGFVN------------EFHKNDLMKTSCGSPCYAAPELVVTARPYEA-RKAD 251

Query: 229 IWALGVFLYKICYYTTPFE---KSGEAGILTSRYEFPA-----FPAYSDRL-RHLISKLL 279
           +W+ GV LY +     P++   ++ E   +   Y +       FP Y   L R L+ ++L
Sbjct: 252 VWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSALKFPEYIKPLPRDLLRRIL 311

Query: 280 AVQPNHRPNIYDV 292
              P+ R ++ ++
Sbjct: 312 VSNPDTRLSVMEI 324

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 90/207 (43%), Gaps = 24/207 (11%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           SFQ   Y V+L MEYC  G     L +R    + E +       V+  +  +H L    +
Sbjct: 502 SFQTEDY-VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FI 558

Query: 157 HRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT----------- 205
           +RD+K EN+LL K+    L DF  +S      + P +    Q+ ++              
Sbjct: 559 YRDLKPENILLHKSGHIMLSDF-DLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSF 617

Query: 206 --TAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF--EKSGE--AGILTSRY 259
             T +Y +PE+I   RG       D W LG+ +Y++ +  TPF  E + E    IL +  
Sbjct: 618 VGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEV 674

Query: 260 EFPAFPAYSDRLRHLISKLLAVQPNHR 286
            FP     S   + LI KLL+   + R
Sbjct: 675 TFPEHHEISRHCKDLIRKLLSKNESKR 701

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 92/197 (46%), Gaps = 27/197 (13%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V++ +EYC    L  +L   ++ R+   E  ++   +   V   H+++   VHRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMS--RGFP 222
           +LL K  + KL DFG      R  +    L  V        T  Y +PE+I+     G+ 
Sbjct: 159 ILLDKKGQAKLTDFGFT----RECATKGILETVCG------TTVYMAPELIERKPYEGYK 208

Query: 223 IDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRL-----RHLISK 277
           I    D W+LG+ LY + +   PF++  E  I T        P Y D       + LI +
Sbjct: 209 I----DTWSLGIILYTMIHGAMPFDE--EDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQ 262

Query: 278 LLAVQPNHRPNIYDVVK 294
           LL   P+ RP++  V++
Sbjct: 263 LLQKDPSQRPSLTQVLQ 279

>KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON}
           Anc_4.384 YHR205W
          Length = 792

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 120/287 (41%), Gaps = 37/287 (12%)

Query: 18  GSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMK 77
           G    ++++ L  G F Q+YQ             +   K+VIV         + E+    
Sbjct: 380 GPEDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLS-KKVIVK--------KNEIAHTI 430

Query: 78  LLRNNRCVVSYIDSH---AAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEV 134
             RN   + +   SH     K SFQ  + +++L+ +Y   G L  F + + + R  E   
Sbjct: 431 GERNILVITATKSSHFMVGLKFSFQTPS-DLYLVTDYMSGGEL--FWHLQKEGRFSEDRA 487

Query: 135 VNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQE 193
               + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++  +N   
Sbjct: 488 ---KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTN--- 541

Query: 194 LALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF----EKS 249
                       T +Y +PE++    G+   +  D W+LGV ++++C   +PF     + 
Sbjct: 542 --------TFCGTTEYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQK 591

Query: 250 GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
               I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 592 MYQKIAFGKVKFPR-DVLSAEGRSFVKGLLNRNPKHRLGAIDDGREL 637

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 87/330 (26%), Positives = 139/330 (42%), Gaps = 56/330 (16%)

Query: 6   ISTYPQGTTLTVGS-HQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKP 64
           I  +  G TL +GS  +VQ+    +    A I   + S      G N + +     PD  
Sbjct: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSM-GNNSSMVSST--PDSL 72

Query: 65  SLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSR 124
           S  + R E+  MKLL N+  V+   D     ++        ++++EY E G L N L  +
Sbjct: 73  SYGIER-EIIIMKLL-NHPNVLRLYDVWETNNNL-------YMVLEYAEKGELFNLLVEK 123

Query: 125 LQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGP 184
               L E+E +     +  G++  HAL   +VHRD+K EN+LL      K+ DFG     
Sbjct: 124 --GPLPENEAIRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKLNIKIADFGMA--- 176

Query: 185 IRPPSNPQELALVQNDIMRNTTA---QYRSPEMIDMSRGFPIDE-KSDIWALGVFLYKIC 240
                     AL   D +  T+     Y +PE++    G P    ++D+W+ GV L+ + 
Sbjct: 177 ----------ALETEDKLLETSCGSPHYAAPEIVS---GLPYHGLETDVWSCGVILFALL 223

Query: 241 YYTTPFEKSGEAG--------ILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
               PF++  E G        +    +E P     S   + L+ K+L V P  R    ++
Sbjct: 224 TGRLPFDE--EDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREI 281

Query: 293 VKE--------LSDMKNI-SCPIINFYLKP 313
           +K         + D K I + P  + YL P
Sbjct: 282 LKHPLLQKYPSIKDSKTIRNLPREDTYLNP 311

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (45%), Gaps = 24/228 (10%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E  A++ L N+  VV         S+FQ+ +  ++ L+EY  NG  ++ +  +    L E
Sbjct: 227 EKTALQKLNNSPSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKYGSLDE 277

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS--GPIRPPS 189
           +        +   +  +H+    ++HRDIK EN+LL    + KL DFG+     P     
Sbjct: 278 TCARYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 190 NPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKS 249
           +  E  L         TA+Y SPE+++ S     D + DIWA G  L+++     PF+ +
Sbjct: 336 SKPEYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPFKAT 392

Query: 250 GE----AGILTSRYEF-PAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
            E      ++  +Y F P FP     +R L+ K+L    + R  I  +
Sbjct: 393 NEYLTFQKVMKVQYAFTPGFPLI---IRDLVKKILVKNLDRRLTISQI 437

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 97/203 (47%), Gaps = 28/203 (13%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++E+   G    ++  + + RLKES    +   +  GV  MH+    LVH
Sbjct: 119 LQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLISGVDYMHS--KGLVH 173

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+LL K+    + DFG V+                N++MR +     Y +PE++
Sbjct: 174 RDLKLENLLLDKHENLVITDFGFVNE-----------FFEDNELMRTSCGSPCYAAPELV 222

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE--AGILTSR-YEFPA-----FPAY 267
             ++ +    K+D+W+ GV LY +     P++   E   G   +R Y++       FP Y
Sbjct: 223 VSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEY 281

Query: 268 SDRL-RHLISKLLAVQPNHRPNI 289
              + R L+ ++L   P  R ++
Sbjct: 282 ITPVPRDLLRRILVPNPRRRVSV 304

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 106/233 (45%), Gaps = 35/233 (15%)

Query: 66  LNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRL 125
           L  L+ EVD    + +   +  Y   H  K         V+LLME+  NG L       L
Sbjct: 142 LKQLKREVDIQLGMDHPNIIKLYAHFHDEK--------RVYLLMEHSINGELY----KSL 189

Query: 126 QNRLKESEVV--NIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSG 183
           +N    ++V+  + ++ ++  +  MH  +  ++HRD+K ENVL+  +N  KL DFG    
Sbjct: 190 KNNGPFNDVLASHYIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG---W 244

Query: 184 PIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYT 243
            I  P   +   L         T  Y SPEMI   R +  DE+ D+WALGV  Y++    
Sbjct: 245 SILNPEGSKRKTLC-------GTIDYLSPEMI-TPREY--DEQVDVWALGVLAYELVVGV 294

Query: 244 TPFEKSGEA----GILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDV 292
            PFE++ +      IL     FP   + S   + LISKLL      R ++  V
Sbjct: 295 PPFEENSKELTYKRILKCDLNFPE--SISKDAKDLISKLLVTDTTQRLSLTGV 345

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 110/238 (46%), Gaps = 35/238 (14%)

Query: 69  LRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNR 128
           L  E++A+K+L +   V         +   QN  Y + +++EY   G    ++  + + R
Sbjct: 123 LYREINALKMLTHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYKYI--KFKKR 172

Query: 129 LKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPP 188
           LKES+   I   +  GV+ +H+    LVHRD+K+EN+LL K     + DFG V+   +  
Sbjct: 173 LKESKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTK-- 228

Query: 189 SNPQELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF 246
                     N +M        Y +PE++     +    K+DIW+ GV LY +     P+
Sbjct: 229 ---------TNKLMHTPCGSPCYAAPELVTSVEPYNA-RKADIWSCGVILYAMLAGYLPW 278

Query: 247 E---KSGEAGILTSRYEFPA-----FPAYSDRL-RHLISKLLAVQPNHRPNIYDVVKE 295
           +   K+     +   Y++       FP Y + + R L+ ++L + P  R ++  +++ 
Sbjct: 279 DDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 96/208 (46%), Gaps = 37/208 (17%)

Query: 105 VFLLMEYCENGGLINFLNSRLQ---NRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIK 161
           V+LLMEY  NG L   L  R+    N +  S  VN M   +  +  MH     ++HRDIK
Sbjct: 213 VYLLMEYLVNGELYRHL--RVNGPFNDILASYYVNQM---ADALNYMHDRN--VLHRDIK 265

Query: 162 IENVLLSKNNEFKLCDFG----SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDM 217
            EN+L+   N  KL DFG    S +G  R     + L           T  Y SPE++  
Sbjct: 266 PENILIGFQNTLKLTDFGWSVISTTGAKR-----KTLC---------GTLDYLSPELVKY 311

Query: 218 SRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRH 273
                 DEK D+WALGV  Y++   T PFE++ +      I+     FP     S   R 
Sbjct: 312 RE---YDEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMSIDARD 366

Query: 274 LISKLLAVQPNHRPNIYDVVKELSDMKN 301
           LI +LL   P+ R ++ DV+     +KN
Sbjct: 367 LIGRLLENDPSTRISLKDVLSHPWIVKN 394

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 101/222 (45%), Gaps = 24/222 (10%)

Query: 75  AMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEV 134
           A++ L N+  VV         S+FQ+ +  ++ L+EY  NG  ++ +  +    L E+  
Sbjct: 234 ALQKLNNSHSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKYGSLDENCA 284

Query: 135 VNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVS--GPIRPPSNPQ 192
                 +   +  +H     ++HRDIK EN+LL      KL DFG+     P    S+  
Sbjct: 285 CYYGSQIIDAIDHLHV--SGIIHRDIKPENILLDGEMRIKLTDFGTAKLLEPTNNSSSKS 342

Query: 193 ELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE- 251
           +  L         TA+Y SPE+++ S     D + DIWA G  L+++     PF+ + E 
Sbjct: 343 KYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPFKATNEY 399

Query: 252 ---AGILTSRYEF-PAFPAYSDRLRHLISKLLAVQPNHRPNI 289
                ++  +Y F P FP     +R L+ K+L    + R  I
Sbjct: 400 LTFQKVMKVQYAFTPGFPLI---IRDLVKKILIKNLDQRLTI 438

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 115/283 (40%), Gaps = 37/283 (13%)

Query: 16  TVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDA 75
           TVG    + I+ L  G   ++Y       D      I     +I   K  +  + AE + 
Sbjct: 476 TVGPQSFEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKK--IKRILAEQEI 533

Query: 76  MKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVV 135
           +    +   V  Y        SFQ   Y ++L MEYC  G     L +R    + E +  
Sbjct: 534 LATSNHPFIVTLY-------HSFQTEDY-LYLCMEYCMGGEFFRALQTRKTKCISEDDAR 585

Query: 136 NIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQ--- 192
                V+  +  +H +    ++RD+K EN+LL ++    L DF  +S   + P NPQ   
Sbjct: 586 FYASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDF-DLSVQAKGPRNPQVKG 642

Query: 193 --ELALVQNDIMRN--------TTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYY 242
             + +LV   I  +         T +Y +PE+I   RG       D W LG+  Y++ + 
Sbjct: 643 NAQSSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTASVDWWTLGILTYEMLFG 699

Query: 243 TTPFEKSGE------AGILTSRYEFPAFPAYSDRLRHLISKLL 279
            TPF+  GE      + IL     FP     S   + LI KLL
Sbjct: 700 FTPFK--GENTNQTFSNILKVEATFPNNNEISRTCKDLIKKLL 740

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 23/192 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY  NG L   L  R +  L +    + ++ ++  +  MH  Q  ++HRD+K EN
Sbjct: 182 VYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPEN 237

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  +N  KL DFG     I  P   +   +         T  Y SPE+I  S+ +  D
Sbjct: 238 ILIGFDNTVKLTDFG---WSIINPRGTKRKTMC-------GTLDYLSPELI-ASKEY--D 284

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPA---FPAY-SDRLRHLISKLLA 280
           +K D+WALGV  +++   + PFE+  +   LTS+        FP + S   + LI+KLL 
Sbjct: 285 DKVDVWALGVLTFELVVNSPPFEEDSKE--LTSKRIVRGDLKFPNHISSDAQDLITKLLR 342

Query: 281 VQPNHRPNIYDV 292
                R ++ +V
Sbjct: 343 HNSKDRISLREV 354

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 105/226 (46%), Gaps = 35/226 (15%)

Query: 72  EVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
           E++A+K L +   +V        +   QN  Y + +++EY   G    ++  +   RLKE
Sbjct: 110 EINALKHLTHPNIIV-------LEEILQNSKY-IGIVLEYASGGEFYKYIQRK--RRLKE 159

Query: 132 SEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNP 191
                +   +  GV  MH+    LVHRD+K+EN+LL KN    + DFG V+         
Sbjct: 160 VNASRLFSQLVSGVHYMHSKG--LVHRDLKLENLLLDKNENLMITDFGFVN--------- 208

Query: 192 QELALVQNDIMRNTTAQ--YRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPFE-- 247
            E +  +N +M+ +     Y +PE++ +SR   +  K DIW+ GV LY +     P++  
Sbjct: 209 -EFS-NENVLMKTSCGSPCYAAPELV-VSREAYVGVKVDIWSCGVILYAMLAGYLPWDDD 265

Query: 248 -KSGEAGILTSRYEFPA-----FPAYSDRL-RHLISKLLAVQPNHR 286
             +     ++  Y +       FP Y + L R L+ ++L   P  R
Sbjct: 266 PSNPNGDDISKLYSYITATPLKFPDYVNPLPRDLLRRILVADPRRR 311

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 89/192 (46%), Gaps = 23/192 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY  NG +   L S       +    + ++ ++  +  MH  +  ++HRDIK EN
Sbjct: 177 VYLLMEYLVNGEMYKLLRS--HGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPEN 232

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  NN  KL DFG     I PP + ++            T  Y SPEMI+ SR +  D
Sbjct: 233 ILIGFNNTIKLTDFG--WSIINPPESRRKTVC--------GTIDYLSPEMIE-SREY--D 279

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRHLISKLLA 280
              D WALG+  +++     PFE+  +      I     + P+    S   + LI KLL 
Sbjct: 280 HTIDAWALGILAFELLTGAPPFEEEMKDTTYKRIAALDIKIPS--NVSQDAQDLILKLLK 337

Query: 281 VQPNHRPNIYDV 292
             P  R  + DV
Sbjct: 338 YDPKDRMRLEDV 349

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 89/199 (44%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L  + +     RL   E   +   +S  V   H++    VHRD+K+E
Sbjct: 106 KVWMALEYCPGKEL--YDHLLSLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL +N   KL DFG      R       L  V        T  Y +PE+I+     GF
Sbjct: 162 NILLDRNGNAKLTDFGFT----RECMTKTTLETVCG------TTVYMAPELIERKTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTS------RYEFPAFPAYSDRLRHLI 275
            I    DIW+LGV LY +     PF+   E            +Y+    P   D  + LI
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFIP---DDAKDLI 264

Query: 276 SKLLAVQPNHRPNIYDVVK 294
           S+LLA  P  RP++  V++
Sbjct: 265 SRLLAKNPGERPSLPQVLR 283

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 120/260 (46%), Gaps = 32/260 (12%)

Query: 52  IACLKRVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEY 111
           +  L +  +  +  +  +  E +A++ L N+R +V          +FQ+    ++ L+EY
Sbjct: 239 VKVLSKEYLIKQKKVKYVNIEKNALQKLNNSRGIVRLF------FTFQDEA-SLYFLLEY 291

Query: 112 CENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKN 170
             NG  ++ +      +          +  +Q + A+H +    ++HRDIK EN+LL   
Sbjct: 292 APNGDFLSLIK-----KFGSMNEDCASYYSAQIIDAIHFVHSRGIIHRDIKPENILLDSE 346

Query: 171 NEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNT-----TAQYRSPEMIDMSRGFPIDE 225
            + KL DFG+ +  + P S+         D++  +     TA+Y SPE+++ S     D 
Sbjct: 347 MKVKLTDFGT-AKILEPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELLNDSYA---DS 402

Query: 226 KSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPA-FPAYSDRLRHLISKLLA 280
           + DIWA G  ++++     PF+ + E      ++  +Y F A FP     +R L+ ++L 
Sbjct: 403 RCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKRILI 459

Query: 281 VQPNHRPNIYDVVKE--LSD 298
             P  R  I  + K   LSD
Sbjct: 460 KAPEQRLTISQIKKHHFLSD 479

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 95/201 (47%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L ++L   +  R+   E   +   +   V   H+L    VHRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMI--DMSRGF 221
           N+LL      KL DFG      R  +   +L  +        T  Y +PE++  D   GF
Sbjct: 158 NILLDMQGNAKLADFGFT----RECATKNQLETICG------TTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAF---PAYSDRLRH----- 273
            I    DIW+LGV LY +   + PF++  E     +R E+      P Y++++ +     
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIE 258

Query: 274 LISKLLAVQPNHRPNIYDVVK 294
           LI  LL   P  RP++ +++K
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 96/203 (47%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIE 163
           +V++ +EYC    L   L  RL  R+   E   +   +S  +   H+L    VHRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 164 NVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSR--GF 221
           N+LL K    KL DFG      R  ++   L  +        T  Y +PE+I   R  GF
Sbjct: 158 NILLDKVGNAKLTDFGFT----RECASKNILETICG------TTVYMAPELIKRERYDGF 207

Query: 222 PIDEKSDIWALGVFLYKICYYTTPFE----KSGEAGILTSRYEFPAF------PAYSDRL 271
            I    D+W+LGV LY +     PF+    K+ E  I+    E P+F      P   D  
Sbjct: 208 KI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVN---EMPSFDSTLLGPDAVD-- 258

Query: 272 RHLISKLLAVQPNHRPNIYDVVK 294
             L+SKLLA  P  RP++ +V++
Sbjct: 259 --LLSKLLAKDPIDRPSMKEVLE 279

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 19/196 (9%)

Query: 97  SFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLV 156
           SFQ   Y ++L MEYC  G     L +R    + E +       V   +  +H L    +
Sbjct: 390 SFQTKDY-LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FI 446

Query: 157 HRDIKIENVLLSKNNEFKLCDFG---SVSGPIRPP---SNPQELALVQNDIMRNT---TA 207
           +RD+K EN+LL ++    L DF      +G  +P    S   +  +  +    N+   T 
Sbjct: 447 YRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTE 506

Query: 208 QYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF--EKSGE--AGILTSRYEFPA 263
           +Y +PE+I   RG       D W LG+ +Y++ +  TPF  + S E  + ILT   +FP 
Sbjct: 507 EYLAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 264 FPAYSDRLRHLISKLL 279
               S   + LI KLL
Sbjct: 564 DKEVSKNCKDLIKKLL 579

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 87/199 (43%), Gaps = 19/199 (9%)

Query: 98   FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            F++  Y       + E G +  F    L+N + E EV  I   +  G+  +H     ++H
Sbjct: 1255 FEDDDYYYIETPIHGETGCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIH 1312

Query: 158  RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDM 217
            RDIK ENV++      KL DFGS +      S P ++ +         T  Y +PE++  
Sbjct: 1313 RDIKDENVIVDATGFVKLIDFGSAA---HVKSGPFDVFV--------GTIDYAAPEVL-- 1359

Query: 218  SRGFPIDEK-SDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLIS 276
              G P + K  DIWA+G+ LY I +   PF    E  IL     F      S   + LIS
Sbjct: 1360 -SGDPYEGKPQDIWAIGILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALIS 1416

Query: 277  KLLAVQPNHRPNIYDVVKE 295
             +L      RP I D+  +
Sbjct: 1417 MILNRNVQKRPTIDDIYND 1435

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 99/210 (47%), Gaps = 28/210 (13%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++E+   G    ++  + + RLKES    +   +  GV  MH     LVH
Sbjct: 119 LQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLISGVNYMH--YKGLVH 173

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+LL K+    + DFG V+                N++M+ +     Y +PE++
Sbjct: 174 RDLKLENLLLDKHENLVITDFGFVNE-----------FFEDNELMKTSCGSPCYAAPELV 222

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE--AGILTSR-YEFPA-----FPAY 267
             ++ +    K+D+W+ GV LY +     P++   E   G   +R Y++       FP Y
Sbjct: 223 VSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTPLKFPEY 281

Query: 268 SDRL-RHLISKLLAVQPNHRPNIYDVVKEL 296
              + R L+ ++L   P  R N+  + + +
Sbjct: 282 ITPIPRDLLRRILVPNPRRRINLQTIKRHV 311

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 89/192 (46%), Gaps = 23/192 (11%)

Query: 105 VFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIEN 164
           V+LLMEY  NG +   L S       +    + ++ ++  +  MH  +  ++HRDIK EN
Sbjct: 177 VYLLMEYLVNGEMYKLLRS--HGPFNDILASDYVYQIANALDYMH--KKNIIHRDIKPEN 232

Query: 165 VLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPID 224
           +L+  NN  KL DFG     I PP + ++            T  Y SPEMI+ SR +  D
Sbjct: 233 ILIGFNNIIKLTDFG--WSIINPPDSRRKTVC--------GTIDYLSPEMIE-SREY--D 279

Query: 225 EKSDIWALGVFLYKICYYTTPFEKSGE----AGILTSRYEFPAFPAYSDRLRHLISKLLA 280
              D WALGV  +++     PFE+  +      I     + P+    S   + LI KLL 
Sbjct: 280 HTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKIPS--NISQDAQDLILKLLK 337

Query: 281 VQPNHRPNIYDV 292
             P  R  + DV
Sbjct: 338 YDPKDRMRLEDV 349

>NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384
          Length = 801

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 124/290 (42%), Gaps = 43/290 (14%)

Query: 18  GSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIVPDKPSLNVLRAEVDAMK 77
           G +  ++++ L  G F Q+YQ             +   K+VIV         + EVD   
Sbjct: 390 GPNDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLS-KKVIVK--------KNEVDHTI 440

Query: 78  LLRNNRCVVSYIDSHAA------KSSFQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKE 131
             RN   ++    S+A+      K SFQ  T +++L+ ++   G L  F + + + R  E
Sbjct: 441 GERN---ILVTTASNASPFIVGLKFSFQTPT-DLYLVTDFMSGGEL--FWHLQKEGRFTE 494

Query: 132 SEVVNIMWSVSQGVAAMHALQP-PLVHRDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSN 190
                  + +++ V A+  L    +V+RD+K EN+LL  N    LCDFG     ++  +N
Sbjct: 495 DRA---KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTN 551

Query: 191 PQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKICYYTTPF---- 246
                          T +Y +PE++    G+   +  D W+LGV ++++C   +PF    
Sbjct: 552 -----------TFCGTTEYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFFAED 598

Query: 247 EKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296
            +     I   + +FP     S   R  +  LL   P HR    D  +EL
Sbjct: 599 NQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHRLGAIDDGREL 647

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 28/200 (14%)

Query: 98  FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            QN  Y + +++E+   G    ++  +   RLKES    +   +  GV  MH     LVH
Sbjct: 119 LQNSKY-IGIVLEFVSGGEFYKYIQRK--RRLKESSACRLFAQLISGVNYMHT--KGLVH 173

Query: 158 RDIKIENVLLSKNNEFKLCDFGSVSGPIRPPSNPQELALVQNDIMRNTTAQ--YRSPEMI 215
           RD+K+EN+L+ K+    + DFG V+                N++MR +     Y +PE++
Sbjct: 174 RDLKLENLLMDKHENLVITDFGFVNE-----------FFEDNELMRTSCGSPCYAAPELV 222

Query: 216 DMSRGFPIDEKSDIWALGVFLYKICYYTTPFEKSGE--AGILTSR-YEFPA-----FPAY 267
             ++ +    K+D+W+ GV LY +     P++   E   G   +R Y++       FP Y
Sbjct: 223 VSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEY 281

Query: 268 SDRL-RHLISKLLAVQPNHR 286
              + R L+ ++L   P  R
Sbjct: 282 ITPIPRDLLRRILVPNPRRR 301

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 86/200 (43%), Gaps = 27/200 (13%)

Query: 98   FQNGTYEVFLLMEYCENGGLINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVH 157
            F++  Y       + E G +  F    L+  + E E   I   V   +  +H+    +VH
Sbjct: 1077 FEDDDYYYIETPVHGETGCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVH 1134

Query: 158  RDIKIENVLLSKNNEFKLCDFGSV----SGPIRPPSNPQELALVQNDIMRNTTAQYRSPE 213
            RDIK ENV++      KL DFGS     SGP               D+   T   Y +PE
Sbjct: 1135 RDIKDENVVVDSKGFVKLIDFGSAAYVKSGPF--------------DVFVGTI-DYAAPE 1179

Query: 214  MIDMSRGFPIDEK-SDIWALGVFLYKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLR 272
            ++    G P D K  DIWA+GV LY I +   PF    E  IL    +F      S+   
Sbjct: 1180 VL---SGEPFDGKPQDIWAIGVLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECI 1234

Query: 273  HLISKLLAVQPNHRPNIYDV 292
            +LI  +L   P+ RP I +V
Sbjct: 1235 NLIKMILNKNPSQRPTIDEV 1254

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,381,450
Number of extensions: 2738261
Number of successful extensions: 12614
Number of sequences better than 10.0: 1852
Number of HSP's gapped: 11425
Number of HSP's successfully gapped: 1905
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)