Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H020002.286ON49849824010.0
KAFR0H033102.286ON48850017230.0
NDAI0G006602.286ON49649917160.0
Suva_14.3252.286ON49049616880.0
Skud_14.3072.286ON49049616760.0
TPHA0C034002.286ON49449816740.0
Kpol_1003.382.286ON49650016630.0
CAGL0M06941g2.286ON49250316460.0
SAKL0E07678g2.286ON47749716410.0
NCAS0G037902.286ON49249816420.0
YNL022C2.286ON49049616330.0
Smik_14.3092.286ON49049616000.0
TBLA0B069602.286ON50850916010.0
Kwal_27.115322.286ON47949615950.0
TDEL0G021702.286ON48449815810.0
KLLA0E08361g2.286ON49149915710.0
KLTH0G10362g2.286ON52949615710.0
ZYRO0A01892g2.286ON46549615010.0
Ecym_33252.286ON49649915000.0
ADL215W2.286ON48449714290.0
ADL254W2.247ON6032911662e-11
SAKL0E08624g2.247ON6112701615e-11
CAGL0J10032g2.247ON6192781608e-11
KLLA0F03399g2.247ON6192761609e-11
TPHA0H001508.171ON6493041591e-10
KNAG0I018702.247ON6292781591e-10
Kpol_1003.152.247ON6332911582e-10
Smik_14.2662.247ON6182911572e-10
YNL061W (NOP2)2.247ON6182781562e-10
NDAI0D010502.247ON6252781553e-10
NCAS0G030302.247ON4902781543e-10
TBLA0E038502.247ON6322921553e-10
KAFR0J009702.247ON6102781544e-10
Suva_14.2802.247ON6202911545e-10
TDEL0C041502.247ON6142891535e-10
ZYRO0A01562g2.247ON6172641537e-10
YBL024W (NCL1)8.171ON6843031537e-10
Ecym_32842.247ON6062781527e-10
TPHA0C031502.247ON6082161528e-10
KLTH0G09460g2.247ON6372781529e-10
Kwal_23.48412.247ON6272791501e-09
Smik_2.928.171ON6743031492e-09
NCAS0B056408.171ON6593031482e-09
Skud_14.2712.247ON6192701482e-09
Suva_2.978.171ON6703031473e-09
NDAI0B018308.171ON6863031402e-08
Kpol_1002.1098.171ON6703031376e-08
KNAG0G015108.171ON6662991358e-08
Skud_2.818.171ON6813031341e-07
KNAG0D020508.171ON6823031312e-07
NCAS0B043908.171ON6713001303e-07
TDEL0B043908.171ON6733041286e-07
ZYRO0G08998g8.171ON6833021278e-07
TPHA0C028708.171ON6743041252e-06
KLTH0H08096g8.171ON6883021252e-06
SAKL0H19448g8.171ON6913021242e-06
AFR179C8.171ON7002961232e-06
NDAI0B029808.171ON6793041232e-06
KAFR0B022208.171ON6863051232e-06
CAGL0K01991g8.171ON6722971206e-06
TBLA0A087408.171ON6863081206e-06
Ecym_23538.171ON6902971152e-05
KLLA0F12562g8.171ON7043041108e-05
Ecym_30036.1ON31977930.006
Kwal_14.20818.171ON27277820.14
KNAG0L024406.1ON31783820.17
Suva_16.396.1ON318105800.24
Skud_16.116.1ON318105800.27
Smik_6.4746.1ON318105800.27
YPL266W (DIM1)6.1ON318105800.30
Kpol_449.126.1ON31979800.30
KAFR0B064506.1ON31879790.40
SAKL0E00660g6.1ON32277780.49
ZYRO0F00308g6.1ON319105770.64
CAGL0L07678g6.1ON31777760.73
NDAI0A074403.277ON30996760.77
NCAS0D022506.1ON31977750.99
NCAS0I015903.277ON30950751.2
NDAI0I027106.1ON31977741.4
ACR026W6.1ON31977741.4
TBLA0A070806.1ON321105741.6
KLLA0D00594g6.1ON32077731.8
SAKL0D03014g3.277ON31587731.9
Suva_5.3058.237ON77794732.4
TDEL0G047006.1ON319105722.9
TPHA0J002006.1ON319105713.1
ZYRO0B11836g8.237ON77046723.6
Kwal_56.223176.1ON362153713.8
SAKL0H17776g8.237ON78446696.8
KLTH0C11704g6.1ON32277687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02000
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   929   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   668   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   665   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   654   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   650   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   649   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   645   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   638   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   636   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   637   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   633   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   620   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   621   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   619   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   613   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   609   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   609   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   582   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   582   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   555   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    69   2e-11
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    67   5e-11
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    66   8e-11
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    66   9e-11
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    66   1e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    66   1e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    65   2e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    65   2e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    65   2e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    64   3e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    64   3e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    64   3e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    64   4e-10
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    64   5e-10
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    64   5e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   7e-10
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    64   7e-10
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    63   7e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    63   8e-10
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    63   9e-10
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    62   1e-09
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    62   2e-09
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    62   2e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    62   2e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    61   3e-09
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    59   2e-08
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    57   6e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    57   8e-08
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    56   1e-07
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    55   2e-07
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    55   3e-07
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    54   6e-07
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    54   8e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    53   2e-06
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    53   2e-06
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    52   2e-06
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    52   2e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    52   2e-06
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    52   2e-06
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    51   6e-06
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    51   6e-06
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    49   2e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    47   8e-05
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    40   0.006
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    36   0.14 
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    36   0.17 
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.24 
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.27 
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    35   0.27 
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    35   0.30 
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    35   0.30 
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    35   0.40 
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    35   0.49 
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    34   0.64 
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    34   0.73 
NDAI0A07440 Chr1 complement(1697937..1698866) [930 bp, 309 aa] {...    34   0.77 
NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1 ...    33   0.99 
NCAS0I01590 Chr9 (294902..295831) [930 bp, 309 aa] {ON} Anc_3.27...    33   1.2  
NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1 ...    33   1.4  
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    33   1.4  
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    33   1.6  
KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}...    33   1.8  
SAKL0D03014g Chr4 complement(250066..251013) [948 bp, 315 aa] {O...    33   1.9  
Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W ...    33   2.4  
TDEL0G04700 Chr7 (858722..859681) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   2.9  
TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}...    32   3.1  
ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly...    32   3.6  
Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON...    32   3.8  
SAKL0H17776g Chr8 complement(1575666..1578020) [2355 bp, 784 aa]...    31   6.8  
KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly ...    31   7.2  

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/498 (91%), Positives = 456/498 (91%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKKSKILDEVPQKKGAPVFQR            SKSKRIQMGKHPIKMFVLKYKTR
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           LNAELAKMKVKLKVK              ITPVRWFRVNPLRCTAEKPVQSVVTELRKKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTD        
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
            LDAVP       LDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 481 PREDGGIGFFAVCFERTL 498
           PREDGGIGFFAVCFERTL
Sbjct: 481 PREDGGIGFFAVCFERTL 498

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/500 (64%), Positives = 390/500 (78%), Gaps = 14/500 (2%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE IE QD+KG++SGSLQ+LVL SC+++K+KTNPKHIYAV+ SCW+YKPF
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVM KS IL ++P+KKG PV+ R            SK KRIQMGKHPIK+FVL+YK+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++EL K+K+K KV+              ITPVRWFR+NPLRC       +V+ EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD---ASAVMKELEKKF 177

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
            ++V+SW+ +VPGSIY+DE+IP LF +HPQDKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +D +IDAC+APGNKTTH+A++MF +   D+   V+I+AFEKDPERA+VL KMIK+AGC
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD---VRIFAFEKDPERAKVLQKMIKVAGC 294

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           SK+I V VGDFTKLATP   P+V G IVDPSCSGSGIFGRKYIDS+N +K          
Sbjct: 295 SKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVD--- 351

Query: 361 XLDAVP--XXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENE 418
             + VP          + NL+ RLSKLSSFQFQ+VK+A+SFP+A ++VYSTCSIHAEENE
Sbjct: 352 --NGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENE 409

Query: 419 RVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIR 478
           RV +DLLLD+KVK+ GW++A R  VIP W RRG V EFQ++FR D  +S CQEMADGCIR
Sbjct: 410 RVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFR-DKTASECQEMADGCIR 468

Query: 479 ALPREDGGIGFFAVCFERTL 498
           ALPREDGGIGFFA+CFER +
Sbjct: 469 ALPREDGGIGFFAICFERDI 488

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/499 (64%), Positives = 393/499 (78%), Gaps = 6/499 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E Q+AKG++SGSLQTLVL SC ++K+K NPKH+YAV+ SCW+YKP+
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKKS ILD++P+KKG P++ R            SKSKRIQMGKHPIK +VLK+K+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++EL ++K+KLKVK              +TPVRW R+NPLRC   + V +V+ EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
            ++V++W D+VPGSIYYDEYIP+L+ +HPQDKITSHELYKQGKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             DDI+IDACAAPGNKTTH+A++MF D    E P VQIYAFEKDPERA++L KMIK+AGC
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGD-AKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           SK I+V VGDFTK ATP    +V G IVDPSCSGSGIFGRKY+DS+N ++ +        
Sbjct: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKK 359

Query: 361 XL---DAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417
                D VP         ++LKTRL+KLSSFQFQ++K+A+SFP A K+VYSTCSIHAEEN
Sbjct: 360 STEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419

Query: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477
           ERVV+DLLLD KVK+ GW+VA +  VIPTW RRG ++EF++VFR+D   + CQ +ADGCI
Sbjct: 420 ERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCI 477

Query: 478 RALPREDGGIGFFAVCFER 496
           RALPR+DGGIGFFAVCFER
Sbjct: 478 RALPRDDGGIGFFAVCFER 496

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/496 (62%), Positives = 391/496 (78%), Gaps = 7/496 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKK++IL+E+P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++E+ K+K+KLKV+              + PVRW R+NPL+C  +   + V+ EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           T+KVD+W ++VPGSIY+DEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
            S+DIVIDAC+APGNKTTH A+++F +   D+  K+QIYAFEKDPERA++L KMIK+AGC
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDK--KIQIYAFEKDPERAKILQKMIKVAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           S  I+V VGDFTKLATP+ C  V G IVDPSCSGSGIFGRK+ DS+N +K D        
Sbjct: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDD- 357

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
              AVP         + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 358 ---AVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERV 414

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLDK V+E GW+VA R++V+P+W RRG V+EF++VFR D  + + Q++A+GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFR-DGSAHDPQQLAEGCIRAL 473

Query: 481 PREDGGIGFFAVCFER 496
           P+EDGGIGFFAVCF R
Sbjct: 474 PKEDGGIGFFAVCFVR 489

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/496 (62%), Positives = 383/496 (77%), Gaps = 7/496 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCK++K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKK++IL+++P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++E+ K+K+KLKV+              + PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           T KV+ W D+VPGSIYYDEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
            +DDIVIDAC+APGNKTTH A+++      D    ++IYAFEKDPERA++L KM+K+AGC
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDN--IIRIYAFEKDPERAKILQKMVKVAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           S  I+V VGDFTKLATP  C    G IVDPSCSGSGIFGRK+ DS+N +K D        
Sbjct: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDN-- 356

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
             D +P         + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 357 --DVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLDK V+E GW+VAPR++VIP+W RRG V+EF +VFR D  + N +++A+GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFR-DGTAHNPRQLAEGCIRAL 473

Query: 481 PREDGGIGFFAVCFER 496
           P+EDGGIGFFAVCFER
Sbjct: 474 PKEDGGIGFFAVCFER 489

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/498 (62%), Positives = 384/498 (77%), Gaps = 4/498 (0%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E +DAKGK+SGS+Q++VL SCK +KV++NPKHIYAV++SCW+YKP+
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LE +MKKS IL+ +P+K G P F+R            SKSKRIQMGKHP+K +VLKYKT 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L +E+ K++VK+K+K              ITPVRWFR+NP+R    K V+ ++ EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +VD W  +  G+IY+DE+IPNLF VH +DKITSHELYKQGKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             DDIVID+CAAPGNKTTH AA++    + D+  K+QI+AFEKDPERA+VL KM++ AGC
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQ--KIQIHAFEKDPERAKVLQKMVRTAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           ++ IEV VGDFTK+ATP+   NV G IVDPSCSGSGIFGRK+ID++N KK          
Sbjct: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
                          D+LKTRLSKL+SFQFQ+VK+A++FP+A K+VYSTCSIHAEENERV
Sbjct: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLD+ +K++GWRVA R KVIPTW RRG VDEF++VFR+D E   C+E+A GCIRAL
Sbjct: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEE--KCKEIAGGCIRAL 476

Query: 481 PREDGGIGFFAVCFERTL 498
           P+EDGGIGFFAVCFER +
Sbjct: 477 PKEDGGIGFFAVCFERDI 494

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/500 (63%), Positives = 385/500 (77%), Gaps = 7/500 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           MDFYRD+TWVLE +E ++AK K+SGSLQ LVL SCK++KVK+NP+H+YA VSSCW+ KP+
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMK+S ILD++P KKG P F+R            SKSKRIQMGKHPIK ++LKYKTR
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++EL K+K+KLKV+              ITPVRW R+NP+R   +K ++ ++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +V+ W D+VPG+IY+D+YIPNLF VH +DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +DIVIDACAAPGNKTTH A+++      D+    QIYAFEKDPERA++L  MIK+AGC
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQ--TTQIYAFEKDPERAKILQHMIKVAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXX-XXXX 359
           S  I+V VGDFTK+ATP+   NV G IVDPSCSGSGIFGRKY+DSIN KK +        
Sbjct: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358

Query: 360 XXLDAVPXXXXXX--XLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417
              DAVP           D+LKTRLSKL+SFQFQ+VK+A+SFP+A K+VYSTCSIHAEEN
Sbjct: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418

Query: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477
           E VVIDLLLDKKV+E GW+VAPRS+VIPTW RRG   EF +VFR++ E   CQE+ADGCI
Sbjct: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEK--CQELADGCI 476

Query: 478 RALPREDGGIGFFAVCFERT 497
           R LP+EDGGIGFFAVCFER 
Sbjct: 477 RVLPKEDGGIGFFAVCFERN 496

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/503 (61%), Positives = 379/503 (75%), Gaps = 19/503 (3%)

Query: 1   MDFYRDATWVLESIENQDAK-GKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59
           M+FYRD+TWVLE +E Q  K G++SGSLQT+VL  CK++++KTNPKHIYA+VSSCW+YKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  FLEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKT 119
           +L+K+MKKS +LD +P+KKG P F +            SK+KRIQMGKHPIK +VLKYK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179
            LNAE  K+K+KLK+               +TPVRW R+NPLR +     Q V+ EL+KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQ-VLNELKKK 179

Query: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V++WKD++PGSIYYDE+IPNL+ +H  DKITSHELYKQGKIIIQDRASCFPAHILN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAG 299
           P +DD+VIDAC+APGNKTTH+AAH+F D        VQIYAFEKDPERAQ+L KMIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 300 CSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINH--KKTDXXXXX 357
           C K I+V VGDFT++ATP    +V G I+DPSCSGSGIFGRK +D +N+  KK++     
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSN----- 354

Query: 358 XXXXLDAVPXXXXXXXLDDN----LKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIH 413
                D VP         D+    LK RLSKL+SFQFQIV++A+SFP A K+VYSTCSIH
Sbjct: 355 -----DEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIH 409

Query: 414 AEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMA 473
           AEENERVVIDLLLDKKV+  GWRVA +  V+PTW RRG  +EFQ+VF + +E   CQE+A
Sbjct: 410 AEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQE-CQELA 468

Query: 474 DGCIRALPREDGGIGFFAVCFER 496
           DGC+RALP+EDGGIGFFAVCF R
Sbjct: 469 DGCVRALPKEDGGIGFFAVCFVR 491

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/497 (62%), Positives = 378/497 (76%), Gaps = 22/497 (4%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+ YRDATWV E +E +++KGK++GSLQTLVLNSCKR+K+KTNPKH+YA+V SCW+YKPF
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEK++KKS IL ++P+KKG P F              SK+KRIQMGKHPIK FVLK+K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L AELAK+KVKL+V               +TPVRW R+NP+RC  +  V  V  EL+KKF
Sbjct: 121 LQAELAKLKVKLRV--TNLSQLVKDDSNDMTPVRWIRINPVRCNGK--VDDVKGELQKKF 176

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             KV +W ++VPG+IY+DE+IPNLF VHP DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +D++ID+C+APGNKTTH+AAHMF  +   ++   QI+AFEKDPERA+ L KMI++AGC
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQK--QIHAFEKDPERAKTLQKMIQVAGC 294

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
            K IEV VGDFTKLA P     V G IVDPSCSGSGIFGRK ID  N+K           
Sbjct: 295 DKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKN---------- 344

Query: 361 XLDAVP-XXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENER 419
             + +P        +D +LKTRL+KLSSFQFQI+K+A+SFP A K+VYSTCSIHAEENER
Sbjct: 345 --EVLPEEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENER 402

Query: 420 VVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRA 479
           VVIDLLLD KV++ GWRV  R+ VIPTW RRG V+EFQQV+++  ++   QE+ADGCIRA
Sbjct: 403 VVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQA---QELADGCIRA 459

Query: 480 LPREDGGIGFFAVCFER 496
           LP+EDGGIGFFAVCFER
Sbjct: 460 LPKEDGGIGFFAVCFER 476

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/498 (64%), Positives = 393/498 (78%), Gaps = 8/498 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E +DAKG++SGSLQTLV  SCKR+K+K NPKH+YAV+ SCW+YKP+
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKKS ILDE+P++KG P++ R            SK+KRIQMGK PIK +VLK+K+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++EL K+K+KLKVK              +TPVRW R+NPLRC     V++   E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCD----VEATKLEIQKKF 176

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +V++W D+VPGSIYYDEYIPNLF +HPQDKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +D+VID CAAPGNKTTH A++M ++ + D  PK+QIYAFEK+PERA++L+KMIK+AGC
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKD--PKIQIYAFEKNPERAKILDKMIKVAGC 294

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           SK I++ VGDFTK+A P+   +V G IVDPSCSGSGIFGRK+IDS+N KK +        
Sbjct: 295 SKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKE 354

Query: 361 XLDAVPXXXXXXXLD--DNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENE 418
             +           +  ++LKTRLSKLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENE
Sbjct: 355 GDEEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENE 414

Query: 419 RVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIR 478
           RVVIDL+LD KVK+ GW+VAPRSKVIPTW RRG V+EF++VFRED  SS C+E+A GCIR
Sbjct: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIR 474

Query: 479 ALPREDGGIGFFAVCFER 496
           ALPR DGGIGFFAVCFER
Sbjct: 475 ALPRSDGGIGFFAVCFER 492

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 378/496 (76%), Gaps = 7/496 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKHIYAV+ SCW+YKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKK+ IL+++P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++E+ K+K+KLKV+              + PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           T KVD W ++VPGSIYYDE+IPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
              DIVID+C+APGNKTTH A++++ +   D     +IYAFEKDPERA+VL KMIKIAGC
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDN--NTRIYAFEKDPERAKVLQKMIKIAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           S  I V VGDFTKLATP+   +V   IVDPSCSGSGIFGRK+ DS N +K D        
Sbjct: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGG- 357

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
               VP         + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 358 ---IVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLDK V+E GW+VAP+ +VIP+W RRG V+EF++VFR D  + + Q++A+GCIRAL
Sbjct: 415 VIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFR-DGVTYDPQQLAEGCIRAL 473

Query: 481 PREDGGIGFFAVCFER 496
           P+ DGGIGFFAVCFER
Sbjct: 474 PKSDGGIGFFAVCFER 489

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/496 (62%), Positives = 383/496 (77%), Gaps = 7/496 (1%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE IE + AK ++SGS+QTLVL SCKR+K+K+NPKH+YAV+ SCW+YKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEKVMKK++IL+++P+KKG P+F R            SK KRIQMGKHPIK +VLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++E+ K+K+KLKV+              + PVRW R+NPL+C      + V+ ELRKKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           T KV+ W ++VP SIYYDEYIPNLF +HP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +DIVIDAC+APGNKTTH A+++  +   D   + +IYAFEKDPERA++L KMIKIAGC
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDS--RTRIYAFEKDPERAKILQKMIKIAGC 298

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           S  I+V VGDFTKLATP+   +  G IVDPSCSGSGIFGRK+ DS+N KK D        
Sbjct: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDI 358

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
               VP         + L+TRL+KLSSFQFQ+VK+A+SFP A K+VYSTCSIHAEENERV
Sbjct: 359 ----VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERV 414

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLDK V+E GWRVAPRS+VIP W RRG V+EF++VFRE + + + QE+A+GCIRAL
Sbjct: 415 VIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGA-AHDPQELAEGCIRAL 473

Query: 481 PREDGGIGFFAVCFER 496
           P++DGGIGFFAVCFER
Sbjct: 474 PKDDGGIGFFAVCFER 489

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/509 (60%), Positives = 380/509 (74%), Gaps = 12/509 (2%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E QD KG++SGSL +LV+ SCK+FK+++NPKH+YAVV S W++KPF
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           +E++M KS ILD++P+KKG P++QR            SKS+RIQMGKHPIK FVL YKTR
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LNAELAKMKVKLKVKXX----XXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTEL 176
           L++EL K+K+KLKV                   ITPVRW R+NP+R   +K    ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 RKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAH 236
           RKKFT KVD W  + PG IYYDEYIPNLF + P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILNPKSDDIVIDACAAPGNKTTHLAAHM--FQDKTADEKPKVQIYAFEKDPERAQVLNKM 294
           ILN   DD +IDACAAPGNKTTH+A+++    + T     K +++AFEKDPER+++L+KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 295 IKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKK--TD 352
           +KIAGC K +E+  GDFTK+ATP+  PNV G IVDPSCSGSGIFGRK+ID+IN  K  T+
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 353 XXXXXXXXXLDAVP---XXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYST 409
                       +P            D+L+TRLSKLSSFQFQ+VK+A+SFP A K+VYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 410 CSIHAEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNC 469
           CSIHAEENERVVIDLLLDKKVKE GW+V PRS  IPTWERRGLV EF+ VF+ D  + + 
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDP-AMDP 479

Query: 470 QEMADGCIRALPREDGGIGFFAVCFERTL 498
           +++A+GCIR LP+EDGGIGFFAVCFER +
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERNI 508

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 364/496 (73%), Gaps = 18/496 (3%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E  ++ G+++GSLQTLVLNSCK++ +KTNPKH+YA V SCWRY  F
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEK++KKS+IL +VP+KKG  +F              +K+KRIQMGKHP+K FVLK+KTR
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           LN+EL ++K+KLKV               +TPVRWFR+NP+RC  +   + V+ EL KKF
Sbjct: 121 LNSELVRLKIKLKV--TDLHQLLKDDRNDMTPVRWFRINPVRCHGKH--EEVMAELAKKF 176

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +VDSWKDVVPGSIY+DEYIPNLF VHP DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
              D++IDACAAPGNKTTH+AAHMF +   D+  +  I+AFEKDPERA+ L  M+K AGC
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN---DQPQEPLIHAFEKDPERAKTLRTMVKTAGC 293

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           SK I + VGDFTKLA P   PNV+G IVDPSCSGSGIFGR+ ID  N  + +        
Sbjct: 294 SKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEE 353

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
               +           ++K RL+KL+SFQF+IVKYALSFP A K+VYSTCSIHAEENER+
Sbjct: 354 ERQEIE--------GKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLD KVKE GWRV  R+  IPTW RRG   EF+ VFR   E    +E+A+ CIR  
Sbjct: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFR---EGDTAKELAEACIRVA 462

Query: 481 PREDGGIGFFAVCFER 496
           P+EDGGIGFFAVCFER
Sbjct: 463 PKEDGGIGFFAVCFER 478

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/498 (61%), Positives = 376/498 (75%), Gaps = 16/498 (3%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E +D KG+LSGS+QTLVL SC+R+K+K++PKH+YAVV SCWRYK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LEK+MK+SKI D++P+KKG P++ R            SK KRIQMGK PIK +VLK+KTR
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           LN+EL K+K+KLKVK              +TPVRW R+NPLRC  +  V+ V+ EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRC-PKNDVEPVLKELIKKF 179

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
            ++V  W D+  G++YYDE++PNLF VHP+DKITSHELY+QGKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +D+VIDACAAPGNKTTH+AAH+  + T ++ PK  IYAFEKDP RA +L KM  +AGC
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPK--IYAFEKDPARANILKKMTSVAGC 297

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSIN--HKKTDXXXXXX 358
            + +E+ VGDFTKLA P    +V GLIVDPSCSGSGIFGRK +DS N   KKT+      
Sbjct: 298 GQTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTET----- 352

Query: 359 XXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENE 418
               D+         + D++  RLSKL+SFQFQ+VK+A+S P A K+VYSTCSIHAEENE
Sbjct: 353 ----DSEIPDEEEKMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENE 408

Query: 419 RVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIR 478
           RVVIDLLLD+ +KE GW+VA R +VIP W RRG V EF+QVFR+D     C E+ADGCIR
Sbjct: 409 RVVIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDD--PVKCNELADGCIR 466

Query: 479 ALPREDGGIGFFAVCFER 496
           ALP+EDGGIGFFAVCF+R
Sbjct: 467 ALPQEDGGIGFFAVCFKR 484

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/499 (60%), Positives = 372/499 (74%), Gaps = 12/499 (2%)

Query: 1   MDFYRDATWVLESIENQDAKGK-LSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59
           M+FYRDATWVLE +E + +K K ++GSLQTLVL SCKR+K+KTNP+HIYA+VSS W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  FLEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKT 119
           +L+K++KKS IL++VP+KKG P+F +            SKSKRIQMGKHPIK F+LK++T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179
           RL AEL K+KVKLKV               +TPVRW R+NP+    ++    V+ EL KK
Sbjct: 121 RLKAELTKLKVKLKV-TSLSQLIKTDDGEDVTPVRWIRINPI--LVKERYDDVLAELNKK 177

Query: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F ++V+SWK +VPGSIYYDEYIPNLF +HP DKITSHE YK+GKIIIQDRASCFPAHILN
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEK-PKVQIYAFEKDPERAQVLNKMIKIA 298
           P S D+VIDACAAPGNKTTH+AAH+F D   D K   V+I+AFEKDPERA+ L  M+  A
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGD--VDTKVDSVKIHAFEKDPERAKTLQMMVATA 295

Query: 299 GCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXX-X 357
           GC+K +++ VGDFTKL  P+   NV G IVDPSCSGSGIFGRK ID +N  KT       
Sbjct: 296 GCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDE 355

Query: 358 XXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417
               ++ V         + +LK RL+KLSSFQ+QIVK+A+SFP A K+ YSTCSIHAEEN
Sbjct: 356 DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEEN 415

Query: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477
           ERVVIDLLLD KVKE GW+V  R+ VIPTW RRG   EF++VF ++      +E+A+GCI
Sbjct: 416 ERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAEGCI 471

Query: 478 RALPREDGGIGFFAVCFER 496
           RALP+EDGGIGFFAVCFER
Sbjct: 472 RALPKEDGGIGFFAVCFER 490

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 366/496 (73%), Gaps = 14/496 (2%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           M+FYRDATWVLE +E+ +  G+++GSLQTLVLNSCK++++KTNPKHIYA V SCWRY  F
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           L+K++K+S IL ++P+KKG  VF              SK+KRIQMGKHP+K FVLKYK R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L++EL ++K+KLKV               +TPVRWFR+NP+RC A+   + ++ EL KKF
Sbjct: 167 LSSELVRLKIKLKV--TDLQQLLKDDRNDMTPVRWFRLNPIRCGAKS--EDILQELSKKF 222

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +V+SW ++ PG IY+DEYIP LF VHP DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
            S+D++IDACAAPGNKTTH+AAH+FQD+  +    V+I+AFEKDPERA+ L  MI  AGC
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES---VRIHAFEKDPERAKTLRTMINTAGC 339

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
           +K IEV VGDFT+LA P   P+V G I+DPSCSGSGIFGRK ID  N  K D        
Sbjct: 340 TKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEE 399

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
             +           D +LK RL KL+SFQF+IVK+A+SFP A K+VYSTCS+HAEENER+
Sbjct: 400 EKEEEREDIS----DKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERI 455

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           V+DLLLD KVKE GWRV  R+ VIPTW RRG   EF++VFR++  +   +E+A+ CIR  
Sbjct: 456 VVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTA---KELAEACIRVA 512

Query: 481 PREDGGIGFFAVCFER 496
           P+EDGGIGFFAVCFER
Sbjct: 513 PKEDGGIGFFAVCFER 528

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 359/496 (72%), Gaps = 31/496 (6%)

Query: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60
           MDFYRD+TW+LE +E ++ KGKLSGSLQ+ VL +C ++KVK NPKHIYAVV+SCW+Y+ +
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKTR 120
           LE++M KS IL  +PQKKG P F R            SK KRIQMGKHPIK +VLKYKTR
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180
           L+AEL K+KVKLKVK               TPVRW R+NPL+C  + PV  VV +L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDA-TPVRWIRINPLKC--DIPV--VVEQLNKKF 175

Query: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +VD W  + PGSIYYDEY+PNLF +HP +KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
             +D+V+DACAAPGNKTTHLAAH+          + QI+AFEK+P RA+VL KM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXX 360
              +++ VGDFT+LA P    +V   +VDPSCSGSGIFGRK ++S N  +          
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ---------- 345

Query: 361 XLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420
                         D  L+ RLSKLSSFQFQ+VK+A+S P A K+VYSTCS+HAEENERV
Sbjct: 346 --------------DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV 391

Query: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480
           VIDLLLD KVKE GW+++PRS+V+PTW RRG+ +EF++VFR+D     CQ +A+ CIRAL
Sbjct: 392 VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRAL 449

Query: 481 PREDGGIGFFAVCFER 496
           PREDGGIGFFAVCF+R
Sbjct: 450 PREDGGIGFFAVCFQR 465

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/499 (59%), Positives = 365/499 (73%), Gaps = 20/499 (4%)

Query: 1   MDFYRDATWVLESIENQDAKG-KLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59
           M+FYRD++WVLE IE + +K  ++SGSLQTLVL SCKR+K+KTNPKHIYA+VSSCW+YK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  FLEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKT 119
           +LEK++K S +L +VP KKG PVF +            SK+KRI MGKHPIK FVLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179
           RL+ E  KM VKLKVK              ++PVRW R+NP RC  +  V  V+ ELRKK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDAD--MSPVRWIRINPFRCQGK--VDDVLKELRKK 189

Query: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F ++VD W  +VPGSIY DEYIPNL+ VHP DKITSHELYK+GKIIIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAG 299
           P   D+VIDAC+APGNKTTH+AAH+F D  A +   V+IYAFE+D +RA++L KM+  AG
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD---VKIYAFERDAKRAEILEKMVTSAG 306

Query: 300 CSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXX 359
           C   I++ VGDFT+LA PQ   +V G I+DPSCSGSGIFGR+ +D  N  K         
Sbjct: 307 CESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVP--- 363

Query: 360 XXLDAVPXXXXXXXLDDN--LKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417
              + V        ++ N   KTRL+KLSSFQFQIVK+A+SFP A K+VYSTCSIHAEEN
Sbjct: 364 ---NEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420

Query: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477
           ERVVIDLLLD+ +K+ GW+VA R  VIP W+RRG++ EF++VF  +      QE+ADGCI
Sbjct: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCI 476

Query: 478 RALPREDGGIGFFAVCFER 496
           RALP+EDGGIGFFAVCFER
Sbjct: 477 RALPKEDGGIGFFAVCFER 495

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 349/497 (70%), Gaps = 15/497 (3%)

Query: 1   MDFYRDATWVLESIENQDA-KGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59
           M+FYRDA+WVLE IE + A K K++GSL +LVL S K++K+K++ +H+YA+V+S W+YK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  FLEKVMKKSKILDEVPQKKGAPVFQRXXXXXXXXXXXXSKSKRIQMGKHPIKMFVLKYKT 119
           +L+++++KS +L +VP+KKG P F+R            SK KRI MGKHP+K FVLK++T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLNAELAKMKVKLKVKXXXXXXXXXXXXXXITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179
           RL  E AK  VKL V                TPVRW R+NP R   ++  + V+ EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDEREDA--TPVRWIRLNPFRIRGQR--EEVLQELQKK 176

Query: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V  W+++ PGSIY DEY+  L+ VHP DKITSHELYK+GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAG 299
           P   D++IDACAAPGNKTTH+AAH+F +  AD     QI+AFE+DP+RA+ L KMI  AG
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGADH---AQIHAFERDPQRAKTLRKMIATAG 293

Query: 300 CSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXX 359
           C   IEV VGDFT+ A P+   NV G IVDPSCSGSGIFGR+ +D+    +         
Sbjct: 294 CDNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSA 353

Query: 360 XXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENER 419
              +          ++  LK RL+KLSSFQFQIVK+A+SFP A K++YSTCS+HAEENER
Sbjct: 354 DVPEEETFEATKSAVE--LKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENER 411

Query: 420 VVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRA 479
           VVIDLLLD KV++ GW+VA RSKVIP W RRG   EF++VF + +E     E+A GCIR 
Sbjct: 412 VVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQAE-----ELAGGCIRV 466

Query: 480 LPREDGGIGFFAVCFER 496
           LP+EDGGIGFFAVCFER
Sbjct: 467 LPKEDGGIGFFAVCFER 483

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 117/291 (40%), Gaps = 64/291 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          + + 
Sbjct: 261 RTNTLKTRRRDLAQNLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------VGAT 306

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 307 PEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 358

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 359 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 415

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     +N  + D                               ++   Q Q++  A
Sbjct: 416 VIGKDQSVKVNRTEKD-----------------------------FMQIPHLQKQLILSA 446

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
           +    +       +VYSTCS+  EENE  V+D  L K    K+ E+G  + 
Sbjct: 447 IDSVDSNSKHGGVIVYSTCSVAVEENE-AVVDYALRKRPNVKLVETGLAIG 496

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 108/270 (40%), Gaps = 59/270 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 268 RTNTLKTRRRDLAQTLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 313

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P+ ++ ++D  AAPG KTT+++A M        K   
Sbjct: 314 PEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM--------KNTG 365

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC      IV ++     P+     + +++D  CSG+G
Sbjct: 366 CVFANDANKARTKSLIANIHRLGCHN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 422

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 423 VIGKDQSVKVSRTEKD-----------------------------FMQIPHLQKQLILSA 453

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVV 421
           +    A       +VYSTCS+  EENE VV
Sbjct: 454 IDSVDAHSKTGGVIVYSTCSVAVEENEAVV 483

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 115/278 (41%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+ +     Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 277 RTNTLKTSRRDLAQALVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 322

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P+ ++ V+D  +APG KTT+++A M        K   
Sbjct: 323 PEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM--------KNTG 374

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + + +R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 375 CVFANDANKKRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRVLLDAPCSGTG 431

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 432 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 462

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           +    A       +VYSTCS+  EE+E  V+D  L K+
Sbjct: 463 IDSVDANSKKGGVIVYSTCSVAVEEDE-AVVDYALRKR 499

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 112/276 (40%), Gaps = 56/276 (20%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 271 RTNTLKTRRRDLAQTLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 316

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P+ ++ ++D  AAPG KTT+++A M        K   
Sbjct: 317 PEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM--------KNTG 368

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 369 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 425

Query: 337 IFGRKYIDSINHKKTDXXX---XXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIV 393
           + G+     ++  + D            L A+        +D N KT             
Sbjct: 426 VIGKDQSVKVSRTEKDFMQIPHLQKQLLLSAI------DSVDSNSKT------------- 466

Query: 394 KYALSFPQATKVVYSTCSIHAEENERVVIDLLLDKK 429
                      +VYSTCS+  +ENE  V+D  L K+
Sbjct: 467 --------GGVIVYSTCSVAVDENE-AVVDYALRKR 493

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 127/304 (41%), Gaps = 61/304 (20%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L+ K    V+D CAAPG+KT  L   +  D    ++P   + A 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDS---DEPSGFVIAN 196

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGDF---------TKLATPQACPNVNGLIVDPSC 332
           + D +R+ +L   +K    S  + ++  D          TK A+ Q     + ++ D  C
Sbjct: 197 DADNKRSHLLVHQLKRLSTSN-VLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPC 255

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++   +  T                                 L + QF I
Sbjct: 256 SGDGTM-RKNVNVWKNWNTQNALG----------------------------LHNVQFNI 286

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSKVIP 445
           +   L+  + T K+VYSTCS++  ENE VV  +L     KV+    +   +   RSK + 
Sbjct: 287 LDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVLRKWGDKVRLVCCDDKLKGLIRSKGLT 346

Query: 446 TWE--RRGLVDEFQQVFREDSESSNC-----QEMA----DGCIRALPREDGGIGFFAVCF 494
           TW    R + +E  +   +D  + +C     +E++    D C+R  P +    GFF   F
Sbjct: 347 TWPVINRDM-EEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMF 405

Query: 495 ERTL 498
           E+ +
Sbjct: 406 EKVV 409

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 113/278 (40%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       QS+V   R    + + +W  V  G   +D  +P          I + 
Sbjct: 286 RTNTLKTRRRDLAQSLVN--RGVNLQPIGNWTKV--GLQIFDSQVP----------IGAT 331

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P+ ++ ++D  AAPG KTT+++A M        K   
Sbjct: 332 PEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM--------KNTG 383

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 384 CVFANDANKNRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 440

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 441 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 471

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           +    A       +VYSTCS+  EE+E  V+D  L K+
Sbjct: 472 IDSVDANSKKGGIIVYSTCSVAVEEDE-AVVDYALRKR 508

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 120/291 (41%), Gaps = 64/291 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   +    + + +W  V  G   +D  +P          I + 
Sbjct: 289 RTNTLKTRRRDLAQALVN--KGVNLQPIGAWTKV--GLQIFDSQVP----------IGAT 334

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G+ I+Q  +S  P   L+P+ ++ V+D  AAPG KTT+++A M        K   
Sbjct: 335 SEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM--------KNTG 386

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 387 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 443

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+    S+   +T+                               ++   Q Q++  A
Sbjct: 444 VIGKD--QSVKSSRTEKD---------------------------FIQIPHLQKQLLLSA 474

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
           +    A       +VYSTCS+  EE+E  V+D  L K    K+ ESG  + 
Sbjct: 475 IDSVDANSKTGGVIVYSTCSVAVEEDE-AVVDYALRKRPNVKLVESGLAIG 524

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 117/291 (40%), Gaps = 64/291 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 274 RTNTLKTRRRDLAQTLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 319

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 320 PEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 371

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 372 CVFANDANKSRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 428

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 429 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 459

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
           +     +      +VYSTCS+  EE+E  VID  L K    K+ E+G  + 
Sbjct: 460 IDSVDCNSKHGGVIVYSTCSVAVEEDE-AVIDYALRKRPNVKLVETGLAIG 509

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 112/278 (40%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 274 RTNTLKTRRRDLAQTLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 319

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 320 PEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 371

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 372 CVFANDANKSRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 428

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 429 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 459

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVVIDLLLDKK 429
           +     +      +VYSTCS+  EE+E  VID  L K+
Sbjct: 460 IDSVDCNSKHGGVIVYSTCSVAVEEDE-AVIDYALRKR 496

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 112/278 (40%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 281 RTNTLKTRRRDLAQALVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 326

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M    T       
Sbjct: 327 PEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGT------- 379

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 380 -VFANDANKNRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 435

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 436 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 466

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVVIDLLLDKK 429
           +     +      +VYSTCS+  EE+E  V+D  L K+
Sbjct: 467 IDSVDCNSKHGGIIVYSTCSVAVEEDE-AVVDYALRKR 503

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 112/278 (40%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 146 RTNTLKTRRRDLAQALVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 191

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 192 PEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 243

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 244 CVFANDANKNRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 300

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 301 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 331

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVVIDLLLDKK 429
           +     +      +VYSTCS+  EE+E  V+D  L K+
Sbjct: 332 IDSVDCNSKHGGVIVYSTCSVAVEEDE-AVVDYALRKR 368

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 120/292 (41%), Gaps = 64/292 (21%)

Query: 156 FRVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITS 215
            R N L+       Q++V   R    + + +W  V  G   +D  +P          I +
Sbjct: 287 IRTNTLKTRRRDLAQALVN--RGVNLQPIGAWTKV--GLQIFDSQVP----------IGA 332

Query: 216 HELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPK 275
              Y  G  I+Q  +S  P   L+P+ ++ V+D  +APG KTT+++A M        K  
Sbjct: 333 TPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM--------KNT 384

Query: 276 VQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGS 335
             I+A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+
Sbjct: 385 GCIFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGT 441

Query: 336 GIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKY 395
           G+ G+     ++  + D                               ++   Q Q++  
Sbjct: 442 GVIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLILS 472

Query: 396 AL-SFPQATK----VVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
           A+ S    +K    +VYSTCS+  EE+E  V+D  L K    K+ E+G  + 
Sbjct: 473 AIDSLDSNSKNGGVLVYSTCSVAVEEDE-AVVDYALRKRPNVKLVETGLAIG 523

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 114/278 (41%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + +W  V  G   +D  +P          I + 
Sbjct: 269 RTNTLKTRRRDLAQTLVN--RGVNLQPIGNWTKV--GLQIFDSQVP----------IGAT 314

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G+ I+Q  +S  P   L+P+ ++ ++D  +APG KTT+++A M        K   
Sbjct: 315 PEYLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALM--------KNTG 366

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 367 CVFANDANKNRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 423

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 424 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 454

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           +    A       +VYSTCS+  EE+E  V+D  L K+
Sbjct: 455 IDSVDANSKSGGVIVYSTCSVAVEEDE-AVVDYALRKR 491

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 117/291 (40%), Gaps = 64/291 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 276 RTNTLKTRRRDLAQTLVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 321

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 322 PEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 373

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 374 CVFANDANKSRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 430

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 431 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 461

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
           +     +      +VYSTCS+  EE+E  V+D  L K    K+ E+G  + 
Sbjct: 462 IDSVDCNSKHGGVIVYSTCSVAVEEDE-AVVDYALRKRPNVKLVETGLAIG 511

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 117/289 (40%), Gaps = 60/289 (20%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + SW  V  G   +D  +P          I + 
Sbjct: 271 RTNTLKTRRRDLAQALVN--RGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 316

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 317 PEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM--------KNTG 368

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  C+G+G
Sbjct: 369 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCTGTG 425

Query: 337 IFGRKYIDSINHKKTDXXX---XXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIV 393
           + G+     ++  + D            L A+        +D N KT             
Sbjct: 426 VIGKDQSVKVSRTEKDFIQVPHLQKQLLLSAI------DSVDSNSKT------------- 466

Query: 394 KYALSFPQATKVVYSTCSIHAEENERVVIDLLLDK----KVKESGWRVA 438
                      +VYSTCS+  EE+E +V+D  L K    K+ E+G  + 
Sbjct: 467 --------GGIIVYSTCSVAVEEDE-MVVDYALRKRPNVKLVEAGLAIG 506

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 111/264 (42%), Gaps = 62/264 (23%)

Query: 184 VDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNPKSD 243
           + SW  V  G   +D  +P          I +   Y  G  I+Q  +S  P   L+P+ +
Sbjct: 300 IGSWTKV--GLQIFDSQVP----------IGATPEYLAGNYILQAASSFLPVIALDPQEN 347

Query: 244 DIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGCSKE 303
           + ++D  AAPG KTT+++A M        K    ++A + +  R + L   I   GC+  
Sbjct: 348 ERILDMAAAPGGKTTYISALM--------KNTGCVFANDANKSRTKSLVANIHRLGCTN- 398

Query: 304 IEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXXXLD 363
              IV ++     P+     + +++D  CSG+G+ G+     ++  + D           
Sbjct: 399 --TIVCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD----------- 445

Query: 364 AVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYAL-SFPQATK----VVYSTCSIHAEENE 418
                               ++   Q Q++  A+ S    +K    +VYSTCS+  EE+E
Sbjct: 446 ------------------FMQIPHLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEEDE 487

Query: 419 RVVIDLLLDK----KVKESGWRVA 438
           +VV D  L K    K+ E+G  + 
Sbjct: 488 QVV-DYALRKRPNIKLIETGLAIG 510

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 115/303 (37%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT---DEPSGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNVNG------LIVDPSC 332
           + D  R+ +L   +K    S  + V+  D   F ++       N N       ++ D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNTQAGLG-LHAVQLNI 291

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L   +   ++VYSTCS++  ENE VV + L               L   ++  G  
Sbjct: 292 LNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVS 351

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W V  R+    T    G +D F     E++   N Q     C+R  P +    GFF   
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQ----NCMRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 112/278 (40%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + + +W  V  G   +D  +P          I + 
Sbjct: 263 RTNTLKTRRRDLAQTLVN--RGVNLQPIGTWTKV--GLQIFDSQVP----------IGAT 308

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P+ ++ ++D  AAPG KTT+++A M        K   
Sbjct: 309 PEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM--------KNTG 360

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 361 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 417

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           +  +     ++  + D                               ++   Q Q++  A
Sbjct: 418 VIAKDQSVKVSRTEKD-----------------------------FMQIPHLQKQLILSA 448

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           +    +       +VYSTCS+  EENE  V+D  L K+
Sbjct: 449 IDSVDSNSKTGGIIVYSTCSVAVEENE-AVVDYALRKR 485

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 93/216 (43%), Gaps = 46/216 (21%)

Query: 219 YKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQI 278
           Y  G+ I+Q  +S  P   L+P+ ++ V+D  AAPG KTT+++A M        K    +
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM--------KNTGCV 368

Query: 279 YAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIF 338
           +A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G+ 
Sbjct: 369 FANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTGVI 425

Query: 339 GRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYALS 398
           G+     ++  + D                               ++   Q Q++  A+ 
Sbjct: 426 GKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSAID 456

Query: 399 FPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
              A       +VYSTCS+  EE+E  V+D  L K+
Sbjct: 457 SVDANSKTGGFIVYSTCSVAVEEDE-AVVDYALRKR 491

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 111/278 (39%), Gaps = 60/278 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + +  W  V  G   +D  +P          I + 
Sbjct: 285 RTNSLKTRRRDLAQTLVN--RGVNLKPIGPWTKV--GLQIFDSQVP----------IGAT 330

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 331 PEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 382

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 383 CVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 439

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           +  +    S+   +TD                               ++   Q Q++  A
Sbjct: 440 VIAKD--QSVKVSRTDKD---------------------------FMQIPHLQKQLLLSA 470

Query: 397 LSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           +    A       +VYSTCS+  EENE  V+D  L K+
Sbjct: 471 IDSVDANSKTGGVIVYSTCSVAVEENE-AVVDYALRKR 507

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 110/279 (39%), Gaps = 60/279 (21%)

Query: 156 FRVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITS 215
            R N L+       Q++V   R    + +  W  V  G   +D  +P          I +
Sbjct: 282 IRTNSLKTRRRDLAQTLVN--RGVNLKPIGPWTKV--GLQIFDSQVP----------IGA 327

Query: 216 HELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPK 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K  
Sbjct: 328 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNT 379

Query: 276 VQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGS 335
             ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+
Sbjct: 380 GCVFANDANKARTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGT 436

Query: 336 GIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKY 395
           G+  +     ++  + D                               ++   Q Q++  
Sbjct: 437 GVIAKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLS 467

Query: 396 ALSFPQATK-----VVYSTCSIHAEENERVVIDLLLDKK 429
           A+    A       +VYSTCS+  EENE  VID  L K+
Sbjct: 468 AIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYALRKR 505

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 115/303 (37%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT---DEPSGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNVNG------LIVDPSC 332
           + D  R+ +L   +K    S  + V+  D   F ++       N N       ++ D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNTQAGLG-LHTVQLNI 291

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L   +   ++VYSTCS++  ENE VV + L               L   ++  G  
Sbjct: 292 LNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVS 351

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W V  R+    T    G ++ F     E++   N Q     C+R  P +    GFF   
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQ----NCMRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 117/303 (38%), Gaps = 63/303 (20%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L   + +D     +P   + A 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSN---EPTGFVVAN 195

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNVNGL------IVDPSC 332
           + D  RA +L   +K    S  + V+  D   F K+       N +G+      + D  C
Sbjct: 196 DSDSRRAYMLVHQLKRLN-SANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPC 254

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 255 SGDGTM-RKNVNVWK---------------------------DWNTQNALG-LHNVQLNI 285

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSKVIP 445
           +   L   +   ++VYSTCS++  ENE VV   L     K+K    ++  +   RS  I 
Sbjct: 286 LNRGLQLLKDNGRLVYSTCSLNPIENEAVVAAALRKWGNKIKLVDCQNKLQGLVRSNGIS 345

Query: 446 TWERRGLVDEFQQVFREDSESSNCQ--EMADG---------CIRALPREDGGIGFFAVCF 494
            W    + D       +DSES+     E  D          C+R  P +    GFF   F
Sbjct: 346 HW---SVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVF 402

Query: 495 ERT 497
           E+T
Sbjct: 403 EKT 405

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 107/270 (39%), Gaps = 59/270 (21%)

Query: 157 RVNPLRCTAEKPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSH 216
           R N L+       Q++V   R    + +  W  V  G   +D  +P          I + 
Sbjct: 275 RTNTLKTRRRDLAQTLVN--RGVNLQPIGPWTKV--GLQIFDSQVP----------IGAT 320

Query: 217 ELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKV 276
             Y  G  I+Q  +S  P   L+P  ++ ++D  AAPG KTT+++A M        K   
Sbjct: 321 PEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNTG 372

Query: 277 QIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSG 336
            ++A + +  R + L   I   GC+     IV ++     P+     + +++D  CSG+G
Sbjct: 373 CVFANDANKSRTKSLIANIHRLGCTN---TIVCNYDAREFPKVIGGFDRILLDAPCSGTG 429

Query: 337 IFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKYA 396
           + G+     ++  + D                               ++   Q Q++  A
Sbjct: 430 VIGKDQSVKVSRTEKD-----------------------------FIQIPHLQKQLLLSA 460

Query: 397 L-----SFPQATKVVYSTCSIHAEENERVV 421
           +     +      +VYSTCS+  EE+E VV
Sbjct: 461 IDSVDCNSKHGGVIVYSTCSVAVEEDEAVV 490

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 112/303 (36%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT---DEPSGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNG---------LIVDPSC 332
           + D  R+ +L   +K    S  + V+  D       +   N N          ++ D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNTQAGLG-LHTVQLNI 291

Query: 393 VKYALS-FPQATKVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L       ++VYSTCS++  ENE V+ + L               L   V+  G  
Sbjct: 292 LNRGLHLLKDGGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLSGLVRSKGVS 351

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W V  R+    T    G ++ F     E++   N Q     C+R  P +    GFF   
Sbjct: 352 KWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQ----NCMRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 115/303 (37%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDT---DEPTGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---------FTKLATPQACPNVNGLIVDPSC 332
           + D +R+ +L   +K    S  + V+  D          T     +     + ++ D  C
Sbjct: 202 DADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNTQGGLG-LHTVQLNI 291

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL------------------LDKKVKES 433
           +   L+  ++  ++VYSTCS++  ENE VV + L                  L +    S
Sbjct: 292 LNRGLNLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGSKIKLVNCDDKLVGLVRSKGIS 351

Query: 434 GWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W V  R+  +      G ++ +     E+ E  +     D CIR  P +    GFF   
Sbjct: 352 NWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHL----DSCIRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 122/303 (40%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHL--AAHMFQDKTADEKPKVQIY 279
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  L  A HM      D++P   + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHM-----EDDEPSGFVV 199

Query: 280 AFEKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPN------VNGLIVDP 330
           A + D +R+ +L   +K    S  + V+  D   F ++   +           + ++ D 
Sbjct: 200 ANDADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDV 258

Query: 331 SCSGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQF 390
            CSG G   RK ++                              D N ++ L  L + Q 
Sbjct: 259 PCSGDGTM-RKNVNVWR---------------------------DWNTQSGLG-LHTVQL 289

Query: 391 QIVKYALSF--PQATKVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSK 442
            I+   L    P+  ++VYSTCS++  ENE VV   L     K++    +       RSK
Sbjct: 290 NILNRGLHLLKPKG-RLVYSTCSMNPIENEAVVAAALRKWGDKIRLVNCDDKLPGLVRSK 348

Query: 443 VIPTW---------ERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            I TW         +++G  +  +  F    E +   +++  CIR  P +    GFF   
Sbjct: 349 GISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLS-SCIRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 115/299 (38%), Gaps = 57/299 (19%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +S+  V+D CAAPG+KT  L   + +D    ++P   I A 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDT---DEPTGIIVAN 215

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNV----NGLIVDPSCSG 334
           + D  R+ +L   +K    S  I V+  D   F  + T     N+    + ++ D  CSG
Sbjct: 216 DSDMRRSYLLVHQLKRLNSSN-ILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSG 274

Query: 335 SGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVK 394
            G   RK I+  N                           D   +  L  L   Q  I+ 
Sbjct: 275 DGTL-RKNINIWN---------------------------DWRFQNALG-LHRLQNNILN 305

Query: 395 YALSFPQ-ATKVVYSTCSIHAEENERVVIDLLLDKKVKESGWRVAP------RSKVIPTW 447
             L   +   ++VYSTCS++  ENE V+ + L +   + S            RS+ I +W
Sbjct: 306 RGLQLLRNGGRLVYSTCSMNPIENEAVIANALRNWAGEVSLVNFDDELPGLIRSRGISSW 365

Query: 448 ---------ERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVCFERT 497
                      RG  +     F   ++      + + CIR  P +     FF   FE+ 
Sbjct: 366 PVIDRNGEMRERGDPETLDSWFPPTADEQKTFNL-EKCIRVYPHQQDTGAFFIAVFEKN 423

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 113/303 (37%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT---DEPSGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPNVNG---------LIVDPSC 332
           + D  R+ +L   +K    S  + V+  D       +   N N          ++ D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNTQAGLG-LHTVQLNI 291

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L   ++  ++VYSTCS++  ENE V+ + L               L   ++  G  
Sbjct: 292 LNRGLHLLKSNGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLTGLIRSKGVS 351

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W V  R+         G ++ F     E++   N +     C+R  P +    GFF   
Sbjct: 352 KWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLK----NCMRVYPHQQNTGGFFISV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 113/303 (37%), Gaps = 65/303 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDT---DEPTGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNVNGL------IVDPSC 332
           + D  R+ +L   +K    +  I V+  D   F ++ T +     + L      + D  C
Sbjct: 202 DADNRRSHMLVHQLKRLNSANLI-VVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L   Q  I
Sbjct: 261 SGDGTM-RKNVNVWR---------------------------DWNTQNALG-LHQVQANI 291

Query: 393 VKYALS-FPQATKVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L    +  ++VYSTCS++  ENE VV   L               L   V+  G  
Sbjct: 292 LNRGLHLLKKGGRLVYSTCSMNPIENEAVVAQALRKWGDKVRLVNCDDKLPGLVRNKGIS 351

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVC 493
            W    R+       + G  D + Q   E++E    +     CIR  P +    GFF   
Sbjct: 352 KWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLE----NCIRVYPHQQNTGGFFITV 407

Query: 494 FER 496
           FE+
Sbjct: 408 FEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 116/300 (38%), Gaps = 59/300 (19%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L   + +D    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDT---DEPTGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACP------NVNGLIVDPSC 332
           + D  R+ +L   +K    S  + V+  D   F ++               + ++ D  C
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPC 260

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q+ I
Sbjct: 261 SGDGTM-RKNVNVWK---------------------------DWNAQGALG-LHTVQWNI 291

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSKVIP 445
           +   L   +   ++VYSTCS++  ENE VV   L     K++    +       RSK I 
Sbjct: 292 LNRGLHLLKPNGRLVYSTCSLNPIENEAVVAQALRKWGNKIRLVNCDEKLPGLVRSKGIS 351

Query: 446 TW-------ERRGLVDE--FQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVCFER 496
            W       E +   DE   +  F    E ++   + D CIR  P +    GFF   FE+
Sbjct: 352 QWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNL-DACIRVYPHQQNTGGFFITVFEK 410

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 115/304 (37%), Gaps = 66/304 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  +   + +D    ++P   + A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDT---DEPTGFVVAN 199

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQAC----PNV---NGLIVDPS 331
           + D +R+ +L   +K    S  + V+  D   F ++ +  A      NV   + ++ D  
Sbjct: 200 DADSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVP 258

Query: 332 CSGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQ 391
           CSG G   RK ++                  D  P                  L + QF 
Sbjct: 259 CSGDGTM-RKNVNVWR---------------DWTPQGGLG-------------LHTVQFN 289

Query: 392 IVKYALS-FPQATKVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG- 434
           I+   L       ++VYSTCS++  ENE VV + L               L   V+  G 
Sbjct: 290 ILNRGLHLLKNKGRLVYSTCSMNPIENEAVVAEALRKWGDKIRLVSCEDKLPGLVRSKGV 349

Query: 435 --WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAV 492
             W V  R+         G  D +     E++   N +     CIR  P +    GFF  
Sbjct: 350 SQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLE----NCIRVYPHQQNTGGFFIT 405

Query: 493 CFER 496
            FE+
Sbjct: 406 VFEK 409

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 117/302 (38%), Gaps = 63/302 (20%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L+ +    V+D CAAPG+KT  +  ++ +D   +++P   + A 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRD---NDEPSGFVVAN 198

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPN---------VNGLIVDPSC 332
           + D +R+ +L   +K    +  I V+  D       +A P+          + ++ D  C
Sbjct: 199 DADAKRSHMLVHQLKRLNSANLI-VVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPC 257

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++      T                                 L + Q  I
Sbjct: 258 SGDGTM-RKNVNVWRDWTTQNGLA----------------------------LHNVQLNI 288

Query: 393 VKYALS-FPQATKVVYSTCSIHAEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRG 451
           +   L       ++VYSTCS++  ENE VV + L     K    R+   S  +P   R  
Sbjct: 289 LNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGGKV---RLVDCSDKLPGLVRSN 345

Query: 452 LVDEFQQVFR--------EDSESSNC-----QEMA----DGCIRALPREDGGIGFFAVCF 494
            ++++  + R        ED  + +      +E A    D C+R  P +    GFF    
Sbjct: 346 GINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVL 405

Query: 495 ER 496
           E+
Sbjct: 406 EK 407

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 113/304 (37%), Gaps = 67/304 (22%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +S+  V+D CAAPG+KT  L   +    T +++P   + A 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEAL---HTNEDEPTGIVVAN 200

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPNVNG------LIVDPSC 332
           + D  R+ +L   +K    S  + V+  D   F ++A  +   + N       ++ D  C
Sbjct: 201 DADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPC 259

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                               D        L + Q  I
Sbjct: 260 SGDGTM-RKNVN----------------------------VWRDWTSQGGLGLHNIQLNI 290

Query: 393 VKYALSF--PQATKVVYSTCSIHAEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERR 450
           +   L    P+  ++VYSTCS++  ENE V+   L   +   S  RV    + +P   R 
Sbjct: 291 LNRGLHLLKPKG-RLVYSTCSMNPIENEAVIAAAL---RKWGSKIRVINCDEKLPGLVRS 346

Query: 451 GLVDEFQQVFRED------------------SESSNCQEMADGCIRALPREDGGIGFFAV 492
             +D +  VF  D                  SE    Q     CIR  P +     FF  
Sbjct: 347 KGIDSW-PVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFIT 405

Query: 493 CFER 496
             E+
Sbjct: 406 VIEK 409

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 122/302 (40%), Gaps = 66/302 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +S   V+D CAAPG+KT  +   +    +++++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALH---SSEDEPTGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPN---VNGLIVDPSCSGS 335
           + D  R+ +L   +K    S  + V+  D   F ++ T +        + ++ D  CSG 
Sbjct: 202 DADARRSHMLVHQLKRLN-SANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGD 260

Query: 336 GIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKY 395
           G   RK ++      T                                 L + Q  I+K 
Sbjct: 261 GTM-RKNVNVWKDWGTASGLG----------------------------LHTVQLNILKR 291

Query: 396 ALS-FPQATKVVYSTCSIHAEENERVVIDL---------LLDKKVKESGWRVAPRSKVIP 445
            L+   +  ++VYSTCS++  ENE VV            L+D   K  G     RSK I 
Sbjct: 292 GLNLLKKGGRLVYSTCSMNPIENEAVVAAALRQWGDKIKLVDCSDKLPG---LVRSKGIS 348

Query: 446 TWERRGLVDE-FQQVFREDSESS------NCQEMA----DGCIRALPREDGGIGFFAVCF 494
            W    ++D+ F++  + D  ++      + +E A    D CIR  P +    GFF    
Sbjct: 349 NWP---VIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVI 405

Query: 495 ER 496
           E+
Sbjct: 406 EK 407

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 113/302 (37%), Gaps = 66/302 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHL--AAHMFQDKTADEKPKVQIY 279
           G I  Q+  S  P  +L  K +  V+D CAAPG+KT  L  A H  +D     +P   + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQED-----EPTGFVV 199

Query: 280 AFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPN------VNGLIVDPSCS 333
           A + D +R+ +L   +K    S  + V+  D       ++ P+       + ++ D  CS
Sbjct: 200 ANDADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCS 258

Query: 334 GSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIV 393
           G G   RK ++      T                                 L + Q  I+
Sbjct: 259 GDGTM-RKNVNVWRDWGTASGLG----------------------------LHTVQLNIL 289

Query: 394 KYALS-FPQATKVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG--- 434
              L+      ++VYSTCS++  ENE V+   L               L   V+  G   
Sbjct: 290 NRGLNLLKDGGRLVYSTCSLNPIENESVIAAALRKWGDKIRLVNCDEKLPGLVRSKGITQ 349

Query: 435 WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVCF 494
           W V  ++  +      G++    + +   +E    +   + CIR  P +    GFF   F
Sbjct: 350 WPVYDKNFALKEKGDEGVI----ETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVF 405

Query: 495 ER 496
           E+
Sbjct: 406 EK 407

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 111/296 (37%), Gaps = 54/296 (18%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P ++L  +    V+D CAAPG+KT  L   +  +     +P   + A 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGP---EPSGFVVAN 202

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPN---VNGLIVDPSCSGS 335
           + D  R+ +L   +K    +  I V+  D   F ++ T +   +    + ++ D  CSG 
Sbjct: 203 DADYRRSHMLVHQLKRLNSANLI-VVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGD 261

Query: 336 GIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKY 395
           G   RK I+      T                                 L + Q  I+  
Sbjct: 262 GTM-RKNINVWKDWGTGSGL----------------------------GLHTVQLNILNR 292

Query: 396 ALS-FPQATKVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSKVIPTW- 447
            L+      ++VYSTCS++  ENE VV   L     K+K    +       RS  I +W 
Sbjct: 293 GLTLLKNGGRLVYSTCSLNPIENEAVVAAALRKWGAKIKLVNCDDQLLGLVRSTGISSWP 352

Query: 448 -------ERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAVCFER 496
                  E+    D     +   SE    +   + CIR  P +    GFF   FE+
Sbjct: 353 VLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 111/304 (36%), Gaps = 66/304 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L+ K    V+D CAAPG+KT  L   +  D     +P   + A 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGP---EPSGFVVAN 195

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATPQACPN----------VNGLIVDPS 331
           + D +R+ +L   +K    S  + V+  D       Q   N           + ++ D  
Sbjct: 196 DSDSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVP 254

Query: 332 CSGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQ 391
           CSG G   +    ++N  K                        D N +  L  L + Q  
Sbjct: 255 CSGDGTIRK----NVNIWK------------------------DWNTQNSLG-LHNVQLN 285

Query: 392 IVKYALSFPQA-TKVVYSTCSIHAEENERVVIDLL--LDKKVKE---------------- 432
           I+   +   ++  ++VYSTCS+   ENE V+   L     K+K                 
Sbjct: 286 ILNRGIQLLKSGGRLVYSTCSLSPIENEAVISATLRKWGNKIKLVDCKEMLPGLISSPGI 345

Query: 433 SGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFAV 492
           S W V  R+  I +       D + Q   E++   N       CIR  P +    GFF  
Sbjct: 346 SKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSH----CIRVFPHQQNTGGFFIA 401

Query: 493 CFER 496
             E+
Sbjct: 402 VLEK 405

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 117/305 (38%), Gaps = 69/305 (22%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHL--AAHMFQDKTADEKPKVQIY 279
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L  A HM  D     +P   + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTD-----EPTGFVV 200

Query: 280 AFEKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACP------NVNGLIVDP 330
           A + D  R+ +L   +K    S  + V+  D   F ++               + ++ D 
Sbjct: 201 ANDADSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDV 259

Query: 331 SCSGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQF 390
            CSG G   RK ++                              D N ++ L  L + Q+
Sbjct: 260 PCSGDGTM-RKNVNVWK---------------------------DWNTQSGLG-LHTVQY 290

Query: 391 QIVKYALSFPQA-TKVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG 434
            I+   L+  ++  ++VYSTCS++  ENE VV   L               L   V+  G
Sbjct: 291 NILNRGLNLLKSGGRLVYSTCSLNPIENEAVVAQALRTWGDKIKLVNCGDKLPGLVRSQG 350

Query: 435 ---WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFFA 491
              W V  R+         G ++ +     E++++ + +     CIR  P +    GFF 
Sbjct: 351 ISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLE----NCIRVYPHQQNTGGFFI 406

Query: 492 VCFER 496
              E+
Sbjct: 407 TVIEK 411

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 115/297 (38%), Gaps = 65/297 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KTT +   + +D    ++P   + A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDT---DEPTGFVVAN 199

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKL------ATPQACPNVNGLIVDPSC 332
           + D  R+ +L   +K    S  + V+  D   F ++      +  +A    + ++ D  C
Sbjct: 200 DADSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPC 258

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N +  L  L + Q  I
Sbjct: 259 SGDGTM-RKNVNVWK---------------------------DWNTQGALG-LHTVQLNI 289

Query: 393 VKYALSFPQAT-KVVYSTCSIHAEENERVVIDLL---------------LDKKVKESG-- 434
           +   L   Q   ++VYSTCS++  ENE VV + L               L   ++  G  
Sbjct: 290 LDRGLHLLQNNGRLVYSTCSMNPIENEAVVAEALRRWGDKVRLVDCSEKLPGLIRSQGIT 349

Query: 435 -WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIGFF 490
            W V  R+      E  G+++     +   SE    +   + C+R  P +    GFF
Sbjct: 350 QWPVIDRNMEERKKEDEGMINS----WFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 113/308 (36%), Gaps = 75/308 (24%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHL--AAHMFQDKTADEKPKVQIY 279
           G I  Q+  S  P  +L  K    V+D CAAPG+KT  +  A HM      + +P   + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHM-----ENAEPTGFVV 199

Query: 280 AFEKDPERAQVLNKMIKIAGCSK------------EIEVIVGDFTKLATPQACPNVNGLI 327
           A + D  R+ +L   +K    +              I++ VGD       +     + ++
Sbjct: 200 ANDSDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD----NKAKDALKFDRIL 255

Query: 328 VDPSCSGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSS 387
            D  CSG G   RK ++                              D N +  L  L +
Sbjct: 256 CDVPCSGDGTM-RKNVNVWK---------------------------DWNTQAGLG-LHT 286

Query: 388 FQFQIVKYALSFPQ-ATKVVYSTCSIHAEENERVVIDLL---------------LDKKVK 431
            Q+ I+   L   +   ++VYSTCS++  ENE VV   L               L   ++
Sbjct: 287 IQYNILNRGLHLLKTGGRLVYSTCSLNPIENEAVVARALRTWGSKIKIINCDDKLPGLIR 346

Query: 432 ESG---WRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRALPREDGGIG 488
            +G   W V  R+         G ++ +     E+  + N Q     C+R  P +    G
Sbjct: 347 SNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQ----NCMRVYPHQQNTGG 402

Query: 489 FFAVCFER 496
           FF    E+
Sbjct: 403 FFITVIEK 410

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 116/297 (39%), Gaps = 54/297 (18%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  L   +        +P   + A 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEAL---HAKGPEPSGFVVAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEVIVGD---FTKLATPQACPN---VNGLIVDPSCSGS 335
           + D  R+ +L   +K    +  I V+  D   F ++ T +   +    + ++ D  CSG 
Sbjct: 202 DADYRRSHMLVHQLKRLNSANLI-VVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGD 260

Query: 336 GIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQIVKY 395
           G   RK I+                               D        L + Q  I+  
Sbjct: 261 GTM-RKNIN----------------------------VWKDWATASGLGLHTVQVNILNR 291

Query: 396 ALS-FPQATKVVYSTCSIHAEENERVVIDLLL---DK-KVKESGWRVAP--RSKVIPTWE 448
            L+      ++VYSTCS++  ENE VV   L    DK K+ E G ++    RS+ I  W 
Sbjct: 292 GLNLLKDGGRLVYSTCSLNPIENEAVVAAALRKWGDKIKLVECGDKLPGLIRSQGISQWP 351

Query: 449 RRGLVDEFQQVFREDSESS----NCQEMA----DGCIRALPREDGGIGFFAVCFERT 497
                   +Q   E  ++S      +E++    + C+R  P +    GFF   FE+ 
Sbjct: 352 VYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEKA 408

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 117/304 (38%), Gaps = 66/304 (21%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAF 281
           G I  Q+  S  P  +L+ K    V+D CAAPG+KT  L   +  +    ++P   + A 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAES---DEPSGFVIAN 201

Query: 282 EKDPERAQVLNKMIKIAGCSKEIEV---------IVGDFTKLATPQACPNVNGLIVDPSC 332
           + D +R+ +L   +K    +  + V         I  D T+ +        + ++ D  C
Sbjct: 202 DADYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPC 261

Query: 333 SGSGIFGRKYIDSINHKKTDXXXXXXXXXLDAVPXXXXXXXLDDNLKTRLSKLSSFQFQI 392
           SG G   RK ++                              D N  + L  L   Q  I
Sbjct: 262 SGDGTM-RKNVNVWK---------------------------DWNTGSGLG-LHIVQLNI 292

Query: 393 VKYALS-FPQATKVVYSTCSIHAEENERVVIDLL--LDKKVK----ESGWRVAPRSKVIP 445
           ++  L+   +  K+VYSTCS++  ENE V+   L     KV+    +       RSK I 
Sbjct: 293 LERGLNLLKEGGKLVYSTCSLNPIENEAVIAAALRRWGDKVRLVNCDDQLPGLVRSKGIT 352

Query: 446 TWERRGLVDEFQQVFREDSESSNCQE-------------MADGCIRALPREDGGIGFFAV 492
            W+   + D+  QV  +  E  NC +               + C+R    +    GFF  
Sbjct: 353 EWK---VYDKQFQVREKGHE--NCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFIT 407

Query: 493 CFER 496
            FE+
Sbjct: 408 VFEK 411

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN TT +           EK + ++ A E DP  A  L K +     
Sbjct: 55  KPSDIVLEVGPGTGNLTTRIL----------EKAR-KVVAVEFDPRMAAELTKRVHGTAA 103

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+I+GDFTK   P
Sbjct: 104 EKKLEIILGDFTKTELP 120

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 222 GKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHL--AAHMFQDKTADEKPKVQIY 279
           G I  Q+  S  P  +L  +    V+D CAAPG+KT  +  A H  +D     +P   + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATED-----EPTGFVV 199

Query: 280 AFEKDPERAQVLNKMIK 296
           A + D  R+ +L   +K
Sbjct: 200 ANDADARRSHMLVHQLK 216

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 14/83 (16%)

Query: 235 AHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKM 294
           AHI   K  DIV++     GN T  +           EK K ++ A E DP  A  L K 
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRIL----------EKAK-KVVAVEMDPRMAAELTKR 97

Query: 295 IKIAGCSKEIEVIVGDFTKLATP 317
           +      K++++++GDF K   P
Sbjct: 98  VHGTPAEKKLDIMLGDFMKTELP 120

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D+V++     GN T  +           E
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL----------E 76

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + K  + A E DP  A  L K ++     K++E+++GDF K   P
Sbjct: 77  QAK-NVVAVEMDPRMAAELTKRVRGTPVEKKLEILLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D+V++     GN T  +           E
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL----------E 76

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + K  + A E DP  A  L K ++     K++E+++GDF K   P
Sbjct: 77  QAK-NVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D+V++     GN T  +           E
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL----------E 76

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + K  + A E DP  A  L K ++     K++E+++GDF K   P
Sbjct: 77  QAK-SVVAVEMDPRMAAELTKRVRGTQVEKKLEIMLGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D+V++     GN T  +           E
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL----------E 76

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + K  + A E DP  A  L K ++     K++E+++GDF K   P
Sbjct: 77  QAK-NVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 239 NPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIA 298
           N K  DIV++     GN T  +           E+ + ++ A E DP  A  L K +   
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRIL----------EQAR-KVVAVEMDPRMAAELTKRVHGT 102

Query: 299 GCSKEIEVIVGDFTKLATP 317
              K++E+++GDF K   P
Sbjct: 103 PAEKKLEIMLGDFMKTELP 121

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 239 NPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIA 298
           N K  D+V++     GN T  +           E+ + ++ A E DP  A  L K +   
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRIL----------EQAR-KVVAVEMDPRMAAELTKRVHGT 101

Query: 299 GCSKEIEVIVGDFTKLATP 317
              +++E+I+GDF K   P
Sbjct: 102 PAERKLEIILGDFMKTELP 120

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  D+V++     GN T  +           E+ + ++ A E DP  A  L K +     
Sbjct: 56  KPSDVVLEVGPGTGNLTVRIL----------EQAR-RVVAVEMDPRMAAELTKRVHGTAA 104

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 105 EKKLEILLGDFMKTELP 121

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D V++     GN T  +   +        
Sbjct: 39  ILKNPLVAQG---IVDKAQLRPS--------DTVLEVGPGTGNLTVRILEQV-------- 79

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
               + YA E DP  A  L K ++     +++E+++GDF K   P
Sbjct: 80  ---RKAYAVEMDPRMAAELTKRVRGTDGERKLEILLGDFIKTDLP 121

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN T  +           E+ + ++ A E DP  A  L K +     
Sbjct: 55  KPSDIVLEVGPGTGNLTVRIL----------EQAR-KVVAVEMDPRMAAELTKRVHGTPA 103

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 104 EKKLEIMLGDFMKTELP 120

>NDAI0A07440 Chr1 complement(1697937..1698866) [930 bp, 309 aa] {ON}
           Anc_3.277
          Length = 309

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 236 HILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDP----ERAQVL 291
           H L+  +   V+D CAAPG+ +  L+  +F D T +++ + +I A +  P    +    L
Sbjct: 37  HFLDDTNLKRVVDLCAAPGSWSQVLSKKLFNDTTLEQQNERKIVAVDLQPMSPIDHVVTL 96

Query: 292 NKMIKIAGCSKEIEVIVGDF-TKLATPQACPNVNGL 326
              I      K I  I G+           P+V GL
Sbjct: 97  QADITHPKTLKRILEIFGNEKADFVCSDGAPDVTGL 132

>NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN T  +           E+ + ++ A E DP  A  L K +     
Sbjct: 56  KPSDIVLEVGPGTGNLTVRIL----------EQAR-KVVAVEMDPRMAAELTKRVHGTPS 104

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 105 EKKLEILLGDFMKTDLP 121

>NCAS0I01590 Chr9 (294902..295831) [930 bp, 309 aa] {ON} Anc_3.277
           YBR061C
          Length = 309

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 236 HILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDP 285
           H L+  +   V+D CAAPG+ +  L+  +F  KTA+E    +I A +  P
Sbjct: 37  HFLDDPNLKRVVDLCAAPGSWSQVLSQKLFDGKTAEEIKDRKIVAVDLQP 86

>NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN T  +           E+ +  + A E DP  A  L K +     
Sbjct: 56  KPSDIVLEVGPGTGNLTVRIL----------EQAR-NVIAVEMDPRMAAELTKRVHGTPG 104

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 105 EKKLEIMLGDFMKTELP 121

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN T  +           E+ + ++ A E DP  A  L K +     
Sbjct: 55  KPSDIVLEVGPGTGNLTVRIL----------EQAR-KVVAVEFDPRMAAELTKRVHGTPA 103

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 104 EKKLEIMLGDFMKTELP 120

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        DIV++     GN T  +           E
Sbjct: 39  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL----------E 77

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + + ++ A E DP  A  L K +      K++++I+GDF K   P
Sbjct: 78  QAR-KVIAVEFDPRMAAELTKRVHGTPAEKKLDIILGDFMKTELP 121

>KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 320

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  DIV++     GN T  +           E+ + ++ A E DP  A  L K +     
Sbjct: 56  KPSDIVLEIGPGTGNLTVRIL----------EQAR-KVVAVEFDPRMAAELTKRVHGTPV 104

Query: 301 SKEIEVIVGDFTKLATP 317
            K++E+++GDF K   P
Sbjct: 105 EKKLEILLGDFMKTELP 121

>SAKL0D03014g Chr4 complement(250066..251013) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P38238 Saccharomyces
           cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
           methylates the 2'-O-ribose of nucleotides at positions
           32 and 34 of the tRNA anticodon loop
          Length = 315

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 246 VIDACAAPGNKTTHLAAHMFQDKTADE-KPKVQIYAFEKDP----ERAQVLNKMIKIAGC 300
           V+D CAAPG+ +  L+  +F ++  +E K   +I A +  P    +    L   I   G 
Sbjct: 45  VVDLCAAPGSWSQVLSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGT 104

Query: 301 -SKEIEVIVGDFTKLATPQACPNVNGL 326
            +K +E+  GD          P+V GL
Sbjct: 105 LAKILELFGGDKADFVCSDGAPDVTGL 131

>Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W
           (REAL)
          Length = 777

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 393 VKYALSFPQATKVVYSTCSIHAEENERVVIDL--LLDKKVKESGWRVAPRSKVIPTWERR 450
           + Y + +P+  K++Y  CS    E E+ +++L  L+D + KE G++   R   + + +  
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNL 114

Query: 451 GLVDEFQQVFREDSESSNCQEMADGCIRALPRED 484
            L  E  +  +       C+ M +G  R    ED
Sbjct: 115 CLHPEVSKERKGTVVDEKCRRMTNGQARRKAEED 148

>TDEL0G04700 Chr7 (858722..859681) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        D V++     GN T  +           E
Sbjct: 39  ILKNPLIAQG---IVDKAQIRPS--------DTVLEVGPGTGNLTVRIL----------E 77

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + K  + A E DP  A  L K +      +++E+++GDF K   P
Sbjct: 78  QAK-NVIAVEMDPRMAAELTKRVHGTPVERKLEILLGDFMKTELP 121

>TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}
           Anc_6.1 YPL266W
          Length = 319

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 22/105 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADE 272
           I  + L  QG   I D+A   P+        DIV++     GN T  +           E
Sbjct: 39  ILKNPLVAQG---IVDKAGIQPS--------DIVLEVGPGTGNLTVRIL----------E 77

Query: 273 KPKVQIYAFEKDPERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           + + ++ A E DP  A  L K +      K++++++GDF K   P
Sbjct: 78  QAR-KVVAVEMDPRMAAELTKRVHGTPGEKKLDILLGDFMKTDLP 121

>ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 770

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 393 VKYALSFPQATKVVYSTCSIHAEENERVVIDL--LLDKKVKESGWR 436
           + Y + +P+  K++Y  CS    E E+ +++L  L+D + KE G+R
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYR 100

>Kwal_56.22317 s56 complement(43543..44631) [1089 bp, 362 aa] {ON}
           YPL266W (DIM1) - dimethyladenosine transferase [contig
           186] FULL
          Length = 362

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 65/153 (42%), Gaps = 25/153 (16%)

Query: 167 KPVQSVVTELRKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQ--DKITSHELYKQGKI 224
           +P+ S+ T +  K  +K  S      G +  ++++ ++F  +      I  + L  QG  
Sbjct: 32  RPIISI-TAIMGKAPQKKYSGSAGTSGQVSAEKHLSSVFKFNTDLGQHILKNPLVAQG-- 88

Query: 225 IIQDRASCFPAHILNPKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKD 284
            I D+A   P+        D+V++     GN T  +           E+ + ++ A E D
Sbjct: 89  -IVDKAQIKPS--------DVVLEVGPGTGNLTVRIL----------EQAR-KVIAVEMD 128

Query: 285 PERAQVLNKMIKIAGCSKEIEVIVGDFTKLATP 317
           P     L K +      K++++++GDF K   P
Sbjct: 129 PRMGAELTKRVHGTSGEKKLDILLGDFMKTDLP 161

>SAKL0H17776g Chr8 complement(1575666..1578020) [2355 bp, 784 aa]
           {ON} highly similar to uniprot|P06839 Saccharomyces
           cerevisiae YER171W RAD3 5' to 3' DNA helicase involved
           in nucleotide excision repair and transcription subunit
           of RNA polymerase II transcription initiation factor
           TFIIH subunit of Nucleotide Excision Repair Factor 3
           (NEF3) homolog of human XPD protein
          Length = 784

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 393 VKYALSFPQATKVVYSTCSIHAEENERVVIDL--LLDKKVKESGWR 436
           V Y + +P+  KV+Y  CS    E E+ +++L  L+D + KE G+R
Sbjct: 57  VAYQMHYPEHRKVIY--CSRTMSEIEKALVELESLMDFRSKELGFR 100

>KLTH0C11704g Chr3 (966706..967674) [969 bp, 322 aa] {ON} highly
           similar to uniprot|P41819 Saccharomyces cerevisiae
           YPL266W DIM1 Essential 18S rRNA dimethylase responsible
           for conserved m6(2)Am6(2)A dimethylation in 3'- terminal
           loop of 18 S rRNA part of 90S and 40S pre- particles in
           nucleolus involved in pre-ribosomal RNA processing
          Length = 322

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300
           K  D+V++     GN T  +           E+ + ++ A E DP     L K +     
Sbjct: 56  KPSDVVLEVGPGTGNLTVRIL----------EQAR-KVIAVEMDPRMGAELTKRVHGTAG 104

Query: 301 SKEIEVIVGDFTKLATP 317
            K++++++GDF K   P
Sbjct: 105 EKKLDILLGDFMKTDLP 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,875,244
Number of extensions: 1918566
Number of successful extensions: 4624
Number of sequences better than 10.0: 97
Number of HSP's gapped: 4608
Number of HSP's successfully gapped: 119
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)