Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H019902.288ON97397350380.0
KAFR0H033002.288ON96696831430.0
NDAI0G006702.288ON96896831420.0
NCAS0G037802.288ON95797331070.0
Suva_14.3242.288ON96890430750.0
Smik_14.3082.288ON96592430730.0
YNL023C (FAP1)2.288ON96592630670.0
Skud_14.3062.288ON97092430370.0
TDEL0G021902.288ON93694329570.0
TBLA0B059502.288ON99592628410.0
CAGL0M06919g2.288ON95695228390.0
ZYRO0A01936g2.288ON95391127540.0
SAKL0E07634g2.288ON97492026830.0
KLTH0G10406g2.288ON96392026540.0
TPHA0D015302.288ON96290726410.0
Kpol_1039.452.288ON96891226400.0
Kwal_27.115182.288ON95392225520.0
KLLA0E08317g2.288ON92190423920.0
ADL213W2.288ON90890423290.0
Ecym_33272.288ON92688222480.0
YGL098W (USE1)6.164ON245112800.46
TBLA0A039308.322ON26677771.3
Kpol_1056.392.504ON9762711.7
NCAS0A098303.74ON28332752.6
KAFR0F002102.32ON70082735.1
Smik_7.1756.164ON245112709.2
TDEL0D008604.332ON45854719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H01990
         (973 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1945   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1215   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1214   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1201   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1189   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1188   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1186   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1174   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1143   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1098   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1098   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1065   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1038   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1026   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1021   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1021   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   987   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   926   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   901   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   870   0.0  
YGL098W Chr7 (317342..318079) [738 bp, 245 aa] {ON}  USE1Essenti...    35   0.46 
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...    34   1.3  
Kpol_1056.39 s1056 complement(95698..95955,96083..96118) [294 bp...    32   1.7  
NCAS0A09830 Chr1 complement(1964190..1965041) [852 bp, 283 aa] {...    33   2.6  
KAFR0F00210 Chr6 (55875..57977) [2103 bp, 700 aa] {ON} Anc_2.32 ...    33   5.1  
Smik_7.175 Chr7 (312660..313397) [738 bp, 245 aa] {ON} YGL098W (...    32   9.2  
TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.3...    32   9.7  

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1945 bits (5038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/973 (97%), Positives = 950/973 (97%)

Query: 1   MIADDGKPDPKSLVLNFSSDDEDSAXXXXXXXXXXXXXXXXXXXXXXXQDLPYYERAVRE 60
           MIADDGKPDPKSLVLNFSSDDEDSA                       QDLPYYERAVRE
Sbjct: 1   MIADDGKPDPKSLVLNFSSDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVRE 60

Query: 61  IAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYL 120
           IAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYL
Sbjct: 61  IAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYL 120

Query: 121 VNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTT 180
           VNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTT
Sbjct: 121 VNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTT 180

Query: 181 SVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENL 240
           SVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENL
Sbjct: 181 SVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENL 240

Query: 241 TVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQ 300
           TVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQ
Sbjct: 241 TVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQ 300

Query: 301 HSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKL 360
           HSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKL
Sbjct: 301 HSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKL 360

Query: 361 LKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRR 420
           LKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRR
Sbjct: 361 LKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRR 420

Query: 421 HKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHP 480
           HKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHP
Sbjct: 421 HKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHP 480

Query: 481 GKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACH 540
           GKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACH
Sbjct: 481 GKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACH 540

Query: 541 PLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQ 600
           PLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQ
Sbjct: 541 PLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQ 600

Query: 601 CQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTL 660
           CQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTL
Sbjct: 601 CQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTL 660

Query: 661 SSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEE 720
           SSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEE
Sbjct: 661 SSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEE 720

Query: 721 LQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYN 780
           LQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYN
Sbjct: 721 LQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYN 780

Query: 781 LYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTH 840
           LYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTH
Sbjct: 781 LYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTH 840

Query: 841 LINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPE 900
           LINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPE
Sbjct: 841 LINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPE 900

Query: 901 ENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDI 960
           ENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDI
Sbjct: 901 ENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDI 960

Query: 961 SERLETPEVQEQN 973
           SERLETPEVQEQN
Sbjct: 961 SERLETPEVQEQN 973

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1215 bits (3143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/968 (60%), Positives = 712/968 (73%), Gaps = 23/968 (2%)

Query: 8   PDPKSLVLNFSSDDEDSAXXXXXXXXXXXXXXXXXXXXXXXQDLPYYERAVREIAKGDLY 67
           PDPKSLVL FS DD  SA                        D+ YYERA++EIA GD Y
Sbjct: 19  PDPKSLVLEFSEDDTSSAASSDDEEMDVLSDN---------DDMMYYERAIQEIAAGDSY 69

Query: 68  TCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPT 127
            CMICTVEMDYTCKM+AC+KC R+FDYDC+REWA+KST+KT +RIWKCPNCY VNKKVPT
Sbjct: 70  ICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPT 129

Query: 128 KNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCG 187
           KNR TCWCGKVVNPE NPL+PNSCGQTC+A +CIHGCSKICHLGPHPECLRT ++KC CG
Sbjct: 130 KNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCG 189

Query: 188 KATKEIPCFETKGRRGR-NLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEGD 246
           K  ++I CF++K + GR N F C E C   L CGIH C+K CHSGLCGSCPE L V E  
Sbjct: 190 KHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEK 249

Query: 247 DVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEE 306
             +I CYCG  T+ S  CKDV      S++A G++W+GV++C  IR+VEYSC++HSF E 
Sbjct: 250 CATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVES 309

Query: 307 CIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKH 366
           C+APPTV+GTK+CPFSP  LKTC CG+TPL AL K R +C DP+P CE+ C+K LKCGKH
Sbjct: 310 CVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKH 369

Query: 367 TCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAER 426
            CPF CH+GPCMDPCIQIDK  C+C ++ FL PC F+G PHC +KCESL+SCRRH+C ER
Sbjct: 370 RCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTER 429

Query: 427 CCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPC 486
           CCSGRP AE+R+K   R  D+NDETL+EA+HVCLK CNL LSCG+H+CQRKCHPGKCPPC
Sbjct: 430 CCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPC 489

Query: 487 LESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPC 546
           LESDSNDLVCPCGKT+V APVRCGTKL  C  PCIKV+   S CGH P+PH+CHPLDQPC
Sbjct: 490 LESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPC 549

Query: 547 PPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCK 606
           PPCTATVFKPCKCGK  +VRT+CFQKDVSCG+ CG PL  CHH CQK CH  G+CQ  CK
Sbjct: 550 PPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGECQVKCK 609

Query: 607 QVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSSLFT 666
           QVC K  VNC H+C KSCHG   C D  C    KI CPCGR+E  VTC ATST+ S+   
Sbjct: 610 QVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALI 669

Query: 667 ERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGT-RLEGLASKATTFEELQFPF 725
            RL+C+EECE   RHR+L+EAFGI +K        E  GT RL+  A  AT +++LQ P+
Sbjct: 670 TRLDCNEECEVVKRHRELREAFGIVEK-----EEPENLGTERLQSFAQSATNYDDLQLPY 724

Query: 726 TESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEA 785
           TE  +  Y +Q  WC +IEE L  FMD+  + SLHFKPM+PPQR FI E+AKA+NLY+E+
Sbjct: 725 TEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAES 784

Query: 786 QDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVK 845
           QD EPKRSVF+KKNDDG+S KP   LS++ P+YQ+FK LEKERK + F A+TT  L+N+ 
Sbjct: 785 QDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNIT 844

Query: 846 LNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAI 905
           L+D +    +   +NN  +IKN+S G TL+ L   F K+ + TLI+NPQY  L  EN+ +
Sbjct: 845 LDDTLEERKKF--ENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQY--LIIENNGL 900

Query: 906 VYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDISERLE 965
           +YPE +  I+    ND++ LVGH N IV +  + DS E+C+  ++LPEE  E   + RLE
Sbjct: 901 IYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPEERLE---TPRLE 957

Query: 966 TPEVQEQN 973
           TP ++  +
Sbjct: 958 TPGLESDD 965

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1214 bits (3142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/968 (59%), Positives = 718/968 (74%), Gaps = 19/968 (1%)

Query: 8   PDPKSLVLNFSSDDEDSAXXXXXXXXXXX--XXXXXXXXXXXXQDLPYYERAVREIAKGD 65
           PDPKSL+L  S+D+  S+                         +D+ YYER ++EIAKGD
Sbjct: 13  PDPKSLILQASADEIKSSENVSSTSDNDEYDQEDEYAAATAADEDMKYYERTIQEIAKGD 72

Query: 66  LYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKV 125
            Y CMICTVEMDYTC+M+AC++CYRVFDYDC+REWA+KST+KTVDRIWKCPNCY VNKKV
Sbjct: 73  SYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKV 132

Query: 126 PTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCR 185
           P KNR TCWCGKVVNPE NPL+PNSCGQTC+AKIC+HGC+ ICHLGPHPEC R  S+ CR
Sbjct: 133 PPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCR 192

Query: 186 CGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEG 245
           CGK TK+I C+++K  +G + FQC + C   L CGIH+C++ CHSGLCG CPE L V E 
Sbjct: 193 CGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEE 252

Query: 246 DDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSF 303
           +   + CYCG  T+ S+KCKD+ +  + + S +A G++WIGV+ACK+IR+V+Y C +HSF
Sbjct: 253 NAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSF 312

Query: 304 FEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKC 363
            E CIAPPT++  K CP+SPK LKTC CGKTPLQ L K R  C DPIP CES C+K LKC
Sbjct: 313 IERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKC 372

Query: 364 GKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKC 423
           GKH CPF+CH G CMDPC+QI+  KC+CE+ +FLVPC F G+PHC +KCESL+SCRRH+C
Sbjct: 373 GKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRC 432

Query: 424 AERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKC 483
            ERCCSGRPAAE+R+K   R QD+ DETL+EAEH+CLK CNL LSCG H+CQRKCHPGKC
Sbjct: 433 LERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKC 492

Query: 484 PPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLD 543
           PPCLESDSNDLVCPCGKTIV APVRCGTKLP C   CIKVV     CGH P+PH CHPLD
Sbjct: 493 PPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLD 552

Query: 544 QPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQA 603
           +PCPPCTA VFKPCKCGK   VRT+CFQ DVSCG+ CG PL +C H C K CH+PG CQ 
Sbjct: 553 EPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQT 612

Query: 604 TCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSS 663
            CKQ+C K  +NC H C + CHG   CPD+ C    K+ C CGR+E  VTCGA S ++S+
Sbjct: 613 KCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASA 672

Query: 664 LFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEELQF 723
           + T  LECDEECE   RHRQLKEAFGI + +++ + +   E  RL+ +   A  FEELQ 
Sbjct: 673 VTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDL---EFERLKDIVPTAIAFEELQL 729

Query: 724 PFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYS 783
           PFTE+T+S + RQ +WC +IEE +N FMD++ + SLHFKPM+PPQR FI EL+KAYNLY 
Sbjct: 730 PFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYC 789

Query: 784 EAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLIN 843
           E+QDPEPKRSVF+KKN   +S+KP FSLS++ PLYQ+FK LEKERK+Q+F A+T+  L+N
Sbjct: 790 ESQDPEPKRSVFIKKN--TTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVN 847

Query: 844 VKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENS 903
           V++ +       +  + N FLIK++S GTT++DL+ +FG+Y++ TLI+NPQY  L +  S
Sbjct: 848 VEVPE--GPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKS 905

Query: 904 AIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDISER 963
            ++YPEDY TI+AN   D ++LVGH + +  D F+++  ELC     L         +ER
Sbjct: 906 GVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS--------TER 957

Query: 964 LETPEVQE 971
           L TP + E
Sbjct: 958 LATPAIDE 965

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/973 (61%), Positives = 732/973 (75%), Gaps = 24/973 (2%)

Query: 2   IADDGKPDPKSLVLNFSSDDEDSAXXXXXXXXXXXXXXXXXXXXXXXQDLPYYERAVREI 61
           I+   +PDPKSLVL  S DD +                           + YYERA++EI
Sbjct: 6   ISTGDEPDPKSLVLELSDDDSNGESGNSDSSEYESDFAGMDDDA-----MHYYERAIQEI 60

Query: 62  AKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLV 121
           AKGD Y CMICTVEMDYTC+M+AC++CYRVFDY+C+REWA+KST+KTVDRIWKCPNCY V
Sbjct: 61  AKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHV 120

Query: 122 NKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTS 181
           NKKVP KNRPTCWCGKVVNPEPNPL+PNSCGQTC+A  C+HGCSKICHLGPHPEC R  +
Sbjct: 121 NKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIIT 180

Query: 182 VKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLT 241
           +KCRCGK TK+I C+++   RG++ FQC+EPC   L CG+HRCQK CHSGLCG CPE L 
Sbjct: 181 IKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILN 240

Query: 242 VKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCR 299
            KE  D  I CYCG   R++IKC+DV+V  +   S+N  G++W+GV+ C +IR+V+Y C 
Sbjct: 241 TKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCH 300

Query: 300 QHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDK 359
           +HSF E+CIAPPT+ GTK CPFSPK LKTC CGKTPL+ L ++R++C DPIP C+SRC K
Sbjct: 301 EHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGK 360

Query: 360 LLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCR 419
            LKCG+HTCPF CH GPCMDPC+QIDK KC+C + +FLVPC F   P C  KCESL+SCR
Sbjct: 361 PLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCR 420

Query: 420 RHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCH 479
           RH+C ERCC+GRP AE R+K   R QD+ DE+L+E +H+CLK CNL LSCG+H+CQRKCH
Sbjct: 421 RHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCH 480

Query: 480 PGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHAC 539
           PGKCPPCLESDSNDLVCPCG+TI+ APVRCGTKLP C +PCIKVV G   CGH P+PH C
Sbjct: 481 PGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTC 540

Query: 540 HPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPG 599
           HPL++PCPPCTA+VFKPCKCGK  +VRT+CFQ DVSCG+ CG PL NC+H CQK CHL G
Sbjct: 541 HPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLG 600

Query: 600 QCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATST 659
           +CQ TCKQ+C K  +NC H C K CHG+  CPDI C   +KI C CGRKE  VTCGATST
Sbjct: 601 ECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATST 660

Query: 660 LSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFE 719
           + S+     +ECDEECE   RHRQLKEAFGI D  +N S   E E  +L+ LA  ATTFE
Sbjct: 661 IPSAATKTHIECDEECELLERHRQLKEAFGIVD--SNRSTSLEVE--KLKDLAKVATTFE 716

Query: 720 ELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAY 779
           ELQ P+ E+T+S Y +Q KWC +IEE LN  MD++ + SLHFKPM+PPQR FI+E AK++
Sbjct: 717 ELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSF 776

Query: 780 NLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTT 839
           NLY+EAQD EPKRSVFVKK +DGSS+KPI SL +  PLYQ+FK LEKERK+++F A+TTT
Sbjct: 777 NLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTT 836

Query: 840 HLINVKL-NDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQEL 898
            LINV+   +D    A++SG    FLIK IS GTT++DL+ +FG+++  TLI NPQY  +
Sbjct: 837 RLINVEAPQEDNVYHAKYSG----FLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLII 892

Query: 899 PEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISEN 958
            +   A++YPE+Y+ +SA    D+E LVGH +FI  + F+AD  ELCD    +       
Sbjct: 893 QDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAM------- 945

Query: 959 DISERLETPEVQE 971
            + ERLETP ++E
Sbjct: 946 -LGERLETPILEE 957

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1189 bits (3075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/904 (62%), Positives = 691/904 (76%), Gaps = 9/904 (0%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           D+ YYERA++EIAKGD Y CMICTVEMDYTC+MFAC+KCYRVFDY C+REWA+KST+KTV
Sbjct: 53  DMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 112

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
           D+IWKCPNCY + KKVPT+NRPTCWCGKVVNP+ NPLDPNSCGQTC+A  C+HGCSKICH
Sbjct: 113 DKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICH 172

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHPEC RT  +KCRCGK +K I C+++K  +    F C E C   L CGIH+C+K CH
Sbjct: 173 LGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKH--FDCQEECGLPLSCGIHKCKKKCH 230

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYA 287
           SGLCG CPE +  ++     I CYCG H+++SIKC +VN   +GR SK+ +G+EWIGV+A
Sbjct: 231 SGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFA 290

Query: 288 CKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCI 347
           CKDIR+V+Y+C +HSF E CI+PPTV G K CPF P  LKTC CG+T L+ L K R+ C 
Sbjct: 291 CKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCT 350

Query: 348 DPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPH 407
           DPIP C SRC K LKCGKH+CPF CHDG CMDPC+Q D VKCACE++TFLVPCGFQ  PH
Sbjct: 351 DPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPH 410

Query: 408 CQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTL 467
           C +KCESL+SCRRH+C +RCCSGRP+A ER+K   R QD+ DE+L+EA+H+CLK CNLTL
Sbjct: 411 CNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTL 470

Query: 468 SCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGI 527
           SCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKT++PAPVRCGTKLP C + CIKVV G 
Sbjct: 471 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGE 530

Query: 528 SECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNC 587
           SECGHKP+PH CHPLD  CPPCT TVFKPCKCGK  +VRT+CFQ DVSCG TCGKPL  C
Sbjct: 531 SECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGC 590

Query: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647
           HH CQKTCHLP  CQ  CKQ+C +   NC H C K CHGR  CPD+ C +LVKI C CGR
Sbjct: 591 HHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGR 650

Query: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
            E +V CGA S + S     +L+C+EECEA  R ++L+EAFGI+++ +N S   E +   
Sbjct: 651 IEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEE-SNESTNNELDT-- 707

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           L+ L S ATTFEELQ PFTE+ +S Y +Q  WC +IE  +N  M ++ +SSLHFKPM+PP
Sbjct: 708 LKKLVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPP 767

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR FIRELAKAYNLYSE+QD EP RSVF+KK D+  S++PI SL+E  PLY+SFK L+KE
Sbjct: 768 QRHFIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKE 827

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
           RK+Q+F A+TT  LIN ++ D  A       +NN FL++ +  G  + DL+  F  +++ 
Sbjct: 828 RKIQEFQARTTAKLINFEVRD--AEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKH 885

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL+  PQY  + +  +A+VYPE+Y+ +S N   DM+ LVGH +F+  +AFLADS  LC  
Sbjct: 886 TLVVKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSI 945

Query: 948 SSKL 951
             +L
Sbjct: 946 DEEL 949

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/924 (61%), Positives = 691/924 (74%), Gaps = 18/924 (1%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           D+ YYER+++EI+KGD Y CMICTVEMDYTC+MFAC++CYRVFDY C+REWAIKST+KTV
Sbjct: 49  DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTV 108

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
           DRIWKCPNCY V KKVP  NRPTCWCGKVVNP+PNPLDPNSCGQTC A ICIHGCSK CH
Sbjct: 109 DRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCH 168

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHPEC R   + C CGK ++ I C+++K  +    F+C E C   L C +H C++ CH
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKN--FKCQEECGLPLSCSVHNCKRKCH 226

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYA 287
           +GLCG CPE +T K+  +  I CYCG H+R SIKC +     +GR SK+ NG+EWIGV+A
Sbjct: 227 TGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFA 286

Query: 288 CKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCI 347
           C DIR+V++SCR+HSF E C++PP+V G K CPF P  LKTC CG+T L  L K R+ C 
Sbjct: 287 CTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCD 346

Query: 348 DPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPH 407
           DPIP C SRC K LKCGKH+CPF CHD  CMDPC+QID  KCACE++TF VPCGFQG P 
Sbjct: 347 DPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPR 406

Query: 408 CQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTL 467
           C +KCESL+SCRRH+C +RCCSGRP+A +RRKN  R QD+ DE+L+EA+H+CLK CNLTL
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTL 466

Query: 468 SCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGI 527
           SCG H+CQRKCHPGKCPPCLESDSNDL+CPCGKT+VPAPVRCGT+LP C HPCIKVV G 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGE 526

Query: 528 SECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNC 587
           S CGHKP+PH CHPL  PCPPCT TVFKPCKCGK  +VRT+CFQKDVSCG  CG  L  C
Sbjct: 527 SSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFC 586

Query: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647
            H CQKTCHLPG CQ  CKQ+C    ++C H C K CHG+  CPD+ C  LVKI C CGR
Sbjct: 587 RHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGR 646

Query: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
            E  VTC A S +  +  +  L+CDEECEA  R ++L+EAFGI ++  N ++    E   
Sbjct: 647 NEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTS---NELDA 703

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           L+ L S ATTFEEL  PFTE+T+S Y +Q +WC +IE  LN  MD++ +SSLHFKPM+PP
Sbjct: 704 LKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPP 763

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR FIRELAKAY LYSE+QD EP RSVF+KK D+G+S KP+ SL E  PLY+SFK L+KE
Sbjct: 764 QRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKE 823

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
           RK+Q+F ++TT  LIN ++ D  A       +NN FL++N+  G T++DLK  F  +++ 
Sbjct: 824 RKVQEFQSRTTAKLINFEVQD--AQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKH 881

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL+ NPQY  L +  +A+VYPE+Y T S N   DME LVGH +F+  +AFLADS  LC  
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCS- 940

Query: 948 SSKLPEEISENDISERLETPEVQE 971
                   ++ ++ +RL+TP +QE
Sbjct: 941 --------TDEEVGKRLDTPVIQE 956

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/926 (61%), Positives = 688/926 (74%), Gaps = 18/926 (1%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           D+ YYERA++EI+ GD Y CMICTVEMDYTC+MFAC++CYRVFDY C+REWA+KST+KTV
Sbjct: 49  DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTV 108

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
           DRIWKCPNCY V+K+VP KNRPTCWCGKVVNP+PNPLDPNSCGQTC+A  C+HGCSKICH
Sbjct: 109 DRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICH 168

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHPEC R   + C CGK +K I C+++K  +    F C E C   L C IH C+K CH
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKN--FNCQEVCGLPLSCSIHTCKKKCH 226

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYA 287
            GLCG CPE +  K+     I CYCG HTR +IKC +     +G+ SK+ NG+ WIGV+A
Sbjct: 227 PGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFA 286

Query: 288 CKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCI 347
           C D R V+YSCR+HSF E CI+PPT+ G K CPF P  LKTC CG+T L+ L K R+ C 
Sbjct: 287 CADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCD 346

Query: 348 DPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPH 407
           DPIP C+SRC K LKCGKH+CPF CHD  CM+PC+QID VKCACE++TF VPCGFQG P 
Sbjct: 347 DPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPR 406

Query: 408 CQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTL 467
           C +KCESL+SCRRH+C +RCCSGRP+A  R+KN  R QD+ DE+L+EA+H+CLK CNLTL
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTL 466

Query: 468 SCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGI 527
           SCG H+CQRKCHPGKCPPCLESDSNDLVCPCG T+VPAPVRCGTKLP+C HPCIKVV G 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGE 526

Query: 528 SECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNC 587
           S CGHKP+PH CH LD  CPPCT TVFKPCKCGK ++VRT+CFQ DVSCG  CG PL  C
Sbjct: 527 STCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYC 586

Query: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647
           +H CQKTCHLPG CQ  CKQ C +  +NC H+C K CHG+  CPD+ C  LVKI C CGR
Sbjct: 587 YHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGR 646

Query: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
            +  VTCGA S   S   +  L+C+EECEA  R ++LKEAFGI ++  N ++    E   
Sbjct: 647 IKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTS---NELDA 703

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           L+ L S ATTFEELQ PFTE+ +S Y +Q +WC +IE  LN  MD++ +SSLHFKPM+PP
Sbjct: 704 LKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPP 763

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR FIRELAKAY LYSE+QD EP RSVF+KK D+G+S KP+ SL+E  PLY+SFK L+KE
Sbjct: 764 QRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKE 823

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
           RK Q+F A+TT  LIN ++ D          + N FL++N+ AG T +DL+  F  +++ 
Sbjct: 824 RKAQEFQARTTAKLINFEVQD--TEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKH 881

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL+ NPQY  L +  +A+VYPE+Y T S N   DME LVGH +F+  +AFLADS  LC  
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCS- 940

Query: 948 SSKLPEEISENDISERLETPEVQEQN 973
                   +E ++  RL+TP +QE +
Sbjct: 941 --------TEEELERRLDTPVIQEDS 958

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1174 bits (3037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/924 (59%), Positives = 689/924 (74%), Gaps = 18/924 (1%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           DL YYERA++EIAKGD Y CMICTVEMDYTC+MFAC+KCYRVFDY C+REWA+KST+KTV
Sbjct: 54  DLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 113

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
           D+IWKCPNCY V KKVPT+NRPTCWCG VVNP+PN LDPNSCGQTC+A  C+HGC KICH
Sbjct: 114 DKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICH 173

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHPEC R   +KC CG+ +K I C+++K  R R  F C E C   L CG+H+C+K CH
Sbjct: 174 LGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHKCKKKCH 231

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYA 287
           SGLCGSCPE +   +     I CYCG H +NSIKC +     +GR SK+ +G+EW GV+A
Sbjct: 232 SGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFA 291

Query: 288 CKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCI 347
           C DIR+V+Y+C +HSF E C++PPT++G K CPF P  LKTC CG+T L+ L K R+ C 
Sbjct: 292 CADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCH 351

Query: 348 DPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPH 407
           DPIP C SRC K LKCGKH CPF CHDG CMDPC+QID   C+CE++TF +PCGFQ +P 
Sbjct: 352 DPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPR 411

Query: 408 CQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTL 467
           C +KCESL+SCRRH+C +RCCSGRP+A  R+K+  R QD+ DE+L+EA+H+CLK CNLTL
Sbjct: 412 CNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTL 471

Query: 468 SCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGI 527
           SCG H+CQRKCHPGKCPPCLESDSNDL+C CGKT+VPAPVRCGTKLP+C HPCIKVV G 
Sbjct: 472 SCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGE 531

Query: 528 SECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNC 587
           S CGHKP+PH CHP +  CPPCT TVFKPC+CGK  +VRT+CFQ DVSCG +CG PL  C
Sbjct: 532 SWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGC 591

Query: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647
           +H CQKTCHL G+CQ  CKQ+C +  ++C H C K CHG+  CPD+ C ALVKI C CGR
Sbjct: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651

Query: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
            +  +TC A     S + +  L+C+EECE   R ++L+EAFG+++   N   +   E   
Sbjct: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNN---VIRNELDA 708

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           L  L S A TFEELQ PFTE+T+S Y +Q +WC +IE  LN  MD+E +SSLHFKPM+PP
Sbjct: 709 LSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPP 768

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR FI E+AKAYNLY+E+QD EP RSVF+KK D+ +S KP+ SL+E  PLY+SFK  +KE
Sbjct: 769 QRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKE 828

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
           RK+Q+F A+TT  LIN ++ D  A     + +NN FL++N+ +G T++DLK  F  +++ 
Sbjct: 829 RKLQEFQARTTAKLINFEVQD--AESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKH 886

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL+ NPQY  L +  SA++YPE+Y T S N   DME LVGH +F+  +AFLADS  LC  
Sbjct: 887 TLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSV 946

Query: 948 SSKLPEEISENDISERLETPEVQE 971
                    + +I +RL++P +QE
Sbjct: 947 ---------DEEIGKRLDSPAIQE 961

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/943 (57%), Positives = 677/943 (71%), Gaps = 18/943 (1%)

Query: 12  SLVLNFSSDDEDSAXXXXXXXXXXXXXXXXXXXXXXXQDLPYYERAVREIAKGDLYTCMI 71
           SLVL FS DD D +                        D+ YYERAV+EIA GD Y CMI
Sbjct: 10  SLVLEFSEDDSDFSSESCSVHEVRDE-----------HDMAYYERAVQEIALGDRYVCMI 58

Query: 72  CTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPTKNRP 131
           CTVEMDYTCKM+AC  CYRVFDY+C+REWA+KST+KT+DR+WKCPNCY VNK+VP KNRP
Sbjct: 59  CTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRP 118

Query: 132 TCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCGKATK 191
           TCWCGK VNP+PNPLDPNSCGQTCDA IC HGCSK CHLGPHP+C+RT + KC+CGK T+
Sbjct: 119 TCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTR 178

Query: 192 EIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEGDDVSIS 251
           E  C++T   +G++ FQCNE C   L CGIH+C+++CHSG+CG CP  L  K  + + I 
Sbjct: 179 ETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK-SNKLKIR 237

Query: 252 CYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEECIAPP 311
           CYCG   R+S KCKDV V    SK+  GD WIG + C  IR +EY+CR+HSF E+C   P
Sbjct: 238 CYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPSP 297

Query: 312 TVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKHTCPFQ 371
           +++G   CPFSPK LKTC CG+T L+ L + R+ C  PIP+C+S C K L CG+HTCPF 
Sbjct: 298 SISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPFT 357

Query: 372 CHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAERCCSGR 431
           CHDGPCMDPCIQI+ V+C+C +N + VPC F+  P C  KCESL+SCRRH+C ERCC GR
Sbjct: 358 CHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCGR 417

Query: 432 PAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPCLESDS 491
           P AE RRK     +++ DE+ +E+EH+CLK CNLTLSCG H+CQRKCHPGKCPPCLESDS
Sbjct: 418 PFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLESDS 477

Query: 492 NDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPCPPCTA 551
           NDLVCPCGKT+V APVRCGT+LP C +PCI+V++   +CGHKP+PH CHPL++PCP CTA
Sbjct: 478 NDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSCTA 537

Query: 552 TVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCKQVCNK 611
            VFKPCKCGK  +VRT+CFQ DVSCG TCGKPL NC H CQK+CH+PG+CQ  CKQ+CN+
Sbjct: 538 PVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQICNR 597

Query: 612 PPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSSLFTERLEC 671
             + C HKCR  CHG   CPDI C   VKI+C C  KE  +TCGA S   S   T  L C
Sbjct: 598 KRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTILPC 657

Query: 672 DEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEELQFPFTESTIS 731
           DEECE + RH QL+EAFGI++   N S  K      LE LA+ A +FEEL+ PF+E  + 
Sbjct: 658 DEECERHKRHLQLREAFGISNFSDNPSRSK---TASLENLAAVANSFEELELPFSEPALG 714

Query: 732 TYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEAQDPEPK 791
           T+ +Q  WC +IE  LN+FMDNE K+SLHFKPM+P QR FI ELAK+YNLY E+QD EPK
Sbjct: 715 TFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPK 774

Query: 792 RSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVA 851
           RSVFVKK D+G S KP+  L +  P+YQ FK  EKE+K Q F A+TTT  +N    ++  
Sbjct: 775 RSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQ 834

Query: 852 TGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDY 911
                  +NNAF +KN+S GTT +DL+ +F  +++ TL++NPQ++      + ++YPEDY
Sbjct: 835 L---ERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDY 891

Query: 912 RTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEE 954
             IS N   D+E LVGH +++  ++F+ D  ELC    K+ +E
Sbjct: 892 AEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKVLQE 934

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1098 bits (2841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/926 (57%), Positives = 665/926 (71%), Gaps = 12/926 (1%)

Query: 49  QDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKT 108
           +DL YYERAVREIAKGD Y CMICTVEMD+TCKM+ACR CYRVFDYDC+REWA+KST KT
Sbjct: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126

Query: 109 VDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKIC 168
           VD+ WKCPNCY  +KKVP K+RPTCWCGKVVNP+PNPLDPNSCGQTC+A IC H C K C
Sbjct: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQC 186

Query: 169 HLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKIC 228
           HLG HPEC +   + CRCG+ TK+I C E+  RR +++F C++ C   LPCGIH+C++ C
Sbjct: 187 HLGSHPECTQLLKITCRCGRETKDIYCHES--RRQKSIFHCDQECGLTLPCGIHKCRRKC 244

Query: 229 HSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVY 286
           HSGLCGSCPE L + E     I CYCG H+   + CKDV    +G+ S+N    EW+G++
Sbjct: 245 HSGLCGSCPE-LLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIF 303

Query: 287 ACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRC 346
            CK++RSV Y+C +H F E CIAPPT+  T  CPFSP  LKTC CGKT LQ +   R +C
Sbjct: 304 DCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKC 363

Query: 347 IDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAP 406
            DPIP C++ C+K+LKCGKH CPF CH G CMDPCIQIDK+ CACER TFLVPC F+G P
Sbjct: 364 TDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKP 423

Query: 407 HCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLT 466
            C+ KCESL+SCRRH+C E CCSGRP AE R+K   R  D NDETL+EAEHVCLK CNL 
Sbjct: 424 VCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLK 483

Query: 467 LSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEG 526
           LSCG H CQRKCHPG CPPCLESDSNDLVCPCGKT++PAPVRCGT LP C++PCIKV+ G
Sbjct: 484 LSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRG 543

Query: 527 ISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPN 586
            S+CGHKP+PH+CH LDQPCP CTA VFKPCKCGK  +VRT+CFQ+DVSCG  CG PL +
Sbjct: 544 ESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKD 603

Query: 587 CHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCG 646
           C+H CQK CHLPG+CQ TC Q+CN    NC+H C + CH    CPDI C   V + C CG
Sbjct: 604 CYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCG 663

Query: 647 RKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGT 706
           R+++   C +TST+ S   T  LECDEEC    R  +LK AFGI + + +       E  
Sbjct: 664 RRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIE-- 721

Query: 707 RLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKP 766
           R++   S A  +EEL+ PF E+ ++ Y +Q KWC +IE  LN FMD + KSSLHFK MK 
Sbjct: 722 RIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKA 781

Query: 767 PQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEK 826
           PQR F+  LA AY +YSE+QDPEP RSVFVKK  +G+S+KPI +L E  PLY+SFK ++K
Sbjct: 782 PQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQK 841

Query: 827 ERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYME 886
           E+K Q++ A+T   LINV+         Q + + N FLIKN+  GTT +DL+ +FG+ ++
Sbjct: 842 EKKKQEYEARTHKTLINVEAE---TQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLK 898

Query: 887 KTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCD 946
            TL+++PQY  + E +   + P DY  IS N   DME L+G  + +  + F+ D  ELC+
Sbjct: 899 PTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCN 958

Query: 947 ASSKLPEEIS--ENDISERLETPEVQ 970
               L +E    E+   E+L +PEV+
Sbjct: 959 IDEALLQENVDLEDSEEEKLTSPEVE 984

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/952 (57%), Positives = 662/952 (69%), Gaps = 15/952 (1%)

Query: 5   DGKPDPKSLVLNFSSDDEDSAXXXXXXXXXXXXXXXXXXXXXXXQDLPYYERAVREIAKG 64
           D  PD  SLV+  S D+ +                         +D+ YYE+AV+EI KG
Sbjct: 17  DDHPDNSSLVIGLSEDESE----IETNMGAELSEELSDLDEGDEKDMAYYEKAVQEIVKG 72

Query: 65  DLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKK 124
           D Y+C+ICTVE+DYTCK++AC KCYRV+DY+C+REWA KST K  D++W CPNC+   K 
Sbjct: 73  DSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKA 132

Query: 125 VPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKC 184
           +P KNRPTCWCG+ VNPEPNPL+PNSCGQTC+AKIC HGCS+ICHLGPH EC R  S+KC
Sbjct: 133 IPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKC 192

Query: 185 RCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKE 244
            CGK TK+I CF+   R     F C   C+ LLPCGIH+C + CH+GLCGSCPE + + +
Sbjct: 193 SCGKVTKDIVCFQR--RLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETI-ISK 249

Query: 245 GDDVSISCYCGQHTRNSIKCKDVN--VTGRKSKNANGDEWIGVYACKDIRSVEYSCRQHS 302
             ++ I CYCGQ +++ IKCKDV        SK+  G  WIGV+ C  IR V Y C +HS
Sbjct: 250 NTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHS 309

Query: 303 FFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLK 362
           F+E+C APP+++G   C FSPK LKTC CGK  L  L K R +C D IP C   C K+LK
Sbjct: 310 FYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLK 369

Query: 363 CGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHK 422
           CGKH CPF CH G CMDPC QI+KV+CACE+  F +PCGF     C LKCESL+SCRRH+
Sbjct: 370 CGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHR 429

Query: 423 CAERCCSGRPAAEERRKNSS-RFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPG 481
           C ERCC+GRP AE RRK      +D+ DE+ +E  H+CLK CNLTLSCG H+C RKCH G
Sbjct: 430 CTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAG 489

Query: 482 KCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHP 541
           KCPPCLESDSNDLVCPCGKTIV APVRCGTKLP+C +PCI+VV G ++CGH P+PH CHP
Sbjct: 490 KCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHP 549

Query: 542 LDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQC 601
            D PCP CTATVFKPCKCGK  RVRT+CF KDVSCG+ CG+ L  C+H CQK CH PG C
Sbjct: 550 PDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGAC 609

Query: 602 QATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLS 661
           Q  CKQ CN P + C H+C K CH    CPDI C ALVKI CPCGR E EVTCG  S   
Sbjct: 610 QTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNK 669

Query: 662 SSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEEL 721
            +  + R+ CDEEC    RH QLKEAFGI DK  N      +E  RLE + S A+TF +L
Sbjct: 670 EAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQN---THNEEMARLEQVISTASTFADL 726

Query: 722 QFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNL 781
             PFTE  I+TYIR   WC +IE TLN  +D+  ++SLHFKPM+PPQR FIRELAKAYNL
Sbjct: 727 DLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNL 786

Query: 782 YSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHL 841
           YSE+QDPEP RSVFVKKN DGSS KPI S+SE APLYQS+K LEKE+K  +F + TTT L
Sbjct: 787 YSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRL 846

Query: 842 INVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEE 901
           IN     +++   + + + N FL+ N+   T+  DL+NLF  Y++ TL+  PQ+Q LPE 
Sbjct: 847 IN--FTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPER 904

Query: 902 NSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPE 953
             A++YP  Y+ IS N   DME LV H +F++ ++ LA   ELC+  + L E
Sbjct: 905 KQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/911 (57%), Positives = 640/911 (70%), Gaps = 17/911 (1%)

Query: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110
           + YYERAV+EIA+GD Y CMICTVEMDYTCKMFAC KCYRVFDYDC+REWA+KST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170
           + WKCPNC   + KVP K+RPTCWCGKVVNP+PNPLDPNSCGQTCDA IC HGCSK+CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230
           GPHPEC R  S+KC+CG+ T+++ C E    R +  F C E C  LLPCG+H+C K CHS
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQ-FTCEESCGLLLPCGVHKCSKKCHS 234

Query: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKD 290
           GLCG C E L  K      I CYCG H   SI+C DV V  R S +  G+ WIGV+ CKD
Sbjct: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKD 294

Query: 291 IRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPI 350
           +R VEY+C QHSF E C   P++     CPFSP  L++C CG+TPL  LG+AR +C D I
Sbjct: 295 VRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHI 354

Query: 351 PHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQL 410
           P CES+C K L CGKHTCP++CH+G CMDPC+Q +K  C CE  +FLVPC F+  P C  
Sbjct: 355 PTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNT 414

Query: 411 KCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCG 470
           KCESL+SCRRH+C E+CCSG+P AE R+K     +++ DE+L+EAEHVCLK+CNLTL+CG
Sbjct: 415 KCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCG 474

Query: 471 QHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISEC 530
           +H+CQRKCHPG+CPPCLESD NDLVCPCGKT+V APVRCGTKLP C + CI VV     C
Sbjct: 475 RHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPC 534

Query: 531 GHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHF 590
           GH P+PH CHP ++ CPPCTA V KPCKCGK S VRT+CFQ+DVSCGQ C KPL +C H 
Sbjct: 535 GHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHT 594

Query: 591 CQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEV 650
           CQK CH  G CQ  C+Q+C K  VNC HKC K CHG   CPD  C   V I+C CGRKE 
Sbjct: 595 CQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKES 653

Query: 651 EVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEG 710
              CG  S   S+  T  L CDEECE   R  QLK+A G+ +   NG +  E   +    
Sbjct: 654 TEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKE---NGDSSVENTVSN--- 707

Query: 711 LASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRL 770
            A  A+ FEEL  PF E+ ++ Y RQ ++C  IE  LNNF+D+E KSSLHFKPMKP QR 
Sbjct: 708 -ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRH 766

Query: 771 FIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKM 830
           F+ ELAKAY LYSE+QDPEPKRSV+VKK  +G S KP  +L E  P+YQ+FK  EKE K+
Sbjct: 767 FVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKI 826

Query: 831 QDFLAKTTTHLINV--KLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKT 888
           + +  +  T+L+N   K    V        + N FLI+N++ GT  +DL+ ++G++++ T
Sbjct: 827 RRYEMQNVTNLVNFVPKFEPTVEL-----AKYNGFLIRNLTDGTNGEDLQRIYGEHLKPT 881

Query: 889 LIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDAS 948
           L+RNP Y+ LP+ N A+++PE Y  ++ N   DME LVGH +FI  + F+ D  ELC   
Sbjct: 882 LVRNPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVG 941

Query: 949 SKL-PEEISEN 958
             L PE  +E+
Sbjct: 942 EYLQPEAPTES 952

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/920 (55%), Positives = 639/920 (69%), Gaps = 22/920 (2%)

Query: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110
           LPYYE+ + EI KGD Y CMICT+EMDYTC M+AC +CYRV+D++C+REWA+KS+ K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170
           + WKCPNCY VN ++P KNR TCWCGKVV+PE NP+DPNSCGQTC+A IC HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230
           GPHPEC+RTT VKC CGK TK++ C++++  +    +QC EPCN LLPCG+H+CQ+ CHS
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHS 225

Query: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKD 290
           G CG+C E ++ K      I CYCG  TR  I CKDV     KSKN +G+ WIGV++C  
Sbjct: 226 GPCGNCEETISGK------IMCYCGMETREQIICKDVKSVA-KSKNKSGEIWIGVFSCAH 278

Query: 291 IRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPI 350
           +RSVEYSC  HSF E C APPT +G   CPFSP+ LKTC CG TPL+ L   R++C DPI
Sbjct: 279 LRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPI 338

Query: 351 PHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQL 410
           P CE+RC+K LKCGKH+CPF CHDGPCMDPC+ +DKV C+C   +FLVPC F    HC  
Sbjct: 339 PTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNT 398

Query: 411 KCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCG 470
           KCESL+SCRRH+C ERCCSGR  A +R K     +D  DE+L+EA+H+CLK CNL LSCG
Sbjct: 399 KCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 471 QHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISEC 530
            H C+RKCHPGKC PCLESDSNDL CPCGKT+VPAPVRCGTKLP CRHPCIK ++  + C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 531 GHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHF 590
           GH P+PH CH L+QPCP CTA ++K CKC K  +VRT+CFQ DVSCG+ CG PL NC H 
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 591 CQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEV 650
           C++TCH PGQCQ  CKQ+C  P   C HKC   CH    CPD  C   VK+ C CGRKE 
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 651 EVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEG 710
            + C A +   SS     L CD++CE   RHR L EAFGI +K+   + ++E     L  
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLT--APVEE-----LRD 691

Query: 711 LASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRL 770
           L   A +F+EL  PFTEST+S Y +Q  WC +IE  L+  M +  ++SLHFKPMK PQR 
Sbjct: 692 LVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRR 751

Query: 771 FIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKM 830
           FI ELA AY LYSE+QD EPKRSVFVKK ++ S   P+  L E  PLY SFK L+KERK+
Sbjct: 752 FIHELANAYALYSESQDREPKRSVFVKKVENKSHI-PLLCLGEALPLYHSFKQLQKERKV 810

Query: 831 QDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLI 890
           ++    TT  L N  ++D  A    H+ + N FL+K ++ G T  +L +   +Y++ TLI
Sbjct: 811 KELEKSTTRRLFNYTVDD--ANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLI 868

Query: 891 RNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSK 950
           +NP YQ L E    ++YPED+ +IS N  ND++ L  +I+ I  +  +++  +L      
Sbjct: 869 QNPSYQTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDEN 927

Query: 951 LPEEISENDISERLETPEVQ 970
           L    SE  + E  E PE Q
Sbjct: 928 LKTFTSEEYLQE--EQPEKQ 945

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/920 (54%), Positives = 633/920 (68%), Gaps = 22/920 (2%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           D PYYE+ ++EIAKGD Y CMICTVEMD+TC M+AC +CYRVFDY+C+REWA+KST K+V
Sbjct: 60  DQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSV 119

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
            + WKCPNCY   K VP KNRPTCWCGK ++PEPNPL+PNSCGQTCDA IC+HGCS  CH
Sbjct: 120 TKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCH 179

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHP C+R    KCRCGK +K++ C E   R+ + LF+C  PC   LPCG+H+CQ+ CH
Sbjct: 180 LGPHPTCMRMVQTKCRCGKKSKDVFCSE--ARKHQELFRCGNPCGLTLPCGVHKCQRECH 237

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACK 289
           +G+CG CPE +  +      I+CYCG  +  SIKC+DV +   KS++ +G +WIG +AC 
Sbjct: 238 NGVCGECPETIAKE------INCYCGLESLPSIKCQDVKIQS-KSQDGSGKKWIGAFACS 290

Query: 290 DIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDP 349
            IR+VEYSCR+HSF E C APP++ G   CP+SPK LKTC CG+TPL+ +   R +C DP
Sbjct: 291 RIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDP 350

Query: 350 IPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQ 409
           IP C++ C KLL CG+H CPF+CH G CM+ C   DK+KC+C    F+VPC FQG P C 
Sbjct: 351 IPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCN 410

Query: 410 LKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSC 469
            KCESL+SCRRH+CAERCC GR  A+ R K     +D  DE+L+EA+H+CLK CNL LSC
Sbjct: 411 TKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSC 470

Query: 470 GQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISE 529
           G+H CQRKCHPG CPPCLESDSNDLVCPCGKT+ PAPVRCGT LP CR+PCIK ++G  +
Sbjct: 471 GRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLD 530

Query: 530 CGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHH 589
           CGH P+PHACH LD+PCP CTA VFK CKCGKN +VRT+CFQ +VSCG+ CGK L +CHH
Sbjct: 531 CGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHH 590

Query: 590 FCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKE 649
            C KTCH  G+CQ+ CKQVC     NC+H CR  CH    CPD+ C   V+++C CG + 
Sbjct: 591 SCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRS 650

Query: 650 VEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEG-TRL 708
              TC A      +     LEC E+C A  R  +L EAFG+     N   ++  EG   L
Sbjct: 651 SFATCAAHEGQDPA-DQRPLECTEDCAAARRRLELMEAFGM-----NTETVQPTEGIVDL 704

Query: 709 EGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQ 768
             LA K TTF+EL  PFTE+++S + +Q+ WC +IEE LN  M +  K SLHFKPMKPPQ
Sbjct: 705 AALAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQ 764

Query: 769 RLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKER 828
           R FI ELA+AY LY E+QD EPKRSV+VKK  D  S KP  SL E  PLYQSFK  +KER
Sbjct: 765 RHFIHELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKER 822

Query: 829 KMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKT 888
           K+++    TTT ++N     + +       Q N  LI+ +  GT  + ++  F  Y++ T
Sbjct: 823 KLKELERSTTTRILNYTSTGESSPPV---AQINGLLIQKVFEGTDEKTIEACFADYLKHT 879

Query: 889 LIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDAS 948
           LI++P Y +L +    +V+ E+Y T S N   D+  +VGH++ I  D+FLA+   +C   
Sbjct: 880 LIKDPNYLKL-DSGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVE 938

Query: 949 SKLPEEISENDISERLETPE 968
             + EE + +D S   E PE
Sbjct: 939 QVMAEETNRSDESSVAEAPE 958

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/907 (53%), Positives = 639/907 (70%), Gaps = 16/907 (1%)

Query: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110
           L YYE+ +R+I+KGD YTCMICT+EMDYTCKM+AC+ CYRVFDY+C++EWA KS  KT+D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170
           ++WKCPNC   +K++P +NRPTCWCGKV+NP+PN L PNSCGQTC+ K C+HGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230
           GPH EC   T++KC+CG+  K+I C + K     N++QCNE C   L CG+H+C+++CHS
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 231 GLCGSCPENLT------VKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIG 284
           GLCG+CPE L+      V+  ++    CYCG++++N I CK + +TG  SKN+ GD+WIG
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284

Query: 285 VYACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARR 344
            +ACK  R V Y+C +HSF E C A  +++G K CP++PK L +C CGKT L+ L + R+
Sbjct: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344

Query: 345 RCIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQG 404
           +C DPIP CE+RC K LKCGKHTCP+ CH+G CMDPCIQ++   C+C +  FLVPC F+ 
Sbjct: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404

Query: 405 APHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACN 464
            P C  KCESL+SCRRH+C ++CC+G+P A++R+K     +++NDE+L+EA H+CLK CN
Sbjct: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464

Query: 465 LTLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVV 524
           L LSCG H C RKCHPG+CP CL SDSNDLVCPCGKT++ APVRCG+KLP C   CIKV+
Sbjct: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524

Query: 525 EGISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPL 584
           E    CGHKP PH CHP  +PCPPCTA V +PCKCGK+  V+ +CFQ+  SCG+ C K L
Sbjct: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584

Query: 585 PNCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCP 644
            NCHH CQ  CH  GQCQ +CKQVCNK   NC H+C+  CHG   CPD+ C  + K+ C 
Sbjct: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644

Query: 645 CGRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKE 704
           CGRK+    C AT   +SS   E L CDE+CEA+ RH QL++AFG    +   +    K 
Sbjct: 645 CGRKQEYRKCYATLD-NSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSN----KN 699

Query: 705 GTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPM 764
              ++ L  K +T+EEL+ P+ +S ISTY +Q KWC +IE+ L  F+ ++ K++LHFKPM
Sbjct: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759

Query: 765 KPPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLL 824
           KP QR F+REL+ ++NLYSE+QDPEPKRSVFVK+  D  +  P  SL E+ PL+  FK L
Sbjct: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKL 817

Query: 825 EKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKY 884
           EKERK+Q F + +    IN +  + +    + S   N F IK IS G T +DL  +FGK 
Sbjct: 818 EKERKIQHFESTSQRKYINYEPKEVI---VKSSNDTNGFFIKKISPGITEEDLSEVFGKA 874

Query: 885 MEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAEL 944
           ++ TLI+N  Y+ LPE + AI+YPE Y +I+ +   D+E LVGH +FI  +A + DS  L
Sbjct: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIML 934

Query: 945 CDASSKL 951
           C+    +
Sbjct: 935 CNVEGYI 941

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/912 (54%), Positives = 638/912 (69%), Gaps = 18/912 (1%)

Query: 49  QDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKT 108
           +DL +YERA+++IAKGD YTCMICT+E+D T KM+AC  CYRVFDYDC+REWA+KS+ K+
Sbjct: 64  EDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKS 123

Query: 109 VDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKIC 168
           +D++WKCPNC   + K+P +NRPTCWCGK VNP+PNP  PNSCGQTC+AK CIH CS  C
Sbjct: 124 LDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFC 183

Query: 169 HLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNL-FQCNEPCNSLLPCGIHRCQKI 227
           HLGPHP+C RTT++ C CGK TK++ C+     + RN  F C E CN  L CGIH+C ++
Sbjct: 184 HLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243

Query: 228 CHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGV 285
           CHSG CG CPE +T K      ++CYCG  T + I+C +V +  +G+KSK+  G+ WIGV
Sbjct: 244 CHSGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGV 297

Query: 286 YACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRR 345
           + C  IR+VEY+C+ HSFFE C +PPT++GTK CP+SPK LKTC CGKT L      R++
Sbjct: 298 FKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQK 357

Query: 346 CIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGA 405
           C DPI  CE+RCDK LKCGKH CPF CH+GPCMDPC QI+  KC+C    F VPC F   
Sbjct: 358 CTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEK 417

Query: 406 PHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNL 465
           P C +KCESL+SCRRH+C  RCCSG+P A++R+K      D+ DE+L+EAEH+CLK CNL
Sbjct: 418 PRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNL 477

Query: 466 TLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVE 525
            LSCG H C RKCH GKCPPCLESDS+DLVCPCGKT+V APVRCGTKLP C  PCIK +E
Sbjct: 478 KLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIE 537

Query: 526 GISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLP 585
           G   CGHKP  H CHP D PCPPCT  VFKPCKCGK  + + +CFQ+  SCG+ C K L 
Sbjct: 538 GSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLD 597

Query: 586 NCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPC 645
            CHH+CQ  CHLPG+CQ  C Q+CNK  VNC+H C + CHG   CPDI C    ++ C C
Sbjct: 598 GCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGC 657

Query: 646 GRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEG 705
           GR++  + CGATST  S   T+ L CD+ C  Y R  +L+ AFG+     + S   E E 
Sbjct: 658 GRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGM----KSSSEDPESEL 713

Query: 706 TRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMK 765
            RL+ +  K T++EEL+ PF+E+ +S Y +Q  WC +IEE +N F++++ K SLHFKPM 
Sbjct: 714 ERLKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMP 773

Query: 766 PPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLE 825
            PQR FI  L +AY +YSE+QD EPKRSV++KKN    +  P  SL E  PLYQS+K +E
Sbjct: 774 APQRNFIHALVEAYEMYSESQDREPKRSVYLKKNK--YTRIPNISLEEALPLYQSYKKIE 831

Query: 826 KERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYM 885
           KERK+Q F +K     +N +  +   T      + N FLIK I+ GTT  DL  LFG ++
Sbjct: 832 KERKVQSFESKKNVTYLNYQPPERSLTP---DVKYNGFLIKGITFGTTTDDLNTLFGVHL 888

Query: 886 EKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELC 945
           + TLI++ QY  LP+  SAIVYP+DY TIS N   D+E+L GH +++  +A L +S E+C
Sbjct: 889 KPTLIKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMC 948

Query: 946 DASSKLPEEISE 957
           + +  L  E +E
Sbjct: 949 NITDILQTESAE 960

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/922 (52%), Positives = 635/922 (68%), Gaps = 20/922 (2%)

Query: 49  QDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKT 108
           +D PYYE+ V+EI KGD Y CMICTVEMD+TC M+AC  CYRVFD++C+REWA+KST K+
Sbjct: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100

Query: 109 VDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKIC 168
           V + WKCPNCY   K+VP KNRPTCWCGK V PEPNPL+PNSCGQTCDA+IC HGCS IC
Sbjct: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160

Query: 169 HLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKIC 228
           HLGPHP C+R   VKC CGK  K + C E    +  + F C+ PC   LPCGIH+CQ+ C
Sbjct: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHE--AGKFVDSFICDSPCGLTLPCGIHKCQRKC 218

Query: 229 HSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYAC 288
           HSG+CG CPE++        +I+CYC   ++ S+KC +V + GR S++++G++W+G ++C
Sbjct: 219 HSGICGECPESIYG------TINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVGAFSC 271

Query: 289 KDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCID 348
           ++IR+VE+SC++HSF E C APP+++G   CPFSP+ LKTC CG++PL+ +  +R +C D
Sbjct: 272 ENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTD 331

Query: 349 PIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHC 408
           PIP C+S C K+L+CGKH CPF+CH G CM+ C+  DKVKC+C    F+VPC FQ    C
Sbjct: 332 PIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARC 391

Query: 409 QLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLS 468
             KCE+L+SCRRH+C ERCC GR  A+ R K     +D  DE+L+EA+H+CLK CNL LS
Sbjct: 392 NTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLS 451

Query: 469 CGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGIS 528
           CG+H C+RKCHPG C PCLESDSNDLVCPCGKT+VPAPVRCGT LP C HPCIK ++G +
Sbjct: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPA 511

Query: 529 ECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCH 588
            CGH P+PH CHPL++PCP CTA VFK CKC KN +VRT+CFQ DVSCG+ CGK L  C 
Sbjct: 512 PCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571

Query: 589 HFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRK 648
           H CQK CH  G+CQ +CKQ C K   NC H+CR  CH    CPD  C+ LV I+C CG +
Sbjct: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631

Query: 649 EVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRL 708
              VTCGA    + +  T  LEC+ +C+   RH +L EAFGI +    GS   E     L
Sbjct: 632 STTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDANQGSKSLED----L 686

Query: 709 EGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQ 768
           E LA K +TF+EL  PF+E+T+S + +Q  WC +IEE L   M+++ K SLHFKPM+PPQ
Sbjct: 687 EALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQ 746

Query: 769 RLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKER 828
           R FI EL +AY+LY E+QD EPKRSVFVKK  D  S +P  SL    PLY SFK  ++E+
Sbjct: 747 RHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREK 804

Query: 829 KMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKT 888
           K+++    TTT +IN  + D   T    + + N  L++N+  G   + ++  F +Y++ T
Sbjct: 805 KLKETERHTTTRIINYAVTDQAQTPP--AARFNGLLVQNVLNGINEKAIQESFSEYLKHT 862

Query: 889 LIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDAS 948
           L+++P Y  L      +VY +DY T S N  ND+E +VGH++ IV +  LA+        
Sbjct: 863 LLKDPHYLLLA-SGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQ 921

Query: 949 SKLPE-EISENDISERLETPEV 969
           S L + E S +D +  +   E+
Sbjct: 922 SFLDDLESSTSDAATSISNSEL 943

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/904 (50%), Positives = 593/904 (65%), Gaps = 21/904 (2%)

Query: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109
           ++PYYE+ V+EI  GD Y CMICTVE+D TC+M+AC  CYRVFDY+CVREWA+KST+KT+
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169
           D+ WKCPNCY +N K+P + R TCWCGKVVNP+ N LDPNSCGQTC+A  C+HGCSK+CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229
           LGPHPECL    +KC+CGK  K+IPC  ++ +   N + C + C  LLPCG H CQK CH
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPC--SRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCH 208

Query: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACK 289
           +G CG C E++   E     + CYCG   ++ I+C D+ V    SK+ +G +WIGVY+C 
Sbjct: 209 TGFCGPC-ESIIKTE-----LPCYCGSDVKSGIQCSDLRVLDY-SKDVSGKKWIGVYSCG 261

Query: 290 DIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDP 349
           ++R++ YSC  H++ E+C+AP  +  ++ CPFSPK LKTC CGKT L+ L K RR+C D 
Sbjct: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321

Query: 350 IPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQ 409
           IP C + C K L CGKHTCPF CH G CMDPC+ I K  C C   TFL PC     P C 
Sbjct: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381

Query: 410 LKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSC 469
           +KCES +SCRRHKC E CCSG+PAA++R K     +D+N+ETL+E EHVCLK CNL LSC
Sbjct: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441

Query: 470 GQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISE 529
           G H C  KCHPGKCPPCLESD NDLVCPCGKT+VPAPVRCGTKLP C +PCIK+ EG + 
Sbjct: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501

Query: 530 CGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKD--VSCGQTCGKPLPNC 587
           CGH+  PH CHP    CPPCTA V K C+C K   +RT+C   D  V+CG  CG PL  C
Sbjct: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561

Query: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647
           HH CQK CH+ G+C+  C + C      C H C++ CHG   CP+ +C   V I C C R
Sbjct: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621

Query: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
           +  +V CGAT    S   TE+L CDEEC    RH +L EAFG+ +K  N          +
Sbjct: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKE-------Q 674

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           LE +   A  F++L  P++E  ++ Y +Q  WC +I    + F+++  K SLH KPM+ P
Sbjct: 675 LESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVP 734

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR FI+ELA AY LYSE+QD EP RSV++KK     S KP  +L + + LYQ FK LEKE
Sbjct: 735 QRQFIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKE 793

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
           R  + +  K T  LIN+  + +    A + G  NA +I  +   + + +++ L   +++ 
Sbjct: 794 RMQEHYSTKVTKTLINIPAS-ETPLPAPYEGP-NAIVISGVFDSSQIDNIEPLVHDFLKY 851

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL++ PQY+ L + NS +++PE+Y  I+ N  +DME ++  I   + D  LA   E+C  
Sbjct: 852 TLVKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQV 911

Query: 948 SSKL 951
              L
Sbjct: 912 DENL 915

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/904 (50%), Positives = 581/904 (64%), Gaps = 26/904 (2%)

Query: 49  QDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKT 108
           + +PYYE+ V E+  G+ Y C+ICTVEMD +C M+AC +CYRV+DY+C+R WA+K+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 109 VDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKIC 168
           VDR WKCPNCY VN+KVP KNR TCWCGK VN +PN ++PNSCGQTC A IC HGCSK+C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 169 HLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKIC 228
           HLGPH EC+     KCRCGK T+EIPC+E K  + RN F C++PC   +PCGIH+C+++C
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAK-RN-FSCDQPCGLPMPCGIHKCERVC 191

Query: 229 HSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYAC 288
           H+G CG C E +    GD   I CYCG  TRN + C +V+V  R SK +    WIG +AC
Sbjct: 192 HNGPCGPCKEEIA---GD---IKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSWIGAFAC 244

Query: 289 KDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCID 348
             +R V YSC +HSF E+CIAPP++     CP+SP+   TC CGKT L  LG  R  C D
Sbjct: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304

Query: 349 PIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHC 408
            I  C   C K L CG HTCP  CHDG CMDPC+ I + KCACE+  FLVPC F  +P C
Sbjct: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364

Query: 409 QLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLS 468
             KCESL+SCRRH+CAERCCSGRP +  +R +  R +  +DE+ +EA+HVCLK CN  L 
Sbjct: 365 TAKCESLMSCRRHRCAERCCSGRPHS-VKRNSRRRRESPDDESEVEAQHVCLKDCNRVLL 423

Query: 469 CGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGIS 528
           CG H C  KCH GKCPPCLESDSNDL+CPCGKTIVPAPVRCGTKLP C HPC   +    
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 529 ECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCH 588
            CGH P  H CHPLD+PCPPCT TV K C+CGKN  +RT C+  DVSC + C KPL  C+
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKN-EIRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 589 HFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRK 648
           HFCQ  CH  GQCQ TCKQ C  P   C H C+  CHG   CP+  C     I C CG K
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 649 EVEVTCGATSTLSSSL-FTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707
                C   +     +  ++ L CDE+C  + RH+QL  AFG+ +K     A  E++   
Sbjct: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEK-----ATSEEDEAL 657

Query: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767
           L  LA ++ +F++L  PFTE  +S + +Q++WC +IE+ L   MD+    +LHFKPM+  
Sbjct: 658 L--LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAA 715

Query: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827
           QR F+ EL+ ++ LYSE+QDPEPKRSV+VKK   G S  P   LS+ APLY SFK LE+E
Sbjct: 716 QRRFVHELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTSFKKLERE 773

Query: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887
            K     A  T  L++V ++D  +  +QH    NA L+  +++  +   L++ F  Y  +
Sbjct: 774 FKANSESA-VTKKLVSVHIDD--SPESQHDAAINAILLSGLTSFASESALRDCFADYFSQ 830

Query: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947
           TL+  PQY  +       ++P DY ++SANA  D+  L G+   +  +  L      C  
Sbjct: 831 TLLNCPQY--VVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKL 888

Query: 948 SSKL 951
            S L
Sbjct: 889 DSNL 892

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/882 (48%), Positives = 573/882 (64%), Gaps = 21/882 (2%)

Query: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110
           LPYYE+A+++I  G LY C+ICTVE+D TC+M+AC  CYRV+DY+C+ EWA KS+ ++ D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170
             WKCPNCY    KV  K R TCWCGK +NPE N   PNSCGQTC A IC HGC+  CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230
           GPHP+C+    +KC+CGK T++I C++TK  + +    C  PC   LPCG+H CQKICHS
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQKICHS 205

Query: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKD 290
           G CG C    TV  G      CYCG +  +SI CKDV VT + S++    +WIGV++CK+
Sbjct: 206 GPCGRCN---TVMSG---KFKCYCGSNHLDSIICKDVAVT-KMSRSGKHKKWIGVFSCKN 258

Query: 291 IRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPI 350
           IR V Y C++HSF E C   P+     +CP+SP   KTC CG T L  + + R +C DPI
Sbjct: 259 IREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPI 318

Query: 351 PHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQL 410
           P C+ RC K L CGKHTCP  CH G CMDPC+QI++ KC+C+  TFL PC F G P C +
Sbjct: 319 PTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNI 378

Query: 411 KCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCG 470
           KCE+L+SCRRH+C +RCCSG+P A  R    + + D NDE+L+EAEH+C K CN  LSCG
Sbjct: 379 KCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCG 438

Query: 471 QHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISEC 530
            H C  KCHPGKCPPCLESDSNDLVCPCGK+++ APVRCGT  P+C +PCI  + G   C
Sbjct: 439 LHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPC 498

Query: 531 GHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHF 590
           GH+   H CHP  + CPPCTA V+KPCKCGK +  RTICFQ D+SCG+ C   L NCHH 
Sbjct: 499 GHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHL 558

Query: 591 CQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEV 650
           CQK CH PG+C  TC +VC      C H C  +CHG   CPD+ C+  V + C CGR+ +
Sbjct: 559 CQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSL 618

Query: 651 EVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEG 710
           +V CGA     S+  T+ L CD++C    +H+ L +    ++     S  K + G+    
Sbjct: 619 KVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE-----STNKAEHGS--SS 671

Query: 711 LASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRL 770
           + +K T++E+L  P++E  +  + +Q  WC  I+++L   ++++ + SLHFKPMK PQR 
Sbjct: 672 VINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731

Query: 771 FIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKM 830
           F+ EL+KA+ LYSE+QD EPKRSVFVK     +S  P   LSE   LYQ  K  +KER+ 
Sbjct: 732 FVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRD 789

Query: 831 QDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLI 890
            +    TT  LI++ + DD +         NA LI  +    T++++K  F + +++TL+
Sbjct: 790 LELQHNTTKILISIPI-DDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLL 848

Query: 891 RNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFI 932
           ++PQ++ +   ++A +YP ++  ISAN   D++ LV + + +
Sbjct: 849 KDPQFRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHV 888

>YGL098W Chr7 (317342..318079) [738 bp, 245 aa] {ON}  USE1Essential
           SNARE protein localized to the ER, involved in
           retrograde traffic from the Golgi to the ER; forms a
           complex with the SNAREs Sec22p, Sec20p and Ufe1p
          Length = 245

 Score = 35.4 bits (80), Expect = 0.46,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 818 YQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDL 877
           + + K++E + +     +KT  + I++   D V T +Q    N  F+ +N  +   ++  
Sbjct: 65  HDAHKIMESQYEQYQSSSKTRRYSIDLDSVDAVDTESQTEYPNEEFIDRNEDSEAVMELR 124

Query: 878 KNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHI 929
           K L GK   K L     Y+     +  I   ED  T+  + + DM  LVG +
Sbjct: 125 KRLLGKGQNKGL----GYETTKSVDRQI---EDQDTLQQDLIQDMSKLVGSL 169

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score = 34.3 bits (77), Expect = 1.3,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 711 LASKATTFEELQFPFTE-STISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQR 769
           +AS  T  E +    ++ ST   Y+++NKW   +E  LN+F DNE  S L     +  + 
Sbjct: 2   MASDQTLKEFMSLANSDLSTAQKYLKRNKW--RLEYALNDFYDNEIGSFLIQDLARDNKI 59

Query: 770 L---FIRELAKAYNLYS 783
           L   ++R L + YN Y+
Sbjct: 60  LGIEYVRPLTELYNHYA 76

>Kpol_1056.39 s1056 complement(95698..95955,96083..96118) [294 bp,
           97 aa] {ON} complement(95698..95955,96083..96118) [294
           nt, 98 aa]
          Length = 97

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 695 ANGSAMKEKEGTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNE 754
           +N S ++ +   RLE LA+K  TF+ +     +  I+     N+     +  LNN  +  
Sbjct: 4   SNYSQLESRNDERLESLANKLATFKNINQEIGDQAINDNSLMNQLSNSFDSMLNNVRNTS 63

Query: 755 GK 756
           G+
Sbjct: 64  GR 65

>NCAS0A09830 Chr1 complement(1964190..1965041) [852 bp, 283 aa] {ON}
           Anc_3.74 YNL286W
          Length = 283

 Score = 33.5 bits (75), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 853 GAQHSGQNNAFLIKNISAGTTLQDLKNLFGKY 884
           G+QHS +++A  + NIS  T+  DL  LF KY
Sbjct: 33  GSQHSRESSAIYVSNISKHTSQLDLITLFSKY 64

>KAFR0F00210 Chr6 (55875..57977) [2103 bp, 700 aa] {ON} Anc_2.32
           YDL233W
          Length = 700

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 798 KNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQHS 857
           +N+D S  +P   +S+ A   Q F+  ++ ++M +F++    +++N  +N   A     +
Sbjct: 6   QNEDPSQTQP--GMSQQA---QMFQYAQQAQQMSNFMSGVDPYMVNAHMNGGFAGNTNSA 60

Query: 858 GQNNAFLIKNISAGTTLQDLKN 879
           G NN   I++ S  +  Q   N
Sbjct: 61  GHNNNQFIQDGSNRSQNQGANN 82

>Smik_7.175 Chr7 (312660..313397) [738 bp, 245 aa] {ON} YGL098W
           (REAL)
          Length = 245

 Score = 31.6 bits (70), Expect = 9.2,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 46/112 (41%), Gaps = 7/112 (6%)

Query: 818 YQSFKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDL 877
           + S K++E E ++    +KT  + I++          Q    N  FL ++      ++  
Sbjct: 65  HDSHKIMENEYELYQRSSKTRRYSIDLDSVPAADMDPQAVNSNEDFLDRDEDNDAVMELR 124

Query: 878 KNLFGKYMEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHI 929
           K L GK   K L     Y+     +  I   ED  T+  + + DM  LVG +
Sbjct: 125 KRLLGKQQSKGL----GYESTKSVDRQI---EDQDTLQQDLIQDMSKLVGSL 169

>TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.332
           YML068W
          Length = 458

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 53  YYERAVREIAKGDLYTCMICT------VEMDYTCKMFACRKCYRVFDYDCVREW 100
           +Y +A  ++++  LY C+ C       V+ D    M  C+ C  VF +DC+  W
Sbjct: 273 FYSQAASKLSQHCLYACVTCRRCNKWCVKEDLNDSMIECKSCEYVFCFDCLHSW 326

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,140,483
Number of extensions: 4512691
Number of successful extensions: 11346
Number of sequences better than 10.0: 62
Number of HSP's gapped: 10458
Number of HSP's successfully gapped: 70
Length of query: 973
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 854
Effective length of database: 39,836,145
Effective search space: 34020067830
Effective search space used: 34020067830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)