Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H020102.285ON69369337510.0
NCAS0G038002.285ON72668629610.0
ZYRO0A01870g2.285ON70768629530.0
YNL021W (HDA1)2.285ON70667529390.0
NDAI0G006502.285ON68966929250.0
Skud_14.3082.285ON70668229230.0
Smik_14.3102.285ON70668529210.0
Suva_14.3262.285ON70668229150.0
TDEL0G021602.285ON71468128990.0
CAGL0J03454g2.285ON69369128910.0
SAKL0E07700g2.285ON71269328670.0
KAFR0H033202.285ON70267428390.0
KLTH0G10340g2.285ON70870928380.0
Kwal_27.115372.285ON70867528000.0
Ecym_33242.285ON70668927950.0
KLLA0E08383g2.285ON70469427150.0
ADL216C2.285ON70567326850.0
Kpol_1039.322.285ON65965626820.0
TPHA0C033902.285ON70167025710.0
TBLA0B069502.285ON79546120200.0
Kpol_1003.372.285ON57829813151e-174
TPHA0H003208.153ON4503573596e-36
NCAS0B054808.153ON4513733562e-35
Ecym_23468.153ON4853383572e-35
SAKL0H25124g8.153ON4483723534e-35
NDAI0B027108.153ON4533323526e-35
Kpol_246.58.153ON4533633518e-35
KAFR0C029208.153ON4533583501e-34
KLTH0E06446g8.153ON4493623482e-34
AFR172C8.153ON4493353473e-34
KLLA0F09119g8.153ON4523343463e-34
TBLA0D021408.153ON4563433464e-34
TDEL0B045808.153ON4463563455e-34
CAGL0A03322g8.153ON4503393437e-34
Skud_7.798.153ON4523313438e-34
KNAG0G013508.153ON4513353421e-33
YGL194C (HOS2)8.153ON4523323412e-33
Smik_7.798.153ON4523323384e-33
ZYRO0G19316g8.153ON4483373358e-33
Kwal_55.207908.153ON4493343332e-32
Suva_7.718.153ON4523313322e-32
TBLA0I005603.8ON4333263303e-32
Kpol_1038.113.8ON4333253278e-32
KAFR0A086303.8ON4333263242e-31
KLLA0E01981g3.8ON4323263232e-31
AGR395W3.8ON4333253233e-31
Ecym_20103.8ON4333253233e-31
TPHA0A003003.8ON4333263224e-31
ZYRO0C03498g3.8ON4333263224e-31
KLTH0F19668g3.8ON4323413207e-31
KNAG0A011603.8ON4333263181e-30
SAKL0C13706g3.8ON4333253181e-30
Kwal_55.221423.8ON4323413171e-30
NCAS0C043203.8ON4343253162e-30
NDAI0G037403.8ON4333263153e-30
Suva_14.113.8ON4333273144e-30
Skud_14.113.8ON4333273135e-30
CAGL0B01441g3.8ON4333253111e-29
Smik_14.23.8ON4333273073e-29
YNL330C (RPD3)3.8ON4333273073e-29
TDEL0A002703.8ON4333263048e-29
TDEL0C050403.362ON4541821982e-15
TBLA0B023903.362ON5791841932e-14
CAGL0D01430g3.362ON4452331912e-14
ADL265W8.607ON6943771922e-14
SAKL0B07854g3.362ON4892031876e-14
Ecym_82908.607ON7093351861e-13
KLTH0F10582g3.362ON4741831841e-13
NDAI0A051203.362ON5082111814e-13
Kwal_23.37243.362ON4732311804e-13
Suva_16.3963.362ON4771831771e-12
NCAS0A111803.362ON4902091761e-12
TDEL0A055208.607ON6743231762e-12
ADL339W3.362ON4372601742e-12
TPHA0A011208.607ON6983041734e-12
ZYRO0C16390g3.362ON4361931714e-12
KAFR0H008903.362ON4742141716e-12
YPL116W (HOS3)8.607ON6973701726e-12
Smik_6.3158.607ON6973681726e-12
KLLA0B09394g3.362ON4411831698e-12
KLTH0D09592g8.607ON7053811718e-12
Suva_16.1948.607ON6993711701e-11
Skud_16.3533.362ON4711831671e-11
Smik_16.3093.362ON4701831662e-11
KNAG0H006303.362ON4561861652e-11
Kpol_479.68.607ON6883461654e-11
Kpol_376.153.362ON5181831636e-11
YPR068C (HOS1)3.362ON4701831627e-11
SAKL0H08338g8.607ON6903731611e-10
TBLA0E040808.607ON6942971602e-10
KLLA0F00858g8.607ON715651556e-10
KAFR0H027908.607ON7171061549e-10
Kwal_26.85058.607ON7082941531e-09
NCAS0C017608.607ON7001381512e-09
CAGL0J06974g8.607ON6783771512e-09
ZYRO0F10780g8.607ON6683211503e-09
TPHA0M015903.362ON4942751493e-09
NDAI0E024808.607ON6841061493e-09
Skud_16.1648.607ON6973391484e-09
Ecym_34653.362ON4451991465e-09
KNAG0J013008.607ON6771061378e-08
TBLA0B046406.155ON48298790.73
NCAS0B055608.162ON352119751.5
Kpol_1033.248.295ON491553717.1
Smik_16.2238.78ON1226112717.6
CAGL0I01210g5.419ON55160708.3
TBLA0B095002.367ON74761708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02010
         (693 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1449   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1145   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1142   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1136   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1131   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1130   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1129   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1127   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1121   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1118   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1108   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1098   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1097   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1083   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1081   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1050   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1038   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1037   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   994   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   782   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   511   e-174
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   142   6e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   141   2e-35
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   142   2e-35
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   140   4e-35
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    140   6e-35
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   139   8e-35
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   139   1e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   138   2e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   138   3e-34
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   137   3e-34
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   137   4e-34
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   137   5e-34
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   136   7e-34
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   136   8e-34
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   136   1e-33
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   135   2e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   134   4e-33
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   133   8e-33
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   132   2e-32
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   132   2e-32
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   131   3e-32
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   130   8e-32
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   129   2e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   129   2e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   129   3e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   129   3e-31
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   128   4e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   128   4e-31
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   127   7e-31
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   127   1e-30
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   127   1e-30
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   126   1e-30
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      126   2e-30
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   125   3e-30
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   125   4e-30
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   125   5e-30
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   124   1e-29
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   122   3e-29
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   122   3e-29
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   121   8e-29
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    81   2e-15
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    79   2e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    78   2e-14
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    79   2e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    77   6e-14
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    76   1e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    75   1e-13
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    74   4e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    74   4e-13
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    73   1e-12
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    72   1e-12
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    72   2e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    72   2e-12
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    71   4e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    70   4e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    70   6e-12
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    71   6e-12
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    71   6e-12
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    70   8e-12
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    70   8e-12
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    70   1e-11
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    69   1e-11
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    69   2e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    68   2e-11
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    68   4e-11
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    67   6e-11
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    67   7e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    67   1e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    66   2e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    64   6e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    64   9e-10
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    64   1e-09
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    63   2e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    63   2e-09
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    62   3e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    62   3e-09
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    62   3e-09
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    62   4e-09
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    61   5e-09
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    57   8e-08
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    35   0.73 
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    33   1.5  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    32   7.1  
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    32   7.6  
CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly ...    32   8.3  
TBLA0B09500 Chr2 (2256700..2258943) [2244 bp, 747 aa] {ON} Anc_2...    32   8.3  

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1449 bits (3751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/693 (100%), Positives = 693/693 (100%)

Query: 1   MTEPSVKRENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTS 60
           MTEPSVKRENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTS
Sbjct: 1   MTEPSVKRENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTS 60

Query: 61  YFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVH 120
           YFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVH
Sbjct: 61  YFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVH 120

Query: 121 SKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN 180
           SKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN
Sbjct: 121 SKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN 180

Query: 181 AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKA 240
           AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKA
Sbjct: 181 AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKA 240

Query: 241 FYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF 300
           FYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF
Sbjct: 241 FYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF 300

Query: 301 EQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLE 360
           EQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLE
Sbjct: 301 EQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLE 360

Query: 361 GGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRH 420
           GGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRH
Sbjct: 361 GGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRH 420

Query: 421 GNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPE 480
           GNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPE
Sbjct: 421 GNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPE 480

Query: 481 VYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQ 540
           VYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQ
Sbjct: 481 VYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQ 540

Query: 541 SLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKV 600
           SLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKV
Sbjct: 541 SLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKV 600

Query: 601 KSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVL 660
           KSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVL
Sbjct: 601 KSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVL 660

Query: 661 RCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           RCNSDGLTNIIEERFEEATDFMLDSFEEWSESD
Sbjct: 661 RCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/686 (76%), Positives = 610/686 (88%), Gaps = 3/686 (0%)

Query: 8   RENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 67
           +E P+ +K   +   S+R +IV P   +L YTPLKTGLCYDVRMRYHAKIFTSYFEYIDP
Sbjct: 44  KEEPELKKQKITDV-SERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 102

Query: 68  HPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEF 127
           HPEDPRRIYRIYKILAENGLI DP LSGI+DIGDLMLKIPVR+AT +E+LEVHSKEH +F
Sbjct: 103 HPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDF 162

Query: 128 IESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRP 187
           IE  + M+ +ELLK+TE GDSVYFNNDS +SAKL  GG+IEACKAVVEGRVKN+ AVVRP
Sbjct: 163 IEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRP 222

Query: 188 PGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRV 247
           PGHH+EP++AGGFCLFSNVA+A+KNIL+NYPESVRRIMILDWDIHHGNGTQKAFYDDDRV
Sbjct: 223 PGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRV 282

Query: 248 LYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM 307
           LYISLHRFELGKYYPGT  G YD+TGEGKGEGFNCNITWPVGGVGDAEY+WAFEQVVMPM
Sbjct: 283 LYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPM 342

Query: 308 SREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
           +REF+PDLVIIS+GFDAADGD+IGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDA
Sbjct: 343 AREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDA 402

Query: 368 IARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTF 427
           IARSALSVAK+LIGEPP+EL DP++DPKPEAIEII+KVIRLQSKYWKCF+RR+GN+GC F
Sbjct: 403 IARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNF 462

Query: 428 EKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTI 487
           +  + ES+ + NFPLQ AIR+QQ + LS++F F   PL + +L  DTV+CSP VY   T+
Sbjct: 463 KDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTV 522

Query: 488 IILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDN 547
           II   DTPEIWAKRDVIQGTIDPS+SII D+ L FIKWA E+ YGVID+NIPQ+LFEQ+N
Sbjct: 523 IICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQEN 582

Query: 548 YSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFI 607
           YSA++T+QEV++++WDNY+++F +  K+AF+G+GDA SGIVHLLGHRDTRS VKSVINFI
Sbjct: 583 YSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFI 642

Query: 608 AQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGL 667
           AQK L+ L+PLVDE+L DWYFKNSLVFSDK+H  WGD   ENKKPRKK+GR+LRC +DG+
Sbjct: 643 AQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGI 700

Query: 668 TNIIEERFEEATDFMLDSFEEWSESD 693
            NI+EERFEEATDF+LDSFEEWS+S+
Sbjct: 701 NNIVEERFEEATDFILDSFEEWSDSE 726

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/686 (77%), Positives = 609/686 (88%), Gaps = 6/686 (0%)

Query: 11  PDSQKP---AESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 67
           P  +KP   + S+   KRQ+IV  C PK+ YTPLKTGLCYDVRMRYHAKIFTSYFEYIDP
Sbjct: 25  PVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDP 84

Query: 68  HPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEF 127
           HPEDPRRIYRIYKILAENGLI DP LSG DDIG+LMLKIPVREAT +E+L+VH+KEHLEF
Sbjct: 85  HPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEF 144

Query: 128 IESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRP 187
           IE  ++M+ +ELLK TETGDSVYFN+DS S+AKL CGGAIEACKAVVEGRVKNA AV+RP
Sbjct: 145 IEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRP 204

Query: 188 PGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRV 247
           PGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVRRI+ILDWDIHHGNGTQKAFY+DDRV
Sbjct: 205 PGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRV 264

Query: 248 LYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM 307
           LYISLHRFELGKYYPGT  G YD+TGEGKGEGFNCNITWPVGGVGDAEYM AFEQ+VMPM
Sbjct: 265 LYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPM 324

Query: 308 SREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
           +RE+RPDLVIIS+GFDAADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCV LEGGYNLDA
Sbjct: 325 AREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDA 384

Query: 368 IARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTF 427
           IA SALSVAK+LIGEPPEEL DP K+PK EAIE+I+KVI +QSKYWKCF RR GNSGC F
Sbjct: 385 IATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYWKCF-RRLGNSGCNF 443

Query: 428 EKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTI 487
           ++ +TES+ T NFPLQ AIRQ+QF  L KE+GFV  P+ +++L +DTV+CSP+V+ + T+
Sbjct: 444 KEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPEDTVLCSPDVFQESTV 503

Query: 488 IILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDN 547
           II V DTPEIWAKRDVI G IDPS SI  D+ L FIKW++ R YGVIDVNIPQSLFEQDN
Sbjct: 504 IIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGVIDVNIPQSLFEQDN 563

Query: 548 YSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFI 607
           YSAMIT+QEV+ ++WDN++++F S SK+AFVGVGDA SGIVHLLGHRDTRS VK+VINF+
Sbjct: 564 YSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGHRDTRSVVKAVINFV 623

Query: 608 AQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGL 667
            +K LKPL+PLVDE+LGDWYFKNSLVFSD+N+ CW D  NENKKPR+KFGRVLRC SDG+
Sbjct: 624 GRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVD--NENKKPRRKFGRVLRCESDGI 681

Query: 668 TNIIEERFEEATDFMLDSFEEWSESD 693
            N +EERF+EATDF+LDSFEEWS+S+
Sbjct: 682 NNNMEERFDEATDFILDSFEEWSDSE 707

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1136 bits (2939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/675 (77%), Positives = 598/675 (88%), Gaps = 2/675 (0%)

Query: 19  SSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 78
           +++ SKRQ+IV  C PK+ Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 34  TTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 93

Query: 79  YKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDE 138
           YKILAENGLI DP LSG+DD+GDLMLKIPVR ATS+E+LEVH+KEHLEFIES  KMS +E
Sbjct: 94  YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREE 153

Query: 139 LLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAG 198
           LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPPGHH+EP++AG
Sbjct: 154 LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG 213

Query: 199 GFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG 258
           GFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VLY+SLHRFE+G
Sbjct: 214 GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG 273

Query: 259 KYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVII 318
           KYYPGT QG YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM REF+PDLVII
Sbjct: 274 KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII 333

Query: 319 SAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKV 378
           S+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIARSALSVAKV
Sbjct: 334 SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV 393

Query: 379 LIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTD 438
           LIGEPP+EL DP+ DPKPE IE+I+KVIRLQSKYW CF+RRH NSGC F + + +SI + 
Sbjct: 394 LIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISK 453

Query: 439 NFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIW 498
           NFPLQ AIRQQQ   LS EF FV  PL  M L D+TV+C+P +   +TIII+V DT +IW
Sbjct: 454 NFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIW 513

Query: 499 AKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVM 558
           AKR+VI GTID S+S+I D +L FIKW ++R YG+IDVNIP +LFE DNYS MIT+QEV+
Sbjct: 514 AKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVL 573

Query: 559 SFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPL 618
            ++WDNYI++F S +KIAF+G+GD+ SGIVHLLGHRDTR+  K+VINF+  K LKPL+PL
Sbjct: 574 IYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPL 633

Query: 619 VDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEA 678
           VDETL +WYFKNSL+FS+ +H CW   ENE++KPRKKFGRVLRC++DGL NIIEERFEEA
Sbjct: 634 VDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLNNIIEERFEEA 691

Query: 679 TDFMLDSFEEWSESD 693
           TDF+LDSFEEWS+ +
Sbjct: 692 TDFILDSFEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/669 (77%), Positives = 604/669 (90%), Gaps = 2/669 (0%)

Query: 25  RQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 84
           RQ+IV P   ++ YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 85  NGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTE 144
           NGLI DP LSGIDDIGDLMLKIPVREATS+E+LEVHSKEHL+FIES +KM+ ++LLK+TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 145 TGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFS 204
           +GDSVYFN+DS +SAKL  GGAIEACKAVVEGRVKNA AVVRPPGHH+EPE+AGGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 205 NVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGT 264
           NVA+A+KNIL+NYPESVR+I+ILDWDIHHGNGTQKAFYDDDR+LY+SLHRF++GKYYPGT
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 265 AQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDA 324
             G YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPM REF+PDLVIISAGFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 325 ADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPP 384
           ADGDTIGQCHV+PSCYGHMTHMLKSLA GN+ VVLEGGYNLD+IA SALSVAK+LIGEPP
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 385 EELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQS 444
           +EL D  +DPKPE IE+I+KV+R+QSKYWKCF+ + GN+GC F++ +  SI+T NFPLQS
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 445 AIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVI 504
           AIRQQQ   LSKEF F + P+++ +L +DT++CS  +Y  +TIII V DTPEIWAKRD I
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 505 QGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDN 564
           QGTIDPS+SII D++L  IKWA+ER YGVID+NIPQ+L EQ+NY ++ITAQEV+  +WDN
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 565 YIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLG 624
           Y+++F + +KIAFVG+GDA SGIVHLLGHRDTRS VK+VINF+ QK LKPL+PLVDE+LG
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 625 DWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLD 684
           +WYFKNSLVFS+KNH  WGD   ENKKPRKK+GRVLRC++DG++NI+EERFEEATDF+LD
Sbjct: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680

Query: 685 SFEEWSESD 693
           SFEEWS+S+
Sbjct: 681 SFEEWSDSE 689

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/682 (75%), Positives = 597/682 (87%), Gaps = 2/682 (0%)

Query: 12  DSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 71
           + Q    +++ +KRQ+IV  C PK+ Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED
Sbjct: 27  EDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 86

Query: 72  PRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESV 131
           PRRIYRIYKILAENGLI DP LSG+DDIGDLMLKIPVR ATS+E+LEVH+KEHLEFIES 
Sbjct: 87  PRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIEST 146

Query: 132 TKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHH 191
            KMS ++LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPPGHH
Sbjct: 147 EKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHH 206

Query: 192 SEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYIS 251
           +EP++AGGFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VLY+S
Sbjct: 207 AEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVS 266

Query: 252 LHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREF 311
           LHRFE+GKYYPGT QG YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM REF
Sbjct: 267 LHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF 326

Query: 312 RPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARS 371
           +PDLVIIS+GFDAADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIARS
Sbjct: 327 KPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARS 386

Query: 372 ALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHM 431
           ALSVAKVLIGEPP+EL D + DPKPE IE+I+KVIRLQSKYW CF+RRH NSGC F + +
Sbjct: 387 ALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPI 446

Query: 432 TESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILV 491
            +SI + NFPLQ AIRQQQ   LS EF FV  PL  M L D+T +C+P V+  + ++++V
Sbjct: 447 NDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVV 506

Query: 492 RDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAM 551
            DT ++WAKR+VI GTID S+S+I D  + FIKW ++R YG+IDVNIP +LFE DNYS M
Sbjct: 507 HDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGM 566

Query: 552 ITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKT 611
           IT+QEV+ ++WDNYI++F + +KIAF+G+GD+ SGIVHLLGHRDTR+  K+VINF+  K 
Sbjct: 567 ITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQ 626

Query: 612 LKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNII 671
           LKPL+PLVDETL +WYFKNSL+FS+ +H CW   ENE++KPRKKFGRVLRC++DGL+N I
Sbjct: 627 LKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLSNTI 684

Query: 672 EERFEEATDFMLDSFEEWSESD 693
           EERFEEATDF+LDSFEEWS+ +
Sbjct: 685 EERFEEATDFILDSFEEWSDDE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/685 (75%), Positives = 596/685 (87%), Gaps = 2/685 (0%)

Query: 9   ENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 68
           E  + Q    +++++KRQ+IV  C PK+ Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPH
Sbjct: 24  ETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPH 83

Query: 69  PEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFI 128
           PEDPRRIYRIYKILAENGLI DP LSG+DD+GDLMLKIPVR ATS+E+LEVH+KEHLEFI
Sbjct: 84  PEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFI 143

Query: 129 ESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPP 188
           ES  KMS ++LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPP
Sbjct: 144 ESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPP 203

Query: 189 GHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVL 248
           GHH+EP++AGGFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VL
Sbjct: 204 GHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVL 263

Query: 249 YISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMS 308
           Y+SLHRFE+GKYYPGT QG YD+ GEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM 
Sbjct: 264 YVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMG 323

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAI 368
           REF+PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDAI
Sbjct: 324 REFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAI 383

Query: 369 ARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFE 428
           ARSALSVAKVLIGEPP+EL D   DPKPE IE+I+KVIRLQSKYW CF+RRH NSGC F 
Sbjct: 384 ARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFN 443

Query: 429 KHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTII 488
           + + +SI + NFPLQ AIRQQQ   LS EF  V  PL  M L D+TV+C+P VY   T++
Sbjct: 444 EPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLL 503

Query: 489 ILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNY 548
           ++V DT +IWAKR+VI GTID S+S+I D  L FIKW ++R YG+IDVNIP SLFE DNY
Sbjct: 504 VVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNY 563

Query: 549 SAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIA 608
           S MIT+QEV+ ++WDNYI++F + +KIAFVG+GD+ SGIVHLLGHRDTR+  K+VINF+ 
Sbjct: 564 SGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLG 623

Query: 609 QKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLT 668
            K LKPL+PLVDETL +WYFKNSL+FS+ +H CW   ENE++KPRKKFGRVLRC++DGL 
Sbjct: 624 DKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLN 681

Query: 669 NIIEERFEEATDFMLDSFEEWSESD 693
           N IEERFEEATDF+LDSFEEWS+ +
Sbjct: 682 NTIEERFEEATDFILDSFEEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/682 (74%), Positives = 597/682 (87%), Gaps = 2/682 (0%)

Query: 12  DSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 71
           + Q    +++ +KRQ+IV  C PKL YTPL+TGLCYDVRMRYHAKIFTSYFEYIDPHPED
Sbjct: 27  EEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPED 86

Query: 72  PRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESV 131
           PRRIYRIYKILAENGLI DP LSG+DD+GDLMLKIPVR ATS+E+LEVH+KEHLEFIES 
Sbjct: 87  PRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIEST 146

Query: 132 TKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHH 191
            KMS ++LLK TE GDSVYFNNDS +SA+L CGGAIEACKAVVEGRVKN+ AVVRPPGHH
Sbjct: 147 EKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHH 206

Query: 192 SEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYIS 251
           +EP++AGGFCLFSNVAVA+KNIL+NYPESVRRIMILDWDIHHGNGTQK+FY DD+VLYIS
Sbjct: 207 AEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYIS 266

Query: 252 LHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREF 311
           LHRFE+GKYYPGT QG YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPM REF
Sbjct: 267 LHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF 326

Query: 312 RPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARS 371
           +PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIA S
Sbjct: 327 KPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAIS 386

Query: 372 ALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHM 431
           ALSVAKVLIGEPP+EL DP+ DPKPE IE+I+KV+RLQSKYW CF+RRH NSGC F + +
Sbjct: 387 ALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPI 446

Query: 432 TESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILV 491
            +SI + NFPLQ AIRQQQ   LS EF FV  PL  M+L D+ V+C+P V    T++++V
Sbjct: 447 NDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVV 506

Query: 492 RDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAM 551
            DT ++WAKR+VI GTID S+S++ D  L FIKW ++R YG+IDVNIP +LFE DNYS M
Sbjct: 507 HDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGM 566

Query: 552 ITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKT 611
           IT+QEV+ ++WDNYI++F + +KIA++G+GD+ SGIVHLLGHRDTR+  K+VINF+  K 
Sbjct: 567 ITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQ 626

Query: 612 LKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNII 671
           LKPL+PLVDETL +WYFKNSLVF++ +H CW   ENE++KPRKKFGRVLRC++DGL+N +
Sbjct: 627 LKPLVPLVDETLTEWYFKNSLVFTNNSHQCW--KENESRKPRKKFGRVLRCDTDGLSNTV 684

Query: 672 EERFEEATDFMLDSFEEWSESD 693
           EERFEEATDF+LDSFEEWS+ +
Sbjct: 685 EERFEEATDFILDSFEEWSDEE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/681 (75%), Positives = 597/681 (87%), Gaps = 2/681 (0%)

Query: 13  SQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDP 72
           SQ     +  + +++IV  CAP L YTPLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDP
Sbjct: 36  SQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDP 95

Query: 73  RRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVT 132
           RRIYR+YKILAENGLI DP LSGID+IGDLMLKIPVREAT +E+LEVHSKE+LEF+E  +
Sbjct: 96  RRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSS 155

Query: 133 KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHS 192
           +M  +ELLK TE GDSVYFNNDS  SAKLSCGG I+ACKAVVEGRVKNA AVVRPPGHH+
Sbjct: 156 RMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHA 215

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISL 252
           EPE+ GGFCLFSNVAVA++NIL+ YPESVRRI+ILDWDIHHGNGTQKAFY+D RVLYISL
Sbjct: 216 EPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISL 275

Query: 253 HRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFR 312
           HRFE+GKYYPGT  G YD+TGEGKGEGFNCNITWPVGGVGDAEYM AFEQ+VMPM+REF+
Sbjct: 276 HRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQ 335

Query: 313 PDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSA 372
           PDLVIIS+GFDAADGDTIGQCHV+PSCYG MTHMLKSLA GNLCV LEGGYNLDAIA SA
Sbjct: 336 PDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISA 395

Query: 373 LSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMT 432
           LSVAKVLIGEPP+EL DP KDPK EAIE+I+ VI  QSKYWKCFQR+ GN+GC F + +T
Sbjct: 396 LSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVT 455

Query: 433 ESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVR 492
           E++ + +FPLQ+AIRQ+QF  LSKE+GFV  P+ ++++ DD+V+CSPEV+ + TI+I+V 
Sbjct: 456 ETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVH 515

Query: 493 DTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMI 552
           DTPEIWAKRDVI G IDPS SII D+ L F KW M R YGVIDVNIPQSLFEQDNYSAMI
Sbjct: 516 DTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMI 575

Query: 553 TAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTL 612
           T+QEV+ ++WDNYI++F S +K+AFVG GDA +GIVHLLGHRDTR+ VK+V++FI +K L
Sbjct: 576 TSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQL 635

Query: 613 KPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIE 672
           KPL+PLVDE+L DWYFKNSL+F+DKNH CW D  NE+KKPRKKFGRVLRC++DGL + +E
Sbjct: 636 KPLVPLVDESLSDWYFKNSLIFTDKNHPCWAD--NESKKPRKKFGRVLRCDTDGLNSNME 693

Query: 673 ERFEEATDFMLDSFEEWSESD 693
           ERFEEATDF+LD FEEWS+S+
Sbjct: 694 ERFEEATDFILDLFEEWSDSE 714

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/691 (73%), Positives = 611/691 (88%), Gaps = 5/691 (0%)

Query: 6   VKRENPDSQKPAE---SSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYF 62
           +K+E  +S++  E   +S   KR +IV     ++ YTPLKTG+CYDVRMRYHAKIFTSYF
Sbjct: 5   LKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYF 64

Query: 63  EYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSK 122
           EYIDPHPEDPRRIYRIYKILAENGLI DP LSG++DIGDLMLKIP+R AT++E+LEVHSK
Sbjct: 65  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSK 124

Query: 123 EHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAF 182
           EHLEFIE   KM+ +ELLK TE GDSVYFNNDS ++++L CGGAIEACKAVVEGRVKN+ 
Sbjct: 125 EHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSL 184

Query: 183 AVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFY 242
           AVVRPPGHH+EPE+AGGFCLFSNVAVA+KNIL+NYPESVRRI+ILDWD+HHGNGTQKAFY
Sbjct: 185 AVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFY 244

Query: 243 DDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 302
           DDDRVLYISLHRFELGKYYPGT QG YD+ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQ
Sbjct: 245 DDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQ 304

Query: 303 VVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGG 362
           VVMPM REF+PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGG
Sbjct: 305 VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGG 364

Query: 363 YNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGN 422
           YNLDAIA SALSVAK+LIGEPP+EL DP+++PK EA+EII+KVI LQSKYWKCF +R+GN
Sbjct: 365 YNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGN 424

Query: 423 SGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVY 482
            G   E  +   + + +FPLQ+AIRQ+QF  LS++FGFV  PL  M++  D+VICSP ++
Sbjct: 425 LGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLF 484

Query: 483 NKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSL 542
           N+ TI+++V DTPEIWAKR+VI GTIDPS S++ D+   FIKW +ER YG++D+NIPQSL
Sbjct: 485 NETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSL 544

Query: 543 FEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKS 602
           FEQ+NY+A++T+QE++ ++WDNY++FF S +K+AF+G+GDA +GIVHLLGHRDTRS VKS
Sbjct: 545 FEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKS 604

Query: 603 VINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRC 662
           V++FI +K+LKPL+PLV+E+LGDWYFKNSLVF+D +H+CWGD  NEN+KPRKKFGRVLRC
Sbjct: 605 VVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRC 662

Query: 663 NSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           +++G+ NIIEER EE+TDF+LDSFEEWS+S+
Sbjct: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/693 (72%), Positives = 594/693 (85%), Gaps = 2/693 (0%)

Query: 3   EPSVKRENPDSQKPAESSTHSKRQM--IVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTS 60
           E S+KR+    +   ES   S   +  IV    P++ YT LKTGLCYDVRMRYHAKI+TS
Sbjct: 20  EDSLKRKVDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTS 79

Query: 61  YFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVH 120
           YFEYIDPHPEDPRRIYRIYKILAENGLI DP LSG+D+IG+LMLKIPVREAT++E+L+VH
Sbjct: 80  YFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVH 139

Query: 121 SKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN 180
           +KEHL F+E   KM+ ++LLK TETGDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKN
Sbjct: 140 TKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKN 199

Query: 181 AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKA 240
           A AV+RPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVRRIMILDWDIHHGNGTQKA
Sbjct: 200 ALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKA 259

Query: 241 FYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF 300
           FY D+RVLY+SLHR+ELGKYYPGT  G+Y++TGEGKGEGFNCNI WP GG+GDAEYMWAF
Sbjct: 260 FYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAF 319

Query: 301 EQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLE 360
           +QVVMPM REF+PDLVIIS+GFDAADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCVVLE
Sbjct: 320 QQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLE 379

Query: 361 GGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRH 420
           GGYNLD+IA+SAL VAK+LIGEPP+EL  P + PKPEAIE I  VIR QSKYW CF+  H
Sbjct: 380 GGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTH 439

Query: 421 GNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPE 480
            N GC F++ +TES  + NFPLQ AIRQ+Q   LS++FGFV  PL  M++  DTVICSP 
Sbjct: 440 SNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPN 499

Query: 481 VYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQ 540
           +Y+ +T+++ V DTPEIWA+R+ I GTIDPS SII D  L  IKW+++R Y VIDVNIPQ
Sbjct: 500 IYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQ 559

Query: 541 SLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKV 600
           SLFEQDNYSAMIT+QEV+ ++WDNY+++F S +K+AF+GVGDA SGIVHLLGHRDTRS V
Sbjct: 560 SLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVV 619

Query: 601 KSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVL 660
           K+ ++F+  K LK L+PLVDE+LG+WYFKNSLVF+ KNH+CWG + NENKKPRK+FGRVL
Sbjct: 620 KAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVL 679

Query: 661 RCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           +C++ G+ NI+EERF+EATDF+LDSFEEWS+S+
Sbjct: 680 KCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/674 (74%), Positives = 585/674 (86%), Gaps = 6/674 (0%)

Query: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83
           KRQ+IV    P++ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90

Query: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143
           ENGLI D MLSG+DDIGD+MLKIPVREAT+ E+LEVHS+EHLEF+ES T M+ + LLK T
Sbjct: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150

Query: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203
           E GDSVYFNNDS  SAKLSCGGAIEACKAVVEG+VKNA AVVRPPGHHSEPES+GGFCLF
Sbjct: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210

Query: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263
           SNVAVA+KNIL+NYPESVR+IMILDWDIHHGNGTQKAFY D+RVLY+SLHRFE GKYYPG
Sbjct: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270

Query: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323
           T QG YD+ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ+VMPM REF+PDLVIIS+GFD
Sbjct: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330

Query: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383
           AADGD IGQCHV+PSCYGHMTHMLKSLA GNL VVLEGGYNLD+IA SALSVAK LIGEP
Sbjct: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEP 390

Query: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443
           P+EL DP+KDPKPEA+E+I KVI++QSKYWKCF+RRHGN    F +  +++++T  FPLQ
Sbjct: 391 PDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450

Query: 444 SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDV 503
           +AIRQQQ+  L KE+ FVKFP   +KL DD ++CSP ++  +T+II+V DTP+IW ++D+
Sbjct: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510

Query: 504 IQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLF----EQDNYSAMITAQEVMS 559
           I  T+DP +SII D+ L F+KWA  R YG+IDVNIPQSL       DNYS++I AQE++ 
Sbjct: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570

Query: 560 FMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLV 619
           F+WDN+I+F    +KIAF+GVGD+ SG+VHLLGHRDT+ +VK+VINF+A K LKPL+PLV
Sbjct: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630

Query: 620 DETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEAT 679
           DE+L DWYFKNSLVFS++ H CWGD   ENKKPRKK+GRVLRC++DGL + IEERF+EAT
Sbjct: 631 DESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688

Query: 680 DFMLDSFEEWSESD 693
           DF+LDSFEEWS+S+
Sbjct: 689 DFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/709 (72%), Positives = 591/709 (83%), Gaps = 17/709 (2%)

Query: 1   MTEPS-VKRENPDSQ-----KPAESSTH----------SKRQMIVAPCAPKLRYTPLKTG 44
           MTE + VK+E P  Q     +  ES+T           +KR  IV  C PKL YTPLKTG
Sbjct: 1   MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG 60

Query: 45  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLML 104
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP LSG+D IGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML 120

Query: 105 KIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCG 164
           KIPVREAT +E+L+VH+KEHLEFI   T M+ D+LLK TE GDSVYFNNDS  SAKLSCG
Sbjct: 121 KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 165 GAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224
           GAIEACKAVVEGRVKNA AVVRPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVR+I
Sbjct: 181 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI 240

Query: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284
           M+LDWD+HHGNGTQKAFYDDDRVLYISLHR ELGKYYPGT  G+ D+ GEGKGEGFNCNI
Sbjct: 241 MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI 300

Query: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344
            WP  GVGD+EY+WAFEQV+MPM REFRPDLVIIS+GFDAADGDT+GQCHV+PSCYGHMT
Sbjct: 301 PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 345 HMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINK 404
           HMLKSLA GNLC VLEGGY+LD+IA+SAL+VAKVLIGEPP+E L  VK PK EA+E+I+ 
Sbjct: 361 HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDE-LPVVKQPKLEAVEVIDS 419

Query: 405 VIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFP 464
           VI+ QSKYWKCF+  HGN GC+F++  T++    NFPLQ+AIRQQQ   L+ EF FV  P
Sbjct: 420 VIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLP 479

Query: 465 LFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIK 524
           LF+ +L DDT ICSP +Y+   II+ V DTP IWA+R    GTIDPS SII D  L  IK
Sbjct: 480 LFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIK 539

Query: 525 WAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDAC 584
           WA  RNYGVID+NIPQSL EQDNYSA+ITAQEV+  +WDNY+++F S +++AFV +GDA 
Sbjct: 540 WASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAH 599

Query: 585 SGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGD 644
           SG+VHLLGHRDTRS VKS ++F+ Q+ L+PLIPLVDETL DWYFKNSLVF+   H CWG+
Sbjct: 600 SGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGN 659

Query: 645 NENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           + NENKKPRKKFGRVL+C+SDG+ NI+EERFEEATDF+LD+FEEWS+S+
Sbjct: 660 DGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/675 (72%), Positives = 580/675 (85%), Gaps = 1/675 (0%)

Query: 19  SSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 78
           S T  KR +IV  C  KL YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 35  SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 94

Query: 79  YKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDE 138
           YKILAENGLI DP LSG+DDIGDLMLKIP REAT +E+L+VH+ EHLEF+   T M+ ++
Sbjct: 95  YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ 154

Query: 139 LLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAG 198
           LLK TE GDSVYFNNDS  SAKLSCGGAIEAC+AVVEGRVKNA AVVRPPGHH+EP+ AG
Sbjct: 155 LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG 214

Query: 199 GFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELG 258
           GFCLFSNVAVA++NIL+NYPESV++IMILDWD+HHGNGTQKAFY+DDRVLY+SLHR ELG
Sbjct: 215 GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG 274

Query: 259 KYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVII 318
           KYYPGT  G+ D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQVV+PM REF+PDLVII
Sbjct: 275 KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII 334

Query: 319 SAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKV 378
           S+GFDAADGDT+GQCHV+PSCYGHMTHMLKSLA GN+C VLEGGY+LD+IA+SAL VAKV
Sbjct: 335 SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV 394

Query: 379 LIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTD 438
           LIGEPP+E L  VK PKPEA+E+I+ VI++QS+YW+CF+  H N GC+F++ +TE++   
Sbjct: 395 LIGEPPDE-LPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNR 453

Query: 439 NFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIW 498
           NFPLQ+AIRQQQ   L+ E+ FV  PL + +L DDT +CSP +Y+  +II+ V DTPEIW
Sbjct: 454 NFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIW 513

Query: 499 AKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVM 558
           A+R    GTIDPS SII D  L  IKWA +RNYGVID+NIPQSL EQDNYSA++TAQEV+
Sbjct: 514 AQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVL 573

Query: 559 SFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPL 618
            ++WD+Y+++F S SK+AFV +GDA SG+VHLLGHRDTR+ VK+ I+FI Q+ L+PL+PL
Sbjct: 574 VYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPL 633

Query: 619 VDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEA 678
           VDE+L DWYFKNSLVF+   H CWG++  ENKKPRKKFGRVL+CNSDGL NI+EERFEEA
Sbjct: 634 VDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEA 693

Query: 679 TDFMLDSFEEWSESD 693
           TDF+LD+FEEWS+S+
Sbjct: 694 TDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/689 (70%), Positives = 586/689 (85%)

Query: 5   SVKRENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEY 64
           ++  EN  +     +    KR +IV    PK+ Y PLKTGLCYDVRMRYHAKIFTSYFEY
Sbjct: 18  TIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEY 77

Query: 65  IDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEH 124
           IDPHPEDPRRIYRIYKILAENGLI DP LSG+DDIG+LMLKIP+REAT  E+L VHSKEH
Sbjct: 78  IDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEH 137

Query: 125 LEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAV 184
           +EF+++   MS ++LLK TE GDSVY+NNDS  SAKLSCGGAIEACKAVVEGRVKNA AV
Sbjct: 138 VEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAV 197

Query: 185 VRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDD 244
           VRPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVR++MILDWDIHHGNGTQ+AFY+D
Sbjct: 198 VRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYND 257

Query: 245 DRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVV 304
           +RVLY+SLHR+ELG+YYPGT  G+Y+++GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V
Sbjct: 258 NRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIV 317

Query: 305 MPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYN 364
           +PM REF+PDLVIIS+GFDAADGDTIGQCHVSP+CYGHMTHMLKSLA GN+CVVLEGGYN
Sbjct: 318 IPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYN 377

Query: 365 LDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSG 424
           LD+IA+SAL V KVLIGEPP+EL DP K PKPEAI  I  VIR Q+KYW CF+ +HGN G
Sbjct: 378 LDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCG 437

Query: 425 CTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNK 484
             +++ + ES++  NFPLQSA+RQ+QF  LSKE+ FV  PL +M+LS DT+ICSP ++  
Sbjct: 438 VNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHET 497

Query: 485 DTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFE 544
           DT+II V DTPE+WAKR+ + G IDPS SII D  L+   WA+ R+YG+ID+NIPQSLFE
Sbjct: 498 DTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFE 557

Query: 545 QDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVI 604
            DNYSA++T+QEV+S++WD+Y++FF   +++AFVG+GDA SG VHLLGHRDTRS VK  I
Sbjct: 558 LDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAI 617

Query: 605 NFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNS 664
           +F  +K L+PL+PLVDE++ DWYFKNSL+F+ K H+CWG   N++KKPRKKFGRVL+CNS
Sbjct: 618 SFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNS 677

Query: 665 DGLTNIIEERFEEATDFMLDSFEEWSESD 693
           DG+ NI+EERFEEATDF+LDSFEEWS+S+
Sbjct: 678 DGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/694 (68%), Positives = 575/694 (82%), Gaps = 1/694 (0%)

Query: 1   MTEPSVKR-ENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFT 59
           +  PS+K  +N  +     S   S+R +IV P  PK+RY+ LKTG+CYDVRMRYHAKIFT
Sbjct: 11  LERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFT 70

Query: 60  SYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEV 119
           SYFEYIDPHPEDPRRIYR+YKILAENGLI DP LSG D IGDLM+K+PVREA  +E+L+V
Sbjct: 71  SYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQV 130

Query: 120 HSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVK 179
           HS++HL+FI    ++  + LLK TE GDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVK
Sbjct: 131 HSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVK 190

Query: 180 NAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQK 239
           N+ AVVRPPGHH+EPE AGGFCLFSNVAVA+ N+L++YPESVR+IMI+DWDIHHGNGTQK
Sbjct: 191 NSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQK 250

Query: 240 AFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWA 299
           AFYDDDRVLY+SLHR++LGKYYPGT  G+YD+TGEGKGEGFNCNITWP GGVGDAEYMWA
Sbjct: 251 AFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWA 310

Query: 300 FEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVL 359
           FEQV+MPM REF PDLV+IS+GFDAADGDTIGQCHV+P+CYGHMTHML SLA GNLCVVL
Sbjct: 311 FEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL 370

Query: 360 EGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419
           EGGYNLD+IA+SAL V KVL+GEPP+EL  P K P PEA ++I  VIR QSKYW CF+ R
Sbjct: 371 EGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNR 430

Query: 420 HGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSP 479
           HGN G  F+  +T ++ T NFPLQ+AIR+ Q S LS +F FV+ P+ ++ L  +T++C+ 
Sbjct: 431 HGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTS 490

Query: 480 EVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIP 539
            + + +T++++V DTPEIW++RD   G IDPS+SII D AL  I WAM+R YG+ID+NIP
Sbjct: 491 GIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIP 550

Query: 540 QSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSK 599
           Q+LFE  NY  + ++QE++ ++WDNY++FF +  K+AF+G+GDA  GIVHLLGHRDTRS 
Sbjct: 551 QTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSV 610

Query: 600 VKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRV 659
           VK  I+F+ +K LK ++PL+DETLGDWYFKNSLVF+   H+CWG   NENKK RKK+GRV
Sbjct: 611 VKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRV 670

Query: 660 LRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           L+ + DG+TNI +ERFEEATDF+LDSFEEWSES+
Sbjct: 671 LKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/673 (71%), Positives = 566/673 (84%), Gaps = 3/673 (0%)

Query: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83
           KR +IV P  PK+ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 33  KRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 92

Query: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143
           ENGLI DP LSGID+IG+LM KIPVREAT +E+L VHSKEH+EF+++   M  ++LLK T
Sbjct: 93  ENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKET 152

Query: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203
           E GDSVY+NNDS  SA+LSCGGAIEACKAVVEGRVKNA AVVRPPGHH+EP  AGGFCLF
Sbjct: 153 EAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLF 212

Query: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263
           SNVAVA++NIL+NYPESVRR+MILDWDIHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPG
Sbjct: 213 SNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPG 272

Query: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323
           T+ G+YD+ G+GKGEGFNCNI W   GVGDAEYMWAFEQVV+PM REF+PDLVIIS+GFD
Sbjct: 273 TSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFD 332

Query: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383
           AADGDTIGQCHVSP+CYGH+THMLKSLA GN+CVVLEGGYNLD+IA+SAL VAKVLIGEP
Sbjct: 333 AADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEP 392

Query: 384 PEELLDPVKDPKPEAIEIIN-KVIRLQSKYWKCFQRRHGNSGCTF-EKHMTESISTDNFP 441
           P+EL  P+K PKPEAI  I+  +++ QSKYW CF+ RHGN G  + E  + +S+++ NFP
Sbjct: 393 PDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFP 452

Query: 442 LQSAIR-QQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAK 500
           LQ       QF  L+KE+ FV  PL  M+L  DT+ICSP ++  D III V DTPEIWA+
Sbjct: 453 LQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQ 512

Query: 501 RDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSF 560
           RD + G IDPS SII D  ++ I WA+ RNYGVID+NIPQSLFEQDNYSA++++QEV+++
Sbjct: 513 RDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTY 572

Query: 561 MWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVD 620
           +WD+Y++ F   +++AFVG+GDA SG VHLLGHRDTRS VK  I F  +K L+PL+PLVD
Sbjct: 573 LWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVD 632

Query: 621 ETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATD 680
           E+LGDWYFKNSLVF+   H CWG + N++KKPRKKFGRVLR   DG+ NI+EER EEATD
Sbjct: 633 ESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATD 692

Query: 681 FMLDSFEEWSESD 693
           F+LDSFEEWSES+
Sbjct: 693 FILDSFEEWSESE 705

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/656 (71%), Positives = 563/656 (85%), Gaps = 2/656 (0%)

Query: 36  LRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSG 95
           L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 96  IDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDS 155
           IDDIGDLM KIPVREATS+E+LEVH KE LE++E    ++ DELL  TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 156 SSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILR 215
             SAKLSCGGAIEACKA+V+G+VKN+ A+VRPPGHHSEPE AGGFCLFSNVAVA+KNIL+
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 216 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275
           NYP+ V+++MI+DWDIHHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGT  G YD+ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 276 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPM REFRPDLVI+S+GFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPK 395
           +PSCYGHMTHMLKSLANG LCVVLEGGYNLDAIARSAL+VAKVLIGEPP+EL  P KDPK
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 396 PEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALS 455
           PEAIE+I++VI L+SKYWKCF+R+  NS C ++  ++ES     FP+Q AIR QQ   L+
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 456 KEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASII 515
            ++  V  PL    L +DTV+CS ++   +  II V DTPEIW+KRD I G ID SAS+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 516 TDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKI 575
            DA+L F  WA++R YG+IDVNIPQ+L+EQDNYSA +TAQEV+  +WDN +++F + +KI
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 576 AFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFS 635
           A++GVG+A SG+VHLLGHRDTRS VKSVI F+ +K LK L+PLV+E+L DWYFK SL+F+
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 636 DKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSE 691
           DKNH+CWG  EN++KKPRK++GRVLRC+SDG+ ++IEERFEEATDF++DS +EW+E
Sbjct: 605 DKNHSCWG--ENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/670 (67%), Positives = 557/670 (83%), Gaps = 4/670 (0%)

Query: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83
           KR +IV    P L YTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93

Query: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143
           ENGLI DP L+G+ DIGDLMLKIPVREAT +E+L+VH++EH++F+ES  KM+ +ELL  T
Sbjct: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153

Query: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203
           E GDSVY NNDS  SA+LSCGGAIEACKAVVEGRVKNA A+VRPPGHH+EP++AGGFCLF
Sbjct: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213

Query: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263
           SNV+VA+K+IL+ YPESVR+I+I+DWDIHHGNGTQKAFY+DD VLYISLHRFELGK+YPG
Sbjct: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273

Query: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323
             +G+YDK G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM+REFRPDLVI+S+GFD
Sbjct: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333

Query: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383
           AA GDTIGQCHV+P+CYG+MTHMLKSLA GNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393

Query: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443
           P+E+ +  +DPKP  +E+INKVIR+QSKYWKCF+R+ GN G  +E  + ES     FPLQ
Sbjct: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452

Query: 444 SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDV 503
            AIR  Q S    +FG +   L  + L  +++ICS   +   ++ +L+ DTPE+W  RD+
Sbjct: 453 DAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDI 512

Query: 504 IQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWD 563
           I G IDPS SII D++L FI WA+ER   VID+NIP+S FE DNYS+ + +Q+VM  +WD
Sbjct: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572

Query: 564 NYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETL 623
           N+ ++  S  K+ F+G+G+A SGIVHLLG RDTR+  K+ INF+   +LKP++P +DE+L
Sbjct: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632

Query: 624 GDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFML 683
           GDWYFKNSLVF+D  H CW +N+   KKPRKK+GRVLRC++DG+ NIIEERFEEATDF+L
Sbjct: 633 GDWYFKNSLVFTDHFHGCWSEND---KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFIL 689

Query: 684 DSFEEWSESD 693
           D+F+EWS+++
Sbjct: 690 DAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/461 (77%), Positives = 405/461 (87%)

Query: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83
           K+Q+IV   APK+ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143
           ENGLI DP LSG+D+IGDLMLK+P+REAT  E+LEVHS EH +++E  +  + ++LLK T
Sbjct: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159

Query: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203
           E GDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKNA AVVRPPGHHSEPESAGGFCLF
Sbjct: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219

Query: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263
           SNVAVA+KNIL+NYPESVR+++ILDWDIHHGNGTQKAFY+DD VLYISLHRFELGKYYPG
Sbjct: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279

Query: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323
           T QG YD+TGEGKGEGFNCNITWP+G VGDAEYMWAFEQVVMPMSREF+PDLVIIS+GFD
Sbjct: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339

Query: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383
           AADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIARSALSV+K+LIGEP
Sbjct: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEP 399

Query: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443
           P+EL DP+KDPKPE IE+I+K+IRLQSKYWKCF+RRHGN GC F++ + +S+ + NFPLQ
Sbjct: 400 PDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459

Query: 444 SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNK 484
           +AIR  Q   L  E  F+  P+   + ++ +   +  + NK
Sbjct: 460 TAIRNFQSKKLFDELNFLTLPIKNFQKNNMSTSTTNSINNK 500

 Score =  322 bits (825), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 143/224 (63%), Positives = 183/224 (81%), Gaps = 2/224 (0%)

Query: 470 LSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMER 529
           L+++T++CSP +    T+++LV D+P++W KRDV  G +D S++II D+ L FIKW+++R
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 530 NYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVH 589
           NYGVID+NIPQ+LFEQDNYS+++ AQE +   WDNY+++F    KI F+G GDA +GIVH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 590 LLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENEN 649
           LLGHRDTRS VKSVINF+ +K LK L+PLVDETL DWYFKNSLVF+DKNH  W D  NEN
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751

Query: 650 KKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           KKPRKKFGRVLR   DG+ N+IEERF+EATDF+LDSFEEWS+ +
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/298 (77%), Positives = 264/298 (88%)

Query: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83
           KRQ+IV    PKL YTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143
           ENGLI D  LSG+DDIGD+MLKIPVR AT +E+L VH++EHL+FIE++   S +EL+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203
           E  DSVY+NNDS  SAKLSCGG IEAC+AVVEGRVKN+ A+VRPPGHH+EP++AGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263
           SNV+VA+++ILR YPESVR+I+ILDWDIHHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAG 321
           T  G YD+ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+ REFRPDLVI+S+G
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  259 bits (663), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 167/226 (73%), Gaps = 2/226 (0%)

Query: 468 MKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAM 527
           MK  +  V+ S +++  +T++ILV DTPE+W  RD+I G +DPS S++ D ++ FIKWA 
Sbjct: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412

Query: 528 ERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGI 587
           +RNY ++D+NIP+S  E++ +S+   A E+M  +WDN++++  + +KI F+G+G++  GI
Sbjct: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472

Query: 588 VHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNEN 647
           VHL+G RD R   K+VINF+    LK L    DET+ DWYFKNSLVF++ +H CW   E+
Sbjct: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCW--KES 530

Query: 648 ENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693
           E K+PRKKFGRVL+ +SDG+ +II ERF+EATDF+LD+FEEWS+ +
Sbjct: 531 EEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 183/357 (51%), Gaps = 39/357 (10%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R            ++TD ++S  G+ +I D
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRF-----------MLTDHLVSSYGLHNIMD 70

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNNDSSS 157
           L      REAT +E+L+ HS++++EF+  V+  +  ++ + T      GD      +   
Sbjct: 71  LY---ETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYE 127

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
             KL  G +++A + ++    ++  A+    G HH++  +  GFC  +++ +A+ N+LR 
Sbjct: 128 YCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRY 185

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+YD+ G  +
Sbjct: 186 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAE 238

Query: 277 GEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335
           G+ F  N+  P+  G+ D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  ++
Sbjct: 239 GKHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNL 296

Query: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIGEPPEEL 387
           +   +G     ++S     + VV  GGY    ++R     + +    +L  E PE++
Sbjct: 297 NIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDM 352

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/373 (29%), Positives = 185/373 (49%), Gaps = 44/373 (11%)

Query: 34  PKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPML 93
           P+  Y   + G  Y  R+ YH     S + Y   HP  P R+           ++TD ++
Sbjct: 16  PQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------MLTDHLV 61

Query: 94  S--GIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVT-----KMSHDELLKSTETG 146
           S  G+  I DL      REAT +E+ + HS++++EF+  VT     KM    L K     
Sbjct: 62  SSYGLHKIMDLY---ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGD 118

Query: 147 DSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSN 205
           D   F N    S  L  G +++A + ++    ++  A+    G HH++  +  GFC  ++
Sbjct: 119 DCPIFQNIYDYST-LYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVND 175

Query: 206 VAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTA 265
           + ++  N+LR +P    R++ +D D+HHG+G Q+AFY  DRV  IS H+F  G+++PGT 
Sbjct: 176 IVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT- 229

Query: 266 QGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAA 325
            G +D+ G  KG+ F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+ 
Sbjct: 230 -GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSL 287

Query: 326 DGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLI 380
             D +G  +++   +G     +KS     + VV  GGY    ++R     + +    +L 
Sbjct: 288 GHDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLP 346

Query: 381 GEPPEELLDPVKD 393
            E PEE+  P +D
Sbjct: 347 SEIPEEI--PFRD 357

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 172/338 (50%), Gaps = 32/338 (9%)

Query: 40  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GID 97
           P + G  Y  ++ YH     S + Y   HP  P R+           ++TD ++S  G+ 
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRL-----------MLTDHLVSCYGLH 101

Query: 98  DIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNN 153
            I DL      REAT +E+LE H+ +++EF+  VT  + ++L    L+    GD      
Sbjct: 102 KIMDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQ 158

Query: 154 DSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKN 212
                + L  G +++A + ++    ++  A+    G HH++  +  GFC  +++ +A  +
Sbjct: 159 GMFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIIS 216

Query: 213 ILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKT 272
           +LR +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ 
Sbjct: 217 LLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEI 269

Query: 273 GEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQ 332
           G  KG+ F+ N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G 
Sbjct: 270 GCSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGC 328

Query: 333 CHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
            +++   +G     +KS     LCV   GGY    ++R
Sbjct: 329 FNLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 184/372 (49%), Gaps = 41/372 (11%)

Query: 35  KLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS 94
           K  Y P + G  Y   + YH     S + Y   HP  P R+           ++TD ++S
Sbjct: 11  KETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRL-----------MLTDHLVS 59

Query: 95  --GIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFI-----ESVTKMSHDELLKSTETGD 147
             G+  I DL      REAT  E+LE HS +++EF+     ++++KM    L K     D
Sbjct: 60  SYGLHKIMDLY---ETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDD 116

Query: 148 SVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNV 206
              F      S+ L  G +++A + ++ G  ++  A+    G HH++     GFC  +++
Sbjct: 117 CPIFQGIFEYSS-LYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDI 173

Query: 207 AVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQ 266
            +A  N+LR +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  
Sbjct: 174 VLAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 226

Query: 267 GHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAAD 326
           G +D+ G  +G+ F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+  
Sbjct: 227 GDFDEIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG 285

Query: 327 GDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIG 381
            D +G  +++   +G     +KS     L VV  GGY    ++R     + L    +L  
Sbjct: 286 HDRLGCFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQ 344

Query: 382 EPPEELLDPVKD 393
           E PE +  P +D
Sbjct: 345 EIPENI--PFRD 354

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/332 (29%), Positives = 170/332 (51%), Gaps = 34/332 (10%)

Query: 47  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGDLML 104
           Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  I DL  
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMDLY- 75

Query: 105 KIPVREATSQEVLEVHSKEHLEFIESVT-----KMSHDELLKSTETGDSVYFNNDSSSSA 159
               R AT++E+++ HS+++L+F+  VT     KM    L K     D   F N    S 
Sbjct: 76  --ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYST 133

Query: 160 KLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYP 218
            L  G +++A + ++    ++  A+    G HH++  +  GFC  +++ ++  N+LR +P
Sbjct: 134 -LYTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP 190

Query: 219 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGE 278
               R++ +D D+HHG+G Q+AFY  DRV  IS H+F  G+++PGT  G YD+TG  KG+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGK 243

Query: 279 GFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPS 338
            F  N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  +++  
Sbjct: 244 HFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIK 302

Query: 339 CYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
            +G     +KS     + VV  GGY    ++R
Sbjct: 303 GHGECVKFIKSFGIP-MLVVGGGGYTPRNVSR 333

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  139 bits (351), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 106/363 (29%), Positives = 181/363 (49%), Gaps = 41/363 (11%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  I D
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMD 73

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVT-----KMSHDELLKSTETGDSVYFNNDSS 156
           L      R AT  E+L+ HS +++ F++ VT     KM    L K     D   F N   
Sbjct: 74  LY---ETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYD 130

Query: 157 SSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILR 215
            SA L  G +++A + ++    ++  A+    G HH++  +  GFC  +++ +A  N+LR
Sbjct: 131 YSA-LYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLR 187

Query: 216 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275
            +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G+YD+ G  
Sbjct: 188 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCA 240

Query: 276 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335
           +G+ F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++
Sbjct: 241 QGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNL 299

Query: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIGEPPEELLDP 390
           +   +G     ++S     L VV  GGY    ++R     + +    +L  E PE++  P
Sbjct: 300 NIKAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDI--P 356

Query: 391 VKD 393
            +D
Sbjct: 357 FRD 359

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 180/358 (50%), Gaps = 41/358 (11%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  I D
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRL-----------MLTDHLVSSYGLHKIMD 71

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVT-----KMSHDELLKSTETGDSVYFNNDSS 156
           L      REAT +E+ + HS ++L+F+E ++     K+    L K     D   F N   
Sbjct: 72  LY---ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYD 128

Query: 157 SSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILR 215
            S  L  G +++A + ++ G  ++  A+    G HH++  +  GFC  +++ ++  N+LR
Sbjct: 129 YST-LYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLR 185

Query: 216 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275
            +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G+YD+ G  
Sbjct: 186 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCS 238

Query: 276 KGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCH 334
            G+ F  N+  P+  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +
Sbjct: 239 GGKHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFN 296

Query: 335 VSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIGEPPEEL 387
           ++   +G     + S     + VV  GGY    ++R     + +    +L  E PEEL
Sbjct: 297 LNIKAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEEL 353

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 181/362 (50%), Gaps = 39/362 (10%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y+  + YH     S F Y   HP  P R+           ++TD ++S  G+  I D
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRL-----------MLTDHLVSSYGLHKIMD 69

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNNDSSS 157
           L      R AT +E+ E H+ +++EF+  V+  +  +L + T      GD          
Sbjct: 70  LY---ETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQ 126

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
            + L  G +++A + ++ G  ++  A+    G HH++  S  GFC  +++ ++  N+LR 
Sbjct: 127 YSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRY 184

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D+TG  +
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSR 237

Query: 277 GEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVS 336
           G+ F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++
Sbjct: 238 GKHFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 337 PSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIGEPPEELLDPV 391
              +G     +KS     L V+  GGY    ++R     +AL     +  E PE++  P 
Sbjct: 297 VKAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPEDI--PF 353

Query: 392 KD 393
           +D
Sbjct: 354 RD 355

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 171/335 (51%), Gaps = 34/335 (10%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  + D
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRL-----------MLTDHLVSRYGLHKVMD 69

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSS 157
           L      R AT +EVL  H++++++F+  V   + ++L    L+    GD          
Sbjct: 70  LY---ETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFE 126

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
            + L  G +++A + ++ G  ++  A+    G HH++  +  GFC  +++ +A  N+LR 
Sbjct: 127 YSMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRY 184

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSR 237

Query: 277 GEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335
           G+ F+ N+  P+  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++
Sbjct: 238 GKHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           +   +G     +KS     LCV   GGY    ++R
Sbjct: 296 NIRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 167/334 (50%), Gaps = 32/334 (9%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  + D
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRL-----------MLTDHLVSAYGLHKVMD 72

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSS 157
           L      R AT  E+ + HS++++ F+  VT  + ++L    L+    GD          
Sbjct: 73  LY---ETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFD 129

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
            A L  G +++A + ++ G  ++  A+    G HH++  +  GFC  +++ +A  N+LR 
Sbjct: 130 YAALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRY 187

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +
Sbjct: 188 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSR 240

Query: 277 GEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVS 336
           G+ F  N+     G+ D  Y+  F+ ++ P+   FRP ++I   G D+   D +G  +++
Sbjct: 241 GKHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLN 299

Query: 337 PSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
              +G     +KS     L VV  GGY    ++R
Sbjct: 300 IKAHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  137 bits (346), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 174/343 (50%), Gaps = 33/343 (9%)

Query: 34  PKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPML 93
           P+  Y   + G  Y  R+ YH     S + +   HP  P R+           ++TD ++
Sbjct: 16  PQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLV 61

Query: 94  SGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFI-----ESVTKMSHDELLKSTETGDS 148
           SG   +  +M     R+A+  E+LE H+ +++ F+     ++V KM    L K     D 
Sbjct: 62  SGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC 120

Query: 149 VYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVA 207
             F+N    S+ L  G +++A + ++ G  ++  A+    G HH++  S  GFC  +++ 
Sbjct: 121 PIFHNLYEYSS-LYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIV 177

Query: 208 VASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQG 267
           ++  N+LR +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G
Sbjct: 178 LSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--G 230

Query: 268 HYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADG 327
           +YD+TG   G+ F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   
Sbjct: 231 NYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGH 289

Query: 328 DTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           D +G  +++   +G     +KS     + VV  GGY    ++R
Sbjct: 290 DRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPKNVSR 331

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 180/356 (50%), Gaps = 37/356 (10%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  Y  R+ YH     S + Y   HP  P R+           L+TD ++S  G+  I D
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHKIMD 69

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNNDSSS 157
           L      R ATS+E+ E H++++++F+  VT  +  ++ + T      GD      +  +
Sbjct: 70  LY---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFN 126

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
             KL  G +++A + ++    ++  A+    G HH++  +  GFC  +++ +A  N+LR 
Sbjct: 127 YCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRY 184

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G++D+ G   
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCAN 237

Query: 277 GEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVS 336
           G+ F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D IG  +++
Sbjct: 238 GKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLT 296

Query: 337 PSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR-----SALSVAKVLIGEPPEEL 387
              +G     ++S     L VV  GGY    ++R     + +    +L  E PEE+
Sbjct: 297 IKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEI 351

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  136 bits (343), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 173/339 (51%), Gaps = 29/339 (8%)

Query: 38  YTPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGI 96
           + PL + G  Y  R+ YH     S++ Y   HP  P R+           ++TD ++SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 97  DDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFN 152
             +  +M     R+AT++E+ E HS++++ F+  VT  +  +L + T      GD     
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 153 NDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASK 211
            +    + L  G +++A + ++    ++  A+    G HH++  S  GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 212 NILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDK 271
           N+LR +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G  D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 272 TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIG 331
           TG   G+ F  N+     G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 332 QCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
             +++   +G     ++S     + VV  GGY    ++R
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSR 329

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 167/331 (50%), Gaps = 32/331 (9%)

Query: 47  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGDLML 104
           Y  R+ YH     S++ Y   HP  P R+           ++TD ++S  G+  I DL  
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMDLY- 71

Query: 105 KIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSSSAK 160
               R AT  E+LE HS++++ F+  V+  + ++L    L++   GD      +      
Sbjct: 72  --ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTT 129

Query: 161 LSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPE 219
           L  G +++A + ++    ++  A+    G HH++  S  GFC  +++ ++  N+LR +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 220 SVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEG 279
              RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKH 240

Query: 280 FNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSC 339
           F  N+     G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   
Sbjct: 241 FALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 340 YGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           +G     +KS     L VV  GGY    ++R
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 168/335 (50%), Gaps = 28/335 (8%)

Query: 41  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIG 100
            + G    +R+ YH     S++ Y   HP  P R+           ++TD ++SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 101 DLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNNDSS 156
            +M     R AT+ E+ E H+++++ F++ V+  +  +L + T      GD      +  
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 157 SSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILR 215
             A L  G +++A + ++ G  ++  A+    G HH++  S  GFC  +++ ++  N+LR
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 216 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275
            +P    R++ +D D+HHG+G Q+AFY  DRV  IS H++  G ++PGT  G  D+TG  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 276 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335
            GE F  N+     G+ D  Y+  F+ V+ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           +   +G     +KS     L VV  GGY    ++R
Sbjct: 297 NIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 167/332 (50%), Gaps = 32/332 (9%)

Query: 46  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGDLM 103
            Y  R+ YH     S++ Y   HP  P R+           ++TD ++S  G+  I DL 
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMDLY 71

Query: 104 LKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSSSA 159
                R AT  E+L+ HS++++ F+  V+  + ++L    L++   GD      +     
Sbjct: 72  ---ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYT 128

Query: 160 KLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYP 218
            L  G +++A + ++    ++  A+    G HH++  S  GFC  +++ ++  N+LR +P
Sbjct: 129 TLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP 186

Query: 219 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGE 278
               RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+
Sbjct: 187 ----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGK 239

Query: 279 GFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPS 338
            F  N+     G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++  
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIK 298

Query: 339 CYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
            +G     +KS     L VV  GGY    ++R
Sbjct: 299 AHGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 167/332 (50%), Gaps = 32/332 (9%)

Query: 46  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGDLM 103
            Y  R+ YH     S++ Y   HP  P R+           ++TD ++S  G+  I DL 
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMDLY 71

Query: 104 LKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSSSA 159
                R AT  E+L+ HS++++ F+  V+  + ++L    L++   GD      +     
Sbjct: 72  ---ETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYT 128

Query: 160 KLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYP 218
            L  G +++A + ++    ++  A+    G HH++  S  GFC  +++ ++  N+LR +P
Sbjct: 129 TLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP 186

Query: 219 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGE 278
               RI+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+
Sbjct: 187 ----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGK 239

Query: 279 GFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPS 338
            F  N+     G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++  
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIK 298

Query: 339 CYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
            +G     +KS     L VV  GGY    ++R
Sbjct: 299 AHGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  133 bits (335), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 174/337 (51%), Gaps = 32/337 (9%)

Query: 41  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDD 98
            + G  Y  R+ YH     S + Y   HP  P R+           ++TD ++S  G+  
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRL-----------MLTDHLVSSYGLHK 65

Query: 99  IGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNND 154
           I DL      R AT +E+   HS+E+++F++ VT  + ++L + T      GD      +
Sbjct: 66  IMDLY---ETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPN 122

Query: 155 SSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNI 213
               + L  G +++A + ++    ++  A+    G HH++  +  GFC  +++ +A+ N+
Sbjct: 123 LYDYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNL 180

Query: 214 LRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTG 273
           LR +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G++D+ G
Sbjct: 181 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVG 233

Query: 274 EGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQC 333
             +G+ F  N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  
Sbjct: 234 CARGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCF 292

Query: 334 HVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           +++   +G   + ++S     L VV  GGY    ++R
Sbjct: 293 NLNVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 168/334 (50%), Gaps = 32/334 (9%)

Query: 44  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGD 101
           G  +   + YH     S F Y   HP  P R+           ++TD ++S  G+  I D
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRL-----------MLTDHLVSSYGLHKIMD 69

Query: 102 LMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDEL----LKSTETGDSVYFNNDSSS 157
           L      R AT +E+ E HS++++EF+  V+  +  +L    L+    GD          
Sbjct: 70  LY---ETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQ 126

Query: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRN 216
            + L  G +++A + ++ G  ++  A+    G HH++  +  GFC  +++ ++  N+LR 
Sbjct: 127 YSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRY 184

Query: 217 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGK 276
           +P    R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D+ G  +
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSR 237

Query: 277 GEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVS 336
           G+ F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++
Sbjct: 238 GKHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 337 PSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
              +G     +KS     L VV  GGY    ++R
Sbjct: 297 VKAHGECVKYVKSFGLPML-VVGGGGYTPRNVSR 329

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/331 (27%), Positives = 164/331 (49%), Gaps = 32/331 (9%)

Query: 47  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS--GIDDIGDLML 104
           Y  R+ YH     S++ Y   HP  P R+           ++TD ++S  G+  I DL  
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRL-----------MLTDHLVSSYGLHKIMDLY- 71

Query: 105 KIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST----ETGDSVYFNNDSSSSAK 160
               R AT  E+ E H+++++ F+  V+  + ++L + T      GD      +      
Sbjct: 72  --ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTT 129

Query: 161 LSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPE 219
           L  G  ++A + ++    ++  A+    G HH++  S  GFC  +++ ++  N+LR +P 
Sbjct: 130 LYTGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 220 SVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEG 279
              R++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   + G  KG+ 
Sbjct: 187 ---RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKH 240

Query: 280 FNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSC 339
           F  N+     G+ D  Y+  F+ +V P+   F+P +++   G D+   D +G  +++   
Sbjct: 241 FALNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 340 YGHMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
           +G     +KS     L VV  GGY    ++R
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 FVKSF-NIPMMVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  130 bits (327), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 153/325 (47%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVPL 238

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNF 297

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     L VV  GGY +  +AR+
Sbjct: 298 VKSFGI-PLMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 YVKSF-NIPMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  129 bits (323), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS     L +V  GGY +  +AR+
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 154/325 (47%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     + VV  GGY +  +AR+
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 154/325 (47%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     + VV  GGY +  +AR+
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 FVKSF-NIPMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + D   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS     + +V  GGY +  +AR+
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  127 bits (320), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 94/341 (27%), Positives = 161/341 (47%), Gaps = 28/341 (8%)

Query: 35  KLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS 94
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 95  GIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYF 151
                   M     + AT QE+ + HS E+++F+  VT  + +   K +     GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 152 NNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVAS 210
            +       +S GG++E    +  G+     A+    G HH++   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 211 KNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYD 270
             +LR +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 271 KTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTI 330
            TG GKG+ ++ N+     G+ D  Y   FE V+  +   ++P  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 331 GQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARS 371
           G  ++S   + +  + +KS     L VV  GGY +  +AR+
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E+   +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  ++S   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 YVKSF-NIPMMVVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 154/325 (47%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNY 297

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     + VV  GGY +  +AR+
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  126 bits (317), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 93/341 (27%), Positives = 161/341 (47%), Gaps = 28/341 (8%)

Query: 35  KLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLS 94
           +L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 95  GIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYF 151
                   M     + AT QE+ + H+ E+++F+  VT  + +   K +     GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 152 NNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVAS 210
            +       +S GG++E    +  G+     A+    G HH++   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 211 KNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYD 270
             +LR +P    R++ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 271 KTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTI 330
            TG GKG+ +  N+     G+ D+ Y   FE V+  +   ++P  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 331 GQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARS 371
           G  ++S   + +  + +KS     L VV  GGY +  +AR+
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 153/325 (47%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 129 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRFHP----RVLY 183

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G    TG GKG+ +  N+  
Sbjct: 184 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVPL 239

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 240 R-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNY 298

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     + VV  GGY +  +AR+
Sbjct: 299 VKSFGI-PMMVVGGGGYTMRNVART 322

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 154/326 (47%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 156/327 (47%), Gaps = 30/327 (9%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVT----KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGG 165
            AT QE+ + H+ E+++F+  VT    +M   E +K    GD     +       +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFN-VGDDCPVFDGLYEYCSISGGG 126

Query: 166 AIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224
           ++E    +  G+     AV    G HH++   A GFC  +++ +    +LR +P    R+
Sbjct: 127 SMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284
           + +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ ++ N+
Sbjct: 181 LYVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNV 236

Query: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344
                G+ DA Y   FE VV  +   ++P  V++  G D+  GD +G  ++S   + +  
Sbjct: 237 PLR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCV 295

Query: 345 HMLKSLANGNLCVVLEGGYNLDAIARS 371
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 155/327 (47%), Gaps = 30/327 (9%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVT----KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGG 165
            AT QE+ + H+ E+++F+  VT    +M   E +K    GD     +       +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFN-VGDDCPVFDGLYEYCSISGGG 126

Query: 166 AIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224
           ++E    +  G+     AV    G HH++   A GFC  +++ +    +LR +P    R+
Sbjct: 127 SMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284
           + +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNV 236

Query: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344
                G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   +G+  
Sbjct: 237 PLR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCV 295

Query: 345 HMLKSLANGNLCVVLEGGYNLDAIARS 371
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 152/325 (46%), Gaps = 26/325 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMI 226
           +E    +  G+   A        HH++   A GFC  +++ +    +LR +P    R++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 227 LDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITW 286
           +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G GKG+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVPL 238

Query: 287 PVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHM 346
              G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNY 297

Query: 347 LKSLANGNLCVVLEGGYNLDAIARS 371
           +KS     + VV  GGY +  +AR+
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  122 bits (307), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/327 (27%), Positives = 154/327 (47%), Gaps = 30/327 (9%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVT----KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGG 165
            AT QE+ + H+ E+++F+  VT    +M   E +K    GD     +       +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFN-VGDDCPVFDGLYEYCSISGGG 126

Query: 166 AIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224
           ++E    +  G+     AV    G HH++   A GFC  +++ +    +LR +P    R+
Sbjct: 127 SMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284
           + +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNV 236

Query: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344
                G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  
Sbjct: 237 PLR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCV 295

Query: 345 HMLKSLANGNLCVVLEGGYNLDAIARS 371
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  122 bits (307), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/327 (27%), Positives = 154/327 (47%), Gaps = 30/327 (9%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVT----KMSHDELLKSTETGDSVYFNNDSSSSAKLSCGG 165
            AT QE+ + H+ E+++F+  VT    +M   E +K    GD     +       +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFN-VGDDCPVFDGLYEYCSISGGG 126

Query: 166 AIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRI 224
           ++E    +  G+     AV    G HH++   A GFC  +++ +    +LR +P    R+
Sbjct: 127 SMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 225 MILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNI 284
           + +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNV 236

Query: 285 TWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMT 344
                G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  ++S   + +  
Sbjct: 237 PLR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCV 295

Query: 345 HMLKSLANGNLCVVLEGGYNLDAIARS 371
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  121 bits (304), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 153/326 (46%), Gaps = 28/326 (8%)

Query: 50  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVR 109
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 110 EATSQEVLEVHSKEHLEFIESVTKMSHDELLKST---ETGDSVYFNNDSSSSAKLSCGGA 166
            AT QE+ + H+ E+++F+  VT  + +   K +     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 167 IEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIM 225
           +E    +  G+     A+    G HH++   A GFC  +++ +    +LR +P    R++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 226 ILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT 285
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 286 WPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTH 345
               G+ DA +   FE VV  +   ++P  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 346 MLKSLANGNLCVVLEGGYNLDAIARS 371
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 90/182 (49%), Gaps = 11/182 (6%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  +++ +  + + R   +  ++I  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSR 309
           ISLH FE+G ++PGT         E        NI   + G+ D       EQ+V P+  
Sbjct: 263 ISLHLFEVG-FFPGTGN-----LSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 310 EFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDAI 368
              PD+++I  G D   GD   +  +S       +T ++ +  +  + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 369 AR 370
           +R
Sbjct: 376 SR 377

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HHS  + A GFC  +++ +    I +   +  R+I  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSR 309
           IS+H FE G ++P T       + E    GFN      + G+ D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCTG------SLEETKHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 310 EFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVL---EGGYNLD 366
           + +P+ +++  G D   GD   +  ++ S  G   +++  L N   C V+    GGYN  
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYNER 466

Query: 367 AIAR 370
            ++R
Sbjct: 467 VMSR 470

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 105/233 (45%), Gaps = 10/233 (4%)

Query: 161 LSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
           +S G  +   + ++EG  +          HHS    A GFC  +++A+    + R     
Sbjct: 174 VSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---G 230

Query: 221 VRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGF 280
           V RI  +D+D+HHG+G +KAF    +V  ISLH +E G ++P    G  +    GK    
Sbjct: 231 VDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFP--CSGSLEDNSSGKSI-- 285

Query: 281 NCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCY 340
             NI   + G+ D+      +++++P   + +P++++I  G D   GD   +  +S    
Sbjct: 286 -VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIKGL 343

Query: 341 GHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKD 393
                 L    N ++ ++  GGYN   ++R    +   +  +   E   P+ D
Sbjct: 344 TSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDD 396

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 98/377 (25%), Positives = 143/377 (37%), Gaps = 86/377 (22%)

Query: 113 SQEVLEVHSKEHLEFIESVTKMSHDELLKST-------ETGDSVYFNNDSSSSAKLSCGG 165
           S  VL VH  +  + I  + K S D + K           GD +Y    +  + + S G 
Sbjct: 105 SPHVLRVHGNDWPKAILRLCKQSDDRIQKRQLEVPDEWNVGD-IYLCRGTIDALQGSIGA 163

Query: 166 AIEACKAVVEG-----RVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
                 ++ +G         AF  +RPPGHHS   +  GFCL +N  +A +     Y   
Sbjct: 164 LESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--G 221

Query: 221 VRRIMILDWDIHHGNGTQ-----------------KAFYDD--------DRVLYISLHRF 255
           V    ILD+D+HHG+GTQ                  A YDD         +V Y SLH  
Sbjct: 222 VTHAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDI 281

Query: 256 ELGKYYPGTAQGHYDKTGEGKG-----EGFNCNITWPV--------------------GG 290
                +P T QG+  KT          +  + NI W +                      
Sbjct: 282 ---NSFP-TEQGYAHKTSIKDASVCIMDSHDVNI-WNIHLTAYETEEEFNKLYQTKYRAI 336

Query: 291 VGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQ----CHVSPSCYGHMTHM 346
              A+      Q  M    +    L+IISAGFDA++ + +       HV  S Y   T  
Sbjct: 337 FAKADEFLRVSQKRMASEGKNYKGLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKD 396

Query: 347 LKSLA----NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEII 402
              LA     G L  +LEGGY+  A+     S    LIG   +  +     P+  + ++I
Sbjct: 397 ALKLAQMHTQGKLLSLLEGGYSDAALVSGVFS---HLIGMQNQNWI-----PEWGSAQVI 448

Query: 403 NKVIRLQSKYWKCFQRR 419
            +V R     WK ++ +
Sbjct: 449 KEVCRGCRPNWKAYKTK 465

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 93/203 (45%), Gaps = 18/203 (8%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HHS    A GFC  +++ +A + + RN+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMS 308
           ISLH  E G ++PGT      + G          I  P+  G  D   M   E VV+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
           ++  P +++I  G D   GD   +  ++       +  +L SL + ++ ++  GGYN   
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRV 409

Query: 368 IAR----SALSVAKVLIGEPPEE 386
           ++R        V       PPE+
Sbjct: 410 MSRFYTYLTWKVCDQFSKSPPED 432

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 140/335 (41%), Gaps = 75/335 (22%)

Query: 146 GDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKN-----AFAVVRPPGHHSEPESAGGF 200
           GD +Y   ++  + + S G       ++ +G V       AF  +RPPGHHS   +  GF
Sbjct: 145 GD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGF 203

Query: 201 CLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ---------------------- 238
           CL +N  +A +     Y   V   +ILD+D+HHG+GTQ                      
Sbjct: 204 CLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYN 261

Query: 239 ---KAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKG---EGFNCNITWPV---- 288
              K F +  +V Y S+H  ++  +         DK  +      +  + NI W +    
Sbjct: 262 EFDKKFAEFPKVGYFSMH--DINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLP 318

Query: 289 -------GGVGDAEY--MWA-----FEQVVMPMSREFRP--DLVIISAGFDAADGDTIGQ 332
                    +    Y  ++A     F+   + M+++ +P   LV++SAGFDA++ + +  
Sbjct: 319 YETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSM 378

Query: 333 ----CHVSPSCYGHMTHMLKSLA----NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPP 384
                +V  S Y   T     LA    NG +  +LEGGY+  AIA    S    LIG   
Sbjct: 379 QRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIASGVFS---HLIGLQN 435

Query: 385 EELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419
           +  +      +  + +++ +++R     WK ++ R
Sbjct: 436 QNWI-----TEWGSAQVVKEIVRGCKPRWKPYKTR 465

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++A+  + + R     +RRI  +D+D+HH +G ++AF     V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMS 308
           IS+H  E G ++PGT  G   +   GK       +  PV  G+ D       ++V+MP  
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCI 329

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
           R   P++++I  G D   GD   +  ++      ++ ++++     N+ ++  GGYN   
Sbjct: 330 RSHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERL 389

Query: 368 IAR 370
           ++R
Sbjct: 390 MSR 392

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 98/211 (46%), Gaps = 16/211 (7%)

Query: 164 GGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVR 222
           G  +   K +     +   AV    G HH+    A GFC  +++ +  + +  N     +
Sbjct: 206 GATLSLAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYK 262

Query: 223 RIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNC 282
           RI  +D+D+HHG+G Q++F     V  IS H FE G ++P T      K G+        
Sbjct: 263 RITYIDFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCTGSLKESKMGKNI-----V 316

Query: 283 NITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH 342
           NI   + GV D       E+V++P  + + P++++I  G D   GD   +  +  + +G 
Sbjct: 317 NIPL-LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQL--TIHGL 373

Query: 343 MTHMLKSLANGNLCVVL---EGGYNLDAIAR 370
           + ++LK L     C V+    GGYN   ++R
Sbjct: 374 VNNILKLLRIFPGCPVVLLGGGGYNETVMSR 404

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 107/231 (46%), Gaps = 19/231 (8%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++A+  + + R     + +I  LD+D+HHG+G ++AF     V  
Sbjct: 224 HHAFKSKASGFCYVNDIAILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQT 280

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMS 308
           IS+H +E G ++PGT       T +    G N  +  PV  G+ D        +VV+P  
Sbjct: 281 ISIHMYEEG-FFPGTG------TLKDASSGRNI-VNIPVLHGMDDTFLNEVVNRVVIPCL 332

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
               P++VII  G D   GD   +  ++       +  +++   + N+ ++  GGYN   
Sbjct: 333 HNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKL 392

Query: 368 IAR--SALS---VAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYW 413
           ++R  + L+   V+K     P +   D   D  P+  E I+       K+W
Sbjct: 393 MSRFYTYLTWRIVSKYSENAPTDNPFDRHDDVIPDH-EFIDSYKDEFYKFW 442

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 92/183 (50%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  ++V +    I R     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLL---IQRLRKLKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMS 308
           IS+H +E G ++PGT  G  + +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDA 367
           +   P+++I+  G D   GD   +  ++       + +++KS    ++ ++  GGYN   
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYNDLL 380

Query: 368 IAR 370
           ++R
Sbjct: 381 MSR 383

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 14/209 (6%)

Query: 165 GAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPESVRR 223
           GA  +    ++   + + A+    G HH+    A GFC  +++ +  + I +N     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 224 IMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCN 283
           I  +D+D+HHG+G QKAF     V  +SLH FE G ++P T      K G          
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTGSLQEAKAGSSI------- 297

Query: 284 ITWPVGGVGDAEYMWAFEQ-VVMPMSREFRPDLVIISAGFDAADGDTIGQCHVS-PSCYG 341
           +  P+    D  ++    + +++P+  +  P++++I  G D   GD   +  ++     G
Sbjct: 298 VNIPLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 342 HMTHMLKSLANGNLCVVLEGGYNLDAIAR 370
            +  ++ +  + ++ ++  GGYN   ++R
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYNEKVMSR 386

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/323 (27%), Positives = 139/323 (43%), Gaps = 72/323 (22%)

Query: 113 SQEVLEVHSKEHLEFIESVTKMSHDELLK-------STETGDSVYFNNDSSSSAKLSCGG 165
           S  VL+VH ++    +  + K + ++L K       S  +GD +Y ++ +  + + S G 
Sbjct: 105 SPHVLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGD-IYLSSKTIEALQGSIGA 163

Query: 166 AIEACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
                 ++ EG     V N AF V+RPPGHH    +  GFCL +N  V+ +     Y   
Sbjct: 164 LETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--G 221

Query: 221 VRRIMILDWDIHHGNGTQ-------------------------KAFYDDDRVLYISLHRF 255
           +   ++LD+D+HHG+GTQ                         K F +  RV Y S+H  
Sbjct: 222 ITHAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDI 281

Query: 256 ELGKYYPGTAQGHYDKTGEG-KGEGFNCNITWPV-----------GGVGDAEY--MWA-- 299
                  G A     K+       G + NI W V             +  ++Y  ++A  
Sbjct: 282 NSFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKA 340

Query: 300 ---FEQVVMPMS---REFRPDLVIISAGFDAADGDTIG-QCH---VSPSCYGHMTHMLKS 349
              F+   + MS   ++F+  LV+ISAGFDA++ + +  Q H   V  + Y   T     
Sbjct: 341 DEFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALK 399

Query: 350 LAN----GNLCVVLEGGYNLDAI 368
           LA     G +  VLEGGY+  AI
Sbjct: 400 LAQMHSEGKVLSVLEGGYSDKAI 422

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 23/260 (8%)

Query: 162 SCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYPES 220
           +  GA  A    +     +A AV    G HH+    A GFC  +++A+  + + R   + 
Sbjct: 164 TVAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QG 220

Query: 221 VRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGF 280
             R+  +D+D+HHG+G + AF     V   SLH FE G ++PG        TG  K    
Sbjct: 221 FLRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTD 271

Query: 281 NCNITWP-VGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSC 339
           N  +  P + GV D+      + +V P  +   P+++II  G D   GD  G+  +  S 
Sbjct: 272 NSVLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SI 329

Query: 340 YGHMTHMLKSLAN---GNLCVVLEGGYNLDAIARSALSVAKVLIGEP---PEELLDPVKD 393
           +G   ++LK +       + ++  GGYN    +R    +  +L+ +    P E+ D  +D
Sbjct: 330 HGLTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDD-ED 388

Query: 394 PKPEAIEIINKVIRLQSKYW 413
                 E+I    +   K+W
Sbjct: 389 ELIRDHELIEMYEQEDYKFW 408

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 125/304 (41%), Gaps = 75/304 (24%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEG----RVKN-AFAVVRPPGHHS 192
           E+  S  +GD +Y ++++  + + S G       ++  G     + N AF  +RPPGHH 
Sbjct: 139 EVPDSWNSGD-IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHC 197

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ-------------- 238
              +  GFCL +N  +A +     Y   V   +ILD+D+HHG+GTQ              
Sbjct: 198 HVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDICWKRAGFKPDDG 255

Query: 239 -------KAFYDD--------DRVLYISLHRFELGKYYPGTAQGHYDKTGEGKG-----E 278
                  K  YDD         +V Y S+H       +P T  G+  K           +
Sbjct: 256 NVQDDEDKNEYDDFGKKMADFPKVGYFSMHDI---NSFP-TESGYATKDNIKNASTCVMD 311

Query: 279 GFNCNI------TWPV----GGVGDAEYMWAFEQV----------VMPMSREFRPDLVII 318
             + NI      TW        +   +Y   F +           +  M++ F+  LV+I
Sbjct: 312 AHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKPFK-GLVVI 370

Query: 319 SAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA----NGNLCVVLEGGYNLDAIAR 370
           SAGFDA++ + T  Q H   V  S Y   T     LA    NG +  VLEGGY+  AIA 
Sbjct: 371 SAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGGYSDKAIAS 430

Query: 371 SALS 374
              S
Sbjct: 431 GVFS 434

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 93/193 (48%), Gaps = 13/193 (6%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  +++ +    I +   +  +R+  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMS 308
           IS+H FE G ++P +     +K G+        NI  P+  G+ D        QVV+P++
Sbjct: 252 ISMHLFECG-FFPTSGSLEDNKKGKNIA-----NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
               P ++II  G D   GD   +  ++      ++  ++    N ++ ++  GGYN   
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIKGLCENILKIVNRYKNCSIVLLGGGGYNPTV 363

Query: 368 IARSALSVAKVLI 380
           ++R    +   LI
Sbjct: 364 MSRFYTYLTGKLI 376

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 97/214 (45%), Gaps = 15/214 (7%)

Query: 160 KLSCGGAIEACKAVVEGRVKNAFAVVRPPG-HHSEPESAGGFCLFSNVAVASKNILRNYP 218
           +++ G  +   K +V         +    G HH+  + A GFC  +++ +  + + +N  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 219 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGE 278
              ++I  LD+D+HHG+G +KAF     +  ISLH FE G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 279 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSP 337
           G    I  P+  G+ D       +Q+++P       + +++  G D   GD   +  ++ 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 338 SCYGH-MTHMLKSLANGNLCVVLEGGYNLDAIAR 370
                 +  ++   ++  + ++  GGYN   ++R
Sbjct: 356 KGLTQCIIDVIGKFSDCQIVLLGGGGYNELLVSR 389

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 155/370 (41%), Gaps = 75/370 (20%)

Query: 116 VLEVH-SKEHLEFIESVTKMSHDELLKS------TETGDSVYFNNDSSSSAKLSCGGAIE 168
           VL+VH S    E IE + +M+  +LLK       T     +Y ++ +  + + + G    
Sbjct: 110 VLKVHGSSWPAELIE-LCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 169 ACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRR 223
              ++ +G     + N AF  +RPPGHH    +  GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 224 IMILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLHRFELGK 259
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFP 286

Query: 260 YYPGTAQGHYDKTGEG-KGEGFNCNI------TWPVGGVGDAEY------MWA-----FE 301
              G A     K          + NI       W      +  Y      ++A     F 
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFR 346

Query: 302 QVVMPMSREFRP--DLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA---- 351
              + M+++ RP   LV+ISAGFDA++ + T  Q H   V  S Y   T     LA    
Sbjct: 347 SAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 352 NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSK 411
           +G +  ++EGGY+  AI     +    LIG   +   D VK+   E  +++ +++R    
Sbjct: 407 HGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQ---DWVKEWGSE--QVVKEIVRGCKP 458

Query: 412 YWKCFQRRHG 421
            WK ++ +  
Sbjct: 459 AWKPYKTKRA 468

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 95/368 (25%), Positives = 148/368 (40%), Gaps = 75/368 (20%)

Query: 116 VLEVH-SKEHLEFIESVTKMSHDELLKS------TETGDSVYFNNDSSSSAKLSCGGAIE 168
           VL+VH S    E IE + +M+  +LLK       T     +Y ++ +  + + + G    
Sbjct: 110 VLKVHGSHWPAELIE-LCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIET 168

Query: 169 ACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRR 223
              ++ EG     + N AF  +RPPGHH    +  GFCL +N  VA +     Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 224 IMILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLHRFELGK 259
           +++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFP 286

Query: 260 YYPGTAQGHYDKTGEG-KGEGFNCNI------TWPVGGVGDAEYMWAFEQVVMPMSREFR 312
              G A     K          + NI       W      +  Y   +  +       FR
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFR 346

Query: 313 P-------------DLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA---- 351
                          LV+ISAGFDA++ + T  Q H   V  S Y   T     LA    
Sbjct: 347 SAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 352 NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSK 411
           +G +  ++EGGY+  AI     +    LIG   +   D VK+   E  +++ +++R    
Sbjct: 407 HGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQ---DWVKEWGSE--QVVKEIVRGCKP 458

Query: 412 YWKCFQRR 419
            WK ++ R
Sbjct: 459 AWKPYKTR 466

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 89/183 (48%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++ +  +++ R   +  +R+  +D+D+H+G+G  KAF   + V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMS 308
           IS+H +E G ++PGT  G  ++T   K       +  PV  G+ D   +     V+ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDA 367
             F  + ++I  G D   GD   +  +S     H +  ++    +  + ++  GGYN   
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYNELL 361

Query: 368 IAR 370
           ++R
Sbjct: 362 VSR 364

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 151/381 (39%), Gaps = 90/381 (23%)

Query: 113 SQEVLEVHSKEHLEFIESVTKMSHD-------ELLKSTETGDSVYFNNDSSSSAKLSCGG 165
           S  VL+VH  +  + +  + K S         E+ +S   GD +Y +  + S+ + S G 
Sbjct: 106 SDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGD-IYLSRQTISALEGSIGA 164

Query: 166 AIEACKAV-----VEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
                 ++     VE     AF  +RPPGHHS   +  GFCL +N  +A +     Y   
Sbjct: 165 LETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--G 222

Query: 221 VRRIMILDWDIHHGNGTQ-------------------------KAFYDDDRVLYISLHRF 255
           V   ++LD+D+HHG+GTQ                         K F +  +V Y SLH  
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDI 282

Query: 256 ELGKYYPGTAQGHYDKTGEGKG-----EGFNCNITWPVG--------------------- 289
                +P T  G+  K           +  + NI W V                      
Sbjct: 283 ---NSFP-TELGYATKENVRNAATCIMDAHDVNI-WNVHLQSYDSDEAFTKLYQTKYRTL 337

Query: 290 -GVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQ----CHVSPSCYGHMT 344
               D EY    +Q +  + + F+  LV+ISAGFDA++ +         +V    Y   T
Sbjct: 338 FAKAD-EYFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFT 395

Query: 345 HMLKSLA----NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIE 400
                LA    +G L  VLEGGY+  AI+    +    LIG   +  ++     +  + +
Sbjct: 396 KDALKLAQMHSHGKLLSVLEGGYSDGAISSGVFA---HLIGLQNQNWIN-----EWGSAQ 447

Query: 401 IINKVIRLQSKYWKCFQRRHG 421
           ++ +++R     WK ++ +  
Sbjct: 448 VVKEIVRGCKPQWKPYKTKRA 468

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 151/371 (40%), Gaps = 77/371 (20%)

Query: 116 VLEVH-SKEHLEFIESVTKMSHDELLK-------STETGDSVYFNNDSSSSAKLSCGGAI 167
           VL+VH S    E IE + +M+  +LLK       +  +GD +Y ++ +  + + + G   
Sbjct: 110 VLKVHGSHWPTELIE-LCQMADAKLLKGEIEVPDTWNSGD-IYLSSKTIQALQGTIGAIE 167

Query: 168 EACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVR 222
               ++ +G     + N AF  +RPPGHH    +  GFCL +N  VA +     Y   V 
Sbjct: 168 TGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVT 225

Query: 223 RIMILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLHRFELG 258
            +++LD+D+HHG+GTQ                        K F +  +V Y S+H     
Sbjct: 226 HVVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINSF 285

Query: 259 KYYPGTAQGHYDKTGE-------------------GKGEGFNCNITWPVGGV-GDAEYMW 298
               G A     K                         E FN         +   A+  +
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFF 345

Query: 299 AFEQVVMPMSREFRPDLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA--- 351
              ++ M    +    LV+ISAGFDA++ + T  Q H   V  S Y   T     LA   
Sbjct: 346 KTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 352 -NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQS 410
            +G +  ++EGGY+  AI     +    LIG   +   D VK+   E  +++ +++R   
Sbjct: 406 CHGKVLSLMEGGYSDKAICSGVFA---HLIGLQNQ---DWVKEWGSE--QVVKEIVRGCK 457

Query: 411 KYWKCFQRRHG 421
             WK ++ R  
Sbjct: 458 STWKPYKTRRA 468

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  ++V +    I R     + +I  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLL---IQRLRKMKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQVVMPMS 308
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDA 367
           +   PD++II  G D   GD   +  ++       + +++K     ++ ++  GGYN   
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYNDLL 380

Query: 368 IAR 370
           ++R
Sbjct: 381 MSR 383

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  ++V +    I R     + +I  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLL---IQRLRKIKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMS 308
           IS+H +E G ++PGT  G  D +  GK       +  P+  G  D+       +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDA 367
            +  P+++II  G D   GD   +  ++       + + +K  +  ++ ++  GGYN   
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYNDLL 378

Query: 368 IAR 370
           ++R
Sbjct: 379 MSR 381

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 93/186 (50%), Gaps = 20/186 (10%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++ +  + + +   +   ++  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVMPMS 308
           ISLH +E G ++P T       + EG   GF+  +  P+  G+ D+      +QVV P+ 
Sbjct: 263 ISLHLYEPG-FFPCTG------SLEGS-SGFD-TVNLPLQHGLTDSFLQGLVDQVVNPLI 313

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVS----PSCYGHMTHMLKSLANGNLCVVLEGGYN 364
           +   P++++I  G D   GDT  +  +S      C   +  ++      ++ ++  GGYN
Sbjct: 314 QRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGGYN 370

Query: 365 LDAIAR 370
              ++R
Sbjct: 371 PTLMSR 376

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 80/346 (23%), Positives = 132/346 (38%), Gaps = 81/346 (23%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEG----RVKN-AFAVVRPPGHHS 192
           E+  S   GD +Y ++ +  + + S G       ++  G     + N AF  +RPPGHH 
Sbjct: 138 EVPASWNAGD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHC 196

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ-------------- 238
             ++  GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ              
Sbjct: 197 HVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAE 254

Query: 239 -----------KAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNIT-- 285
                      K F +  +V Y S+H       +P  +Q     T E       C +   
Sbjct: 255 PETTEGYDEFGKKFAEFPKVGYFSMHDI---NSFPTESQY---ATKENIRNASTCVMNAH 308

Query: 286 -----------WPVGGVGDAEYMWAFEQVVMPMSREFR-------------PDLVIISAG 321
                      W      D  Y   +  +       FR               LV+ISAG
Sbjct: 309 DVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQGLVVISAG 368

Query: 322 FDAADGDTIGQCHVSPSCYGHMTHMLKSLA--------NGNLCVVLEGGYNLDAIARSAL 373
           FDA++ +       S +   H   M    A        +G +  ++EGGY+  AIA    
Sbjct: 369 FDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIASGVF 428

Query: 374 SVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419
           S    LIG   +     +K+   E  +++ +++R    +WK ++ +
Sbjct: 429 S---HLIGLQNQNW---IKEWGSE--QVVKEIVRGCKPHWKPYKTK 466

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++ +  + + +   + + ++  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQVVMPMS 308
           IS+H +E G ++P T  G  + T  GK       +  P+  GV D        +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI-----VNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPS-CYGHMTHMLKSLANGNLCVVLEGGYNLDA 367
               P++++I  G D   GD   +  ++ S    ++ ++++     ++ ++  GGYN   
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYNELV 391

Query: 368 IAR 370
           ++R
Sbjct: 392 MSR 394

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (48%), Gaps = 13/183 (7%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+  + A GFC  ++V +    I R     + +I  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLL---IQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAF-EQVVMPMS 308
           IS+H +E G ++PGT         + + +    NI  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGTG-----SLSDSRKDKNVVNI--PLKHGCDDNYLELIASKIVNPLI 318

Query: 309 REFRPDLVIISAGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLANGNLCVVLEGGYNLDA 367
               P+ +II  G D   GD   +  ++       + +++KS    ++ ++  GGYN   
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLL 378

Query: 368 IAR 370
           ++R
Sbjct: 379 MSR 381

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 154/373 (41%), Gaps = 79/373 (21%)

Query: 113 SQEVLEVHS----KEHLEFI-ESVTKMSHD--ELLKSTETGDSVYFNNDSSSSAKLSCGG 165
           S  VL+VH     KE L+   +S  K++H   E+      GD +Y +  + ++ + S G 
Sbjct: 106 SPHVLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGA 164

Query: 166 AIEACKAVVEGR-----VKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
                 ++ +G         AF  VRPPGHHS   +  GFCL +N  +A +     +  +
Sbjct: 165 LETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--N 222

Query: 221 VRRIMILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLHRFE 256
           V   ++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDIN 282

Query: 257 LGKYYPGTAQGHYDKTGEG-KGEGFNCNITWPVG-----------GVGDAEYMWAFEQV- 303
                 G A     K          + NI W V             +  ++Y   F +  
Sbjct: 283 SFPTELGYATKENIKNASTCIMNAHDLNI-WNVHLSHYETEEDFVKLYQSKYRSLFAKAD 341

Query: 304 ---------VMPMSREFRPDLVIISAGFDAADGDTIG-QCH--VSPSCYGHM-----THM 346
                    +    ++F+  +V ISAGFDA++ +    Q H    P+C+ +M       +
Sbjct: 342 EFFKNAKKEMASQGKKFKGLVV-ISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKL 400

Query: 347 LKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVI 406
            +   +G +  V+EGGY+  AI+    S    LIG   +  ++     +  + +++ ++I
Sbjct: 401 AQMHTSGKVLSVMEGGYSDGAISSGVFS---HLIGLQNQNWIN-----EWGSAQVVKEII 452

Query: 407 RLQSKYWKCFQRR 419
           R     WK ++ +
Sbjct: 453 RGCKPQWKPYKTK 465

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 123/297 (41%), Gaps = 73/297 (24%)

Query: 181 AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ-- 238
           AF  +RPPGHH +  +  GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 239 -----------------------KAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275
                                  K F +  +V Y S+H       +P T  G+  K    
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDIN---SFP-TETGYATKVNIR 300

Query: 276 KG-----EGFNCNITW-----PVGGVGDAEYMWA-------------FEQVVMPMSREFR 312
                  +G + NI W     P     D + ++              F      M++E +
Sbjct: 301 NASTCIMDGHDLNI-WNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGK 359

Query: 313 P--DLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA----NGNLCVVLEGG 362
           P   LV+ISAGFDA++ + T  Q H   V  + Y   T     LA     G +  +LEGG
Sbjct: 360 PFKGLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGG 419

Query: 363 YNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419
           Y+  A+     +    LIG   +  ++          +++ +++R    +WK ++ +
Sbjct: 420 YSDKALTSGVFA---HLIGFQNQNWINEWGSE-----QVVKEIVRGCKPHWKPYKTK 468

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 174 VEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHH 233
           VE     AF  +RPPGHHS   +  GFCL +N  +A +     Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 234 GNGTQ 238
           G+GTQ
Sbjct: 234 GDGTQ 238

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 315 LVIISAGFDAADGDTIG----QCHVSPSCYGHMTHMLKSLA----NGNLCVVLEGGYNLD 366
           LV+ISAGFDA++ +         +V  S Y   T     LA    NG +  V+EGGY+  
Sbjct: 368 LVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSNGKIISVMEGGYSDG 427

Query: 367 AIARSALS 374
           AIA    S
Sbjct: 428 AIASGVFS 435

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 8/106 (7%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGR-----VKNAFAVVRPPGHHS 192
           E+ +S   GD +Y N+D+  + K S G       ++  G         AF  +RPPGHH 
Sbjct: 138 EVPESWNAGD-IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHC 196

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ 238
                 GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 197 HVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 122/294 (41%), Gaps = 72/294 (24%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRV-----KNAFAVVRPPGHHS 192
           E+ +S   GD +Y +  +  + + S G       ++  G         AF  +RPPGHHS
Sbjct: 140 EVPESWNVGD-IYLSQQTIGALEGSIGALETGIDSIFAGPTPEETSNRAFVALRPPGHHS 198

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ-------------- 238
              +  GFCL +N  +A +     Y  +V   ++LD+D+HHG+GTQ              
Sbjct: 199 HASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDICWKRAGFKPDEC 256

Query: 239 ----------KAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKG-----EGFNCN 283
                     K F +  +V Y S+H       +P T  G+  K           +  + N
Sbjct: 257 ADSGEFDEFGKKFAEYPKVGYFSVHDI---NSFP-TELGYATKENIRNAATCIMDAHDVN 312

Query: 284 ITWPV-----------GGVGDAEYMWAF----------EQVVMPMSREFRPDLVIISAGF 322
           I W V             +   +Y   F          +Q +  + + F+  LV+ISAGF
Sbjct: 313 I-WNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-GLVVISAGF 370

Query: 323 DAADGD--TIGQCHVSPSCYGHMTHMLKSL------ANGNLCVVLEGGYNLDAI 368
           DA++ +  ++ +  V+   + + T    +L      ++G +  V+EGGY+  AI
Sbjct: 371 DASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDGAI 424

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 15/138 (10%)

Query: 113 SQEVLEVHSKEHLEFIESVTKMSHDELLK-------STETGDSVYFNNDSSSSAKLSCGG 165
           S  V +VH KE  + +  + K + ++L K       S   GD +Y ++ +  + + + G 
Sbjct: 105 SPHVYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGD-IYLSSKTIQALQGTIGA 163

Query: 166 AIEACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPES 220
                 ++ +G     + N AF  +RPPGHH    +  GFCL +N  VA +     Y   
Sbjct: 164 LETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--G 221

Query: 221 VRRIMILDWDIHHGNGTQ 238
           V  + +LD+D+HHG+GTQ
Sbjct: 222 VTHVAVLDFDLHHGDGTQ 239

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 145/377 (38%), Gaps = 87/377 (23%)

Query: 113 SQEVLEVHSKEHLEFIESVTKMSHDELLK-STETGDS-----VYFNNDSSSSAKLSCGGA 166
           S  VL+VH  E    +  + K S  +L +   E  D+     +Y  + +  + + + G  
Sbjct: 103 SPHVLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAV 162

Query: 167 IEACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESV 221
                ++  G     + N  F  +RPPGHH    +  GFCL +N  +  +     Y   V
Sbjct: 163 ETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GV 220

Query: 222 RRIMILDWDIHHGNGTQ------------------------KAFYDDDRVLYISLHRFEL 257
              +ILD+D+HHG+GTQ                        K F +  +V Y S+H    
Sbjct: 221 THAVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINS 280

Query: 258 GKYYPGTAQGHYDKTGEGKGEGFNCNIT------WPV-----------GGVGDAEYMWAF 300
                G A      T E       C +       W V             +  ++Y   F
Sbjct: 281 FPTESGFA------TKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLF 334

Query: 301 EQV----------VMPMSREFRPDLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHM 346
            +           +  + + F+  LV+ISAGFDA++ + T  Q H   V  S Y   T  
Sbjct: 335 AKADEFFKNSKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKD 393

Query: 347 LKSLA----NGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEII 402
              LA     G +  +LEGGY+  AI     S    LIG   ++ ++        + +++
Sbjct: 394 ALKLAQMHCQGKVLSLLEGGYSDKAITSGVFS---HLIGLQNQDWINEWG-----SEQVV 445

Query: 403 NKVIRLQSKYWKCFQRR 419
            +++R     WK ++ +
Sbjct: 446 KEIVRGCKPSWKPYKTK 462

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 131/321 (40%), Gaps = 68/321 (21%)

Query: 113 SQEVLEVHSKEHLEFI-----ESVTKMSHDEL-LKSTETGDSVYFNNDSSSSAKLSCGGA 166
           S  VL+VH K+    +     E+  K++  E+ + ++     +Y ++ +  + + S G  
Sbjct: 103 SPHVLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGSIGAL 162

Query: 167 IEACKAVVEG----RVKN-AFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESV 221
             A  ++ +G     + N AF  +RPPGHH    +  GFCL +N  VA +     +   V
Sbjct: 163 ETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--GV 220

Query: 222 RRIMILDWDIHHGNGTQ-------------------------KAFYDDDRVLYISLHRFE 256
               ILD+D+HHG+GTQ                         K F +  RV Y S+H   
Sbjct: 221 THAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMHDIN 280

Query: 257 LGKYYPGTAQGHYDKTGEG-KGEGFNCNITW-----PVGGVGDAEYMWA----------- 299
                 G A     K          + NI W     P     D   ++            
Sbjct: 281 SFPTESGYATKENVKNASTCIMNAHDVNI-WNIHLSPWETEEDFAKLYHTKYRSLFVKAD 339

Query: 300 --FEQVVMPMSREFRP--DLVIISAGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLA 351
             F+Q  + M+ + +P   LV+IS+GFDA++ + T  Q H   V    Y   T     L+
Sbjct: 340 EFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLS 399

Query: 352 ----NGNLCVVLEGGYNLDAI 368
               +G +  ++EGGY+  AI
Sbjct: 400 QMHCHGKVLSIMEGGYSDKAI 420

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 115/275 (41%), Gaps = 46/275 (16%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESV---RRIMILDWDIHHGNGTQKAFYDDDR 246
           HH+    A GFC  +++ V+  N LR  P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 247 VLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQVVM 305
           +  IS+H FE G +YP T    + K         N  I  PV  G+ ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKFGKPKS------NNIINLPVKHGLSNSNMFELVTNIII 317

Query: 306 PMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLAN----------GNL 355
           P+    + D ++I  G D  + D   +  +  +  G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQL--TIIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 356 CVVLEGGYN--------------LDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAI-- 399
            ++  GGYN              +  +A      A  L  E P   +D   D   E +  
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTID---DKDKELLIK 432

Query: 400 --EIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMT 432
             E I++  +   KYW C++  +G  G +F++ + 
Sbjct: 433 DHEHIDEYEKEYYKYW-CYEIENGLDGLSFKRQIN 466

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEG----RVKN-AFAVVRPPGHHS 192
           E+  S  +GD +Y ++ +  + + S G    A  ++ +G     + N AF  +RPPGHH 
Sbjct: 137 EVPDSWNSGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHC 195

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ 238
              +  GFC+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 196 HFATPSGFCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 136/339 (40%), Gaps = 68/339 (20%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEG----RVKN-AFAVVRPPGHHS 192
           E+  +  +GD +Y ++ +  + + + G       ++ +G     + N AF  +RPPGHH 
Sbjct: 139 EVPDTWNSGD-IYLSSKTIKALQGTIGAIETGVDSIFKGPSPEHISNRAFVAIRPPGHHC 197

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ-------------- 238
              +  GFCL +N  VA +     Y  +V  +++LD+D+HHG+GTQ              
Sbjct: 198 HYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQDICWKRAGFKPEEE 255

Query: 239 ----------KAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGE-------------- 274
                     K F +  +V Y S+H         G A     K                 
Sbjct: 256 AKDTSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNV 315

Query: 275 -----GKGEGFNCNITWPVGGV-GDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGD 328
                   E FN         +   A+  +   +V M    +    LV+ISAGFDA++ +
Sbjct: 316 HLSKWTTEEEFNILYRTKYRTLFAKADEFFKSAKVEMKQQGKSFEGLVVISAGFDASEFE 375

Query: 329 -TIGQCH-VSPSCYGHMTHMLKSL------ANGNLCVVLEGGYNLDAIARSALSVAKVLI 380
            T  Q H V+   Y + T    +L       +G +  ++EGGY+  AI     +    LI
Sbjct: 376 QTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICSGVFA---HLI 432

Query: 381 GEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419
           G   ++ ++          +++ +++R     WK ++ R
Sbjct: 433 GLQNQDWVNEWGSE-----QVVKEIVRGCKPAWKPYKTR 466

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 88/199 (44%), Gaps = 26/199 (13%)

Query: 190 HHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLY 249
           HH+    A GFC  +++ +  + + +N      R+  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 250 ISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVG-----GVGDAEYMWAFEQVV 304
            SLH FE G ++PGT            G   NC  T  V      G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 305 MPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSL---ANGNLCVVLEG 361
           +P   +  P++++I  G D   GD   +  +  + +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQL--TIHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 362 GYNLDAIARSALSVAKVLI 380
           GYN    +R    V   L+
Sbjct: 357 GYNPTLQSRFYTYVTVCLL 375

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 138 ELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEG----RVKN-AFAVVRPPGHHS 192
           E+ K    GD +Y ++ + ++ + + G        +  G     + N  F VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 193 EPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQ 238
                 GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 557 VMSFMWDNYIRFFGSA-SKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPL 615
           V S +W  YI  F      + F+ VG+   G+      R T     +V N++A   +  L
Sbjct: 390 VWSLVW--YIAAFACGMGPVPFLMVGEVARGV-----ERATAQSYGTVCNWLATFAVGLL 442

Query: 616 IPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPR 653
            P+  + LG W F    V S    A W   E+  ++ +
Sbjct: 443 FPVAHDLLGGWVFAGFAVVSVA-FAWWARREHHAERSQ 479

>NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa]
           {ON} Anc_8.162
          Length = 352

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 19/119 (15%)

Query: 458 FGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKR---------DVIQGTI 508
           FG +  P      S   ++C      ++ I  L +  P  W K          D++Q  +
Sbjct: 236 FGLIGTP------SGRDLLCIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRML 289

Query: 509 --DPSASIITDAALA--FIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWD 563
             DP + I  + ALA  ++K   + N       IP+S FE D+Y  ++T +++   +W+
Sbjct: 290 IFDPRSRITAEEALAHPYLKTYHDPNDEPTGEPIPKSFFEFDSYKDVLTTKDLKKLLWN 348

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 522  FIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASK 574
            F+ W  + NYG   +   +++ E  +  + +T  + MS +W+NY R + + S+
Sbjct: 2574 FLNWIEKHNYGKFSLEDFKAITEMFSKGSDVTKGQSMSLIWENYRRDYPTTSQ 2626

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 44/112 (39%), Gaps = 31/112 (27%)

Query: 321 GFDAADGDTIGQCH-----VSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDA-------- 367
           G+D A  D +         +S    G   HM+ S   G  C+V E    +D+        
Sbjct: 870 GYDPATPDQLSSISEFFKIISAGLIGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYD 929

Query: 368 ------------IARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIR 407
                       I +SA+   KV +   PEEL+      +P+  E++ K++R
Sbjct: 930 TIELYLTSNSREIVKSAIGFTKVCVLGLPEELM------RPKVPELLLKLLR 975

>CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P38818 Saccharomyces cerevisiae
           YHR109w CTM1 cytochrome c methyltransferase
          Length = 551

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 211 KNILRNYPESVRRIMILDWDIHHGNGTQK-AFYDDDR-----VLYISLHRFELGKYYPGT 264
           +N + NY  +   + ILD+ ++HG+ T + A+YD DR     +LY+ L     GK  P T
Sbjct: 208 ENYMDNYVVTPSLVPILDY-VNHGDKTSRNAYYDVDRRKGDIILYLDLTVVNPGKLKPNT 266

>TBLA0B09500 Chr2 (2256700..2258943) [2244 bp, 747 aa] {ON}
           Anc_2.367 YMR154C
          Length = 747

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 525 WAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDAC 584
           W M+++Y  I  N     F    Y   I    + SF  D+Y RFF   SK+  + +G   
Sbjct: 216 WLMDQSYDTIGSNTAIDTFRLTGYLPEIIKPNIFSF--DDYFRFFN--SKLCLMALGTNM 271

Query: 585 S 585
           S
Sbjct: 272 S 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,714,893
Number of extensions: 3415238
Number of successful extensions: 9266
Number of sequences better than 10.0: 113
Number of HSP's gapped: 9254
Number of HSP's successfully gapped: 127
Length of query: 693
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 576
Effective length of database: 40,065,477
Effective search space: 23077714752
Effective search space used: 23077714752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)