Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H019802.289ON24924913290.0
NDAI0G006802.289ON2552568891e-121
NCAS0G03850singletonON2512498851e-120
NCAS0G037702.289ON2512498851e-120
YNL024C2.289ON2462498641e-117
Skud_14.3052.289ON2492498551e-116
Smik_14.3072.289ON2462498521e-116
Suva_14.3232.289ON2532498501e-115
CAGL0M06897g2.289ON2482488381e-113
KAFR0H032902.289ON2452508091e-109
KLTH0G10428g2.289ON2512457183e-95
SAKL0E07612g2.289ON2522437174e-95
Kwal_27.115132.289ON2512447002e-92
Ecym_33282.289ON2542506932e-91
ADL212W2.289ON2512506637e-87
KLLA0E08295g2.289ON2662416422e-83
NCAS0J021504.352ON3221871482e-10
Smik_10.4224.352ON3401931473e-10
YBR271W (EFM2)1.325ON4191891412e-09
NDAI0J028604.352ON3471491393e-09
Skud_10.3524.352ON3361991385e-09
Smik_2.4141.325ON4171871369e-09
NDAI0B047301.325ON4321701361e-08
KAFR0C042501.325ON3911761332e-08
Suva_4.5321.325ON4161871314e-08
KNAG0C018001.325ON4211531305e-08
NCAS0B074101.325ON4141451252e-07
Skud_2.4031.325ON4171541234e-07
KLTH0H10560g1.325ON4171571218e-07
Kwal_14.25501.325ON4181791218e-07
Suva_12.2204.352ON3372131191e-06
KLLA0E21539g1.325ON4001821201e-06
Kwal_47.166354.352ON3221491182e-06
SAKL0D06798g1.325ON4211351172e-06
KLTH0D17996g4.352ON3171491162e-06
ZYRO0B14916g4.352ON2981721137e-06
KAFR0E042804.352ON3151791137e-06
ZYRO0G20548g1.325ON3971701121e-05
TBLA0D052001.325ON3991861102e-05
Kpol_1066.171.325ON4351811102e-05
Kpol_1028.814.352ON3361591083e-05
AER240W1.325ON3901061049e-05
SAKL0G18106g4.352ON3351411041e-04
CAGL0I09438g1.325ON4061871041e-04
TDEL0D019401.325ON4052181041e-04
YJR129C4.352ON3392031022e-04
Ecym_55131.325ON3961701003e-04
KLLA0B04444g4.352ON308154940.002
KNAG0B067204.352ON283179920.003
TPHA0I026501.325ON421179900.006
CAGL0M00572g4.352ON327181870.011
TDEL0D006404.352ON327174850.026
TPHA0L003404.352ON341170820.049
TBLA0B061504.352ON31698780.17
ACL114Wna 1ON31948750.41
KNAG0E019002.259ON37565720.91
Ecym_11274.352ON320146721.1
AER161C4.352ON316139701.7
SAKL0A06204g6.148ON84345701.9
TBLA0G024902.259ON368170692.1
NCAS0D030006.79ON254153682.5
KLLA0D16753g8.339ON322110683.1
Smik_12.3626.79ON284150665.6
Kwal_26.94245.31ON195672659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H01980
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   516   0.0  
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   347   e-121
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               345   e-120
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   345   e-120
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   337   e-117
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   333   e-116
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   332   e-116
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   332   e-115
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   327   e-113
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   316   e-109
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   281   3e-95
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   280   4e-95
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   274   2e-92
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   271   2e-91
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   259   7e-87
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   251   2e-83
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    62   2e-10
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    61   3e-10
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    59   2e-09
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    58   3e-09
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    58   5e-09
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    57   9e-09
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    57   1e-08
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    56   2e-08
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    55   4e-08
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    55   5e-08
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    53   2e-07
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    52   4e-07
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    51   8e-07
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    51   8e-07
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    50   1e-06
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    51   1e-06
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    50   2e-06
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    50   2e-06
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    49   2e-06
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    48   7e-06
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    48   7e-06
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    48   1e-05
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    47   2e-05
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    47   2e-05
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    46   3e-05
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    45   9e-05
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    45   1e-04
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    45   1e-04
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    45   1e-04
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    44   2e-04
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    43   3e-04
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    41   0.002
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    40   0.003
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    39   0.006
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    38   0.011
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    37   0.026
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    36   0.049
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    35   0.17 
ACL114W Chr3 (144800..145759) [960 bp, 319 aa] {ON} Non-syntenic...    33   0.41 
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    32   0.91 
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    32   1.1  
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    32   1.7  
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...    32   1.9  
TBLA0G02490 Chr7 complement(647049..648155) [1107 bp, 368 aa] {O...    31   2.1  
NCAS0D03000 Chr4 (570300..571064) [765 bp, 254 aa] {ON} Anc_6.79...    31   2.5  
KLLA0D16753g Chr4 (1418383..1419351) [969 bp, 322 aa] {ON} simil...    31   3.1  
Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W...    30   5.6  
Kwal_26.9424 s26 (1209573..1215443) [5871 bp, 1956 aa] {ON} YGR2...    30   9.3  

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 241 THLFELIRN 249
           THLFELIRN
Sbjct: 241 THLFELIRN 249

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  347 bits (889), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/256 (67%), Positives = 200/256 (78%), Gaps = 8/256 (3%)

Query: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59
           M++IFGS F DLVVARP+EH G+ D+SFGGRL   L+IHEDGGESGCGGKVW+AGELLC+
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119
           +I+EKS+ DDLL  W  S  ++FR I+ELGSGTGLVGLC+ LLEK  FHK I   ITDID
Sbjct: 61  FILEKSNSDDLLNGW-ASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119

Query: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAP--HS----EGLSKVTSVDLILAAD 173
           Q+VPLM++NI+LN +  E+ AEELWWGEPL   FAP  HS    E   +   VDLILAAD
Sbjct: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAAD 179

Query: 174 CVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTY 233
           CVYLEKAFPLLEKTLLDLT    PP ILMAYRKRR ADK FF+KI K+F + EI DF  Y
Sbjct: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 234 DQYLKQRTHLFELIRN 249
           + YLKQRTHLF+LIR 
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  345 bits (885), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 196/249 (78%), Gaps = 1/249 (0%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M+ IFG F  LVV RP+EH G+ D+SFGG+L   L+IHEDGGESGCGGKVW+AGELLCD+
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS  +DLL  W     ++FRN++ELGSGTGLVGLCV LLEK  FHK I V ITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS-EGLSKVTSVDLILAADCVYLEK 179
           LVPLMQ+NIELN V+ E++AE LWWGEPL  +FAP + + L K   VDLILAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 180 AFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQ 239
           AFPLLE+TLLDLT    PPVILM+YRKRR ADK FF KI K+F V E+ DF+ Y+ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 240 RTHLFELIR 248
           RTHLF+L R
Sbjct: 241 RTHLFQLAR 249

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  345 bits (885), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 196/249 (78%), Gaps = 1/249 (0%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M+ IFG F  LVV RP+EH G+ D+SFGG+L   L+IHEDGGESGCGGKVW+AGELLCD+
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS  +DLL  W     ++FRN++ELGSGTGLVGLCV LLEK  FHK I V ITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS-EGLSKVTSVDLILAADCVYLEK 179
           LVPLMQ+NIELN V+ E++AE LWWGEPL  +FAP + + L K   VDLILAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 180 AFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQ 239
           AFPLLE+TLLDLT    PPVILM+YRKRR ADK FF KI K+F V E+ DF+ Y+ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 240 RTHLFELIR 248
           RTHLF+L R
Sbjct: 241 RTHLFQLAR 249

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  337 bits (864), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/249 (65%), Positives = 199/249 (79%), Gaps = 3/249 (1%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M  IFG FGDLVV RP EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS   D L +   +  ++F+ ++ELGSGTGLVGLCV LLEK  FH G KV +TDID+
Sbjct: 61  ILEKSV--DHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDK 118

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           L+PL+++NIEL+ V  E++A ELWWGEPLS  F+P  EG  +  +VDL+LAADCVYLE+A
Sbjct: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQ-EGAMQANNVDLVLAADCVYLEEA 177

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLEKTLLDLT+C  PPVILMAY+KRR ADK FF KI ++F V EITDFS ++ YLK+R
Sbjct: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237

Query: 241 THLFELIRN 249
           THLF+LIR 
Sbjct: 238 THLFQLIRK 246

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  333 bits (855), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 197/249 (79%), Gaps = 3/249 (1%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M+ IFG F DLVV R  EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS     L +  T   ++F+ ++ELGSGTGLVGLCV LLEK  FH G KV +TDID+
Sbjct: 61  ILEKSLHH--LLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDK 118

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           LVPL+++NIEL+ V  E++A ELWWGEPLS  F+P  EG  +  +VDL+LAADCVYLEKA
Sbjct: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLE+TLLDLTNC  PPVILMAY+KRR ADK FF KI ++F V EITDFS +D YLKQR
Sbjct: 178 FPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQR 237

Query: 241 THLFELIRN 249
           THLF+LIR 
Sbjct: 238 THLFQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  332 bits (852), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 164/249 (65%), Positives = 197/249 (79%), Gaps = 3/249 (1%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M+ IFG FGDLVV RP EH G  D+SF G+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS +  L    D  K  +F+ ++ELGSGTGLVGLCV LLEK  +H G KV +TDID+
Sbjct: 61  ILEKSVDHLLSKTVDGKK--RFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDK 118

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           LVPL+++NIEL+ V  E++A EL WGEPLS  F+P  EG  +  +VDL+LAADCVYLEKA
Sbjct: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQ-EGDLQTNNVDLVLAADCVYLEKA 177

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLEKTLLDLT+C  PPVILMAY+KRR ADK FF KI ++F V EI++FS +D YLKQR
Sbjct: 178 FPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQR 237

Query: 241 THLFELIRN 249
           THLF+LIR 
Sbjct: 238 THLFQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  332 bits (850), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 197/249 (79%), Gaps = 3/249 (1%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M+ IFG F DLVV R  EH G  D+SFGG+L PAL+I EDGGESGCGGKVW+AGELLC+Y
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKSD  D L +    + + F  ++ELGSGTGLVGLCV LLEK  FH   KV +TDID+
Sbjct: 61  ILEKSD--DHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDR 118

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           LVPLM++NIEL+ V  E++A ELWWGEPLSG F+P  EG  +V +VDL+LAADCVYLEKA
Sbjct: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQ-EGDLQVNNVDLVLAADCVYLEKA 177

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLEKTLLDLTNC  PPVILMAY+KRR ADK+FF KI ++F V EI DF  +D YLKQ+
Sbjct: 178 FPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQK 237

Query: 241 THLFELIRN 249
           THLF+L+R 
Sbjct: 238 THLFQLVRK 246

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  327 bits (838), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/248 (62%), Positives = 192/248 (77%), Gaps = 1/248 (0%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           M +I G FGDL+ +RP+EH G  D++F G L P L+I+EDGGESGCGGKVW+AGELLC++
Sbjct: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           I+EKS + +LL +W       F N++ELGSGTGLVGLCV L+ K+   + +K  ITDIDQ
Sbjct: 60  ILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQ 119

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180
           LVPLM+KN+ELN ++ ++ A+EL WGE L   FAP   G +  +S+DL+LAADCVYLEKA
Sbjct: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKA 179

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240
           FPLLEKTLLDLT C  PPVILMAYRKRR ADK FF+KI K+F V  I DF  YDQYLKQR
Sbjct: 180 FPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQR 239

Query: 241 THLFELIR 248
           THLF+L+R
Sbjct: 240 THLFQLVR 247

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  316 bits (809), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 193/250 (77%), Gaps = 8/250 (3%)

Query: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60
           MNE+FG +  L+  RPIEH GS D+SF G+L+PA++I+EDGG SGCGGKVW+AGELLC+Y
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120
           ++EKSD ++LL +         +NI+ELGSGTGLVG+CV L+EKQ FHK IKV+ITDI  
Sbjct: 61  LIEKSDSENLLCDG------SIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS--EGLSKVTSVDLILAADCVYLE 178
           LVPLM++NI LN +    +A+EL WG+ L   +   S       V++VDL++AADCVY E
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174

Query: 179 KAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLK 238
           KAFPLLEK LLDLTNC  PP+ILMAYRKRR ADKRFF +I K+F V EI DFS++++Y+K
Sbjct: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234

Query: 239 QRTHLFELIR 248
           QRTHLFEL R
Sbjct: 235 QRTHLFELKR 244

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  281 bits (718), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 179/245 (73%), Gaps = 7/245 (2%)

Query: 6   GSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKS 65
             F DLV +RP+EH G  D++FGGR+ PAL+IHEDGGESGCGGK+W+AGELLC+Y++E S
Sbjct: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68

Query: 66  DEDDLLANWDT--SKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVP 123
           D++ +L+       + + F NI+ELGSGTGLVGLC   L +       KV ITDIDQLV 
Sbjct: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGNA-KVHITDIDQLVR 127

Query: 124 LMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPL 183
           LM+ N+ELN + + + AE+LWWGEPL   F P  + +S  T  DL+LAADCVYLE AFPL
Sbjct: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEFGP--DAISNKT--DLVLAADCVYLETAFPL 183

Query: 184 LEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHL 243
           LEKTLLDLT    PPV+LM+YRKRR AD+ FF+ I K+F V  IT F   D +LKQRTHL
Sbjct: 184 LEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHL 243

Query: 244 FELIR 248
           F+LIR
Sbjct: 244 FQLIR 248

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  280 bits (717), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 148/243 (60%), Positives = 184/243 (75%), Gaps = 6/243 (2%)

Query: 8   FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDE 67
           F DLV +RP EH G  D+SFGG+L+P L+IHEDGGESGCGGKVW+AGELLC++++EKSD+
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  DDLLANW--DTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLM 125
             L + W  DT      + I+ELGSGTGLVGLC+ LL KQ   K + + +TDIDQLV LM
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 126 QKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLE 185
            +NI+LN +   +  +ELWWGEPL   FAP     S    VDLILAADCVYLEKAFPLLE
Sbjct: 131 DRNIKLNELE-HVFPKELWWGEPLKPEFAPTR---SNQRQVDLILAADCVYLEKAFPLLE 186

Query: 186 KTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFE 245
            TLLDLT+C  PP+ILM+Y+KRR ADK FF++I K+F V EI +F+ +D YLKQ+THLF+
Sbjct: 187 VTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLFQ 246

Query: 246 LIR 248
           L+R
Sbjct: 247 LVR 249

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  274 bits (700), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 171/244 (70%), Gaps = 7/244 (2%)

Query: 7   SFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSD 66
            F DLV +RP+EH G  D+SFGG++ PAL+IHEDGGE+GCGGK+WVAGELLCDY++E SD
Sbjct: 10  QFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSD 69

Query: 67  EDDLLANW--DTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPL 124
              +L+    +      F NI+ELGSGTGLVGLC   +  Q      KV ITDID+LV L
Sbjct: 70  AKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSV-AQLHGDRTKVYITDIDRLVGL 128

Query: 125 MQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLL 184
           M+ N+ LN +   +  E L WGEPL   F P +    K   VDL+LAADCVYLE AFPLL
Sbjct: 129 METNVNLNHLAETVSVEILSWGEPLKEKFGPDA----KADKVDLVLAADCVYLETAFPLL 184

Query: 185 EKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLF 244
           EKTLLDLT    PP +LM+YRKRR ADK FFR I K+F +  IT+F  YD YLK++THLF
Sbjct: 185 EKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244

Query: 245 ELIR 248
           +L+R
Sbjct: 245 QLVR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  271 bits (693), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 178/250 (71%), Gaps = 9/250 (3%)

Query: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59
           M ++F S F +LV   PIEH G+ D+SF GRL+P L+I+EDGGESGCGGKVW+AGELLCD
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119
           +++EKS +  LL+ +     ++F  ++ELGSGTGLVGLC+ +         + V ITDID
Sbjct: 61  FLLEKSKDGQLLSKF-VKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119

Query: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEK 179
            L PLM +N+ +N +   +   EL+WG+ L   F       +K + VDLILAADCVYLEK
Sbjct: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFR------NKDSPVDLILAADCVYLEK 173

Query: 180 AFPLLEKTLLDLT-NCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLK 238
           AFPLLE  LL+LT N    PV+LM+YRKRR ADK+FF KI KHF + E+TDF  YD+Y+K
Sbjct: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIK 233

Query: 239 QRTHLFELIR 248
           QRTH+F+L+R
Sbjct: 234 QRTHIFQLVR 243

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  259 bits (663), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 177/250 (70%), Gaps = 10/250 (4%)

Query: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59
           M E F + F DLV  RPIEH G  D+S+ G+L+P L+IHEDGGESGCGGKVW+AG LLC+
Sbjct: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60

Query: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119
           +I+EKS +  +L+ +   + Q F+NIIELGSGTGLVGLCV L  K        V ITDI+
Sbjct: 61  FILEKSKDGRVLSQFPGYERQ-FKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIE 119

Query: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEK 179
            L PLMQKN+ELN ++  +    L+WGEPLS  F            +DL+LAADCVYLEK
Sbjct: 120 GLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP--------IDLVLAADCVYLEK 171

Query: 180 AFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQ 239
           AFPLLEKTLLDLT     P++LM+Y+KRR ADK+FF KI K F + EI DF +Y+ Y +Q
Sbjct: 172 AFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQ 231

Query: 240 RTHLFELIRN 249
           RT+LF+L+R 
Sbjct: 232 RTYLFQLVRK 241

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  251 bits (642), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 177/241 (73%), Gaps = 10/241 (4%)

Query: 8   FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDE 67
           F +LV ARPIEH G  DMSF G+L   L I+EDGGESGCGGKVW+AGELLC+YI+EKSD+
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 68  DDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQK 127
           + LL++          +++ELGSGTGLVGLCV L+++   +   +V I+DIDQL+ LM+ 
Sbjct: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151

Query: 128 NIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKT 187
           NI++N ++ ++ AE LWWG PL   F            VDL+LAADCVYLE AFPLLEKT
Sbjct: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVK--------KPVDLVLAADCVYLEAAFPLLEKT 203

Query: 188 LLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFELI 247
           LL+LT+    P+ILMAY+KRR ADK FF+KI K+F + EI DF  +D+YLKQRTHLF+L+
Sbjct: 204 LLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLM 263

Query: 248 R 248
           R
Sbjct: 264 R 264

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 90/187 (48%), Gaps = 32/187 (17%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   L  Y+V   D +D L N D        NI+ELG+GTGLV L +A ++K  
Sbjct: 123 GFRTWAASVYLSKYLV---DHEDALINDDD-------NILELGAGTGLVSLTIASMDKMK 172

Query: 107 FHKGIKVTITDID-QLVP-LMQKNIELNCVNTE--MIAEELWWGEPLSGAFAPHSEGLSK 162
            +K  ++ +TD D +LV   MQ N ++N VN +  +  ++LWW  P      P  E    
Sbjct: 173 DNKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNSP----DQPIPE---- 224

Query: 163 VTSVDLILAADCVYLEKAF----PLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKI 218
              V++++ AD  Y    F      L + LL+ + C K    L+A   R     + F+  
Sbjct: 225 --RVNVVIGADVTYDSTCFTDLCSCLRQCLLE-SECYK---CLIASTIRNVKTDKLFQST 278

Query: 219 GKHFTVR 225
            +HF +R
Sbjct: 279 VEHFGMR 285

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 23/193 (11%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVA 100
              S  G + W A   + D+++ K  ++  L   +  + +K  N++E+G+GTG+V L ++
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 101 LLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTE----MIAEELWWGEPLSGAFAPH 156
              + F +K + VT  D D +   ++KN ELN   +E    +  + LWWG          
Sbjct: 187 QNYRNFVNK-MYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWGS--------- 236

Query: 157 SEGLSKVT-SVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFF 215
                KV   +DL++ AD  Y    FP L K L +    ++  + L++   R  +  + F
Sbjct: 237 ----DKVPDDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLF 292

Query: 216 ----RKIGKHFTV 224
                K+G  +T+
Sbjct: 293 AQECSKLGLEYTI 305

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 90/189 (47%), Gaps = 26/189 (13%)

Query: 3   EIFGSFGDLVVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGE 55
           EI       + +R  E+CG        R      L+ ++ +HE        G K W +  
Sbjct: 167 EIIQELLKELSSRISENCGRTAQPSIVRYFELRNLSTSIPLHEPSLTADNLGWKTWGSSL 226

Query: 56  LLCDYIVEKSD-----EDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFF-HK 109
           +L   +V+  D       ++LAN D  +++    ++ELG+GTGLVGL  AL  K+ +  +
Sbjct: 227 ILSQLVVDHLDYLHTTNVNMLANSDIKQIK----VLELGAGTGLVGLSWALKWKELYGTE 282

Query: 110 GIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEP--LSGAFAPHSEGLSKVTSVD 167
            I++ +TD+ ++V  ++KN+ LN +   + AE L W  P      F   +E        D
Sbjct: 283 NIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTNPHDFIDKFGHENE-------FD 335

Query: 168 LILAADCVY 176
           +IL AD +Y
Sbjct: 336 VILIADPIY 344

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 70/149 (46%), Gaps = 21/149 (14%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVA 100
            G+S  G + W     L  +         L+ N +   ++K  ++IELG+GTGLV LC+ 
Sbjct: 136 SGKSTTGFRTWEGAVYLSKF---------LINNCEKYLIEK-TDVIELGAGTGLVSLCIL 185

Query: 101 LLEKQFFHKGIKVTITDIDQ--LVPLMQKNIELNCVNTE---MIAEELWWGEPLSGAFAP 155
             + Q   K  KV +TD D   +  ++ KN ELN VN E   +I  +LWW +P +   A 
Sbjct: 186 ENDLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDP-NEKIAG 244

Query: 156 HSEGLSKVTSVDLILAADCVYLEKAFPLL 184
              G      + L++ AD  Y     P L
Sbjct: 245 EDNG-----KIGLVVGADITYDNSVIPDL 268

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 95/199 (47%), Gaps = 28/199 (14%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDED-DLLANWDTSKVQKFRNIIELGSGTGLVGLCV 99
              S  G + W A   + D+++ K  +   L+   D  K+    N++E+G+GTG+V L  
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLALMQKEDRKKL----NVLEIGAGTGIVSL-- 180

Query: 100 ALLEK-QFFHKGIKVTITDIDQLVPLMQKNIELN---CVN-TEMIAEELWWGEPLSGAFA 154
            LLEK + F   + VT  D + +   +++N ELN   C N  ++  + LWWG        
Sbjct: 181 VLLEKYREFVNRMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWG-------- 232

Query: 155 PHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRF 214
             S+ +     +DL++AAD  Y    FP L + L +    S+  + L++   R  +  + 
Sbjct: 233 --SDRIPD--DIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKL 288

Query: 215 F----RKIGKHFTVREITD 229
           F     KIG ++TV   T+
Sbjct: 289 FAQECNKIGLNYTVVSSTE 307

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 87/187 (46%), Gaps = 23/187 (12%)

Query: 2   NEIFGSFGDLVVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAG 54
           NE        + +R  E+CG        R      L  A+ ++E        G K W + 
Sbjct: 167 NETIQKLLKELSSRISENCGRTAQPSTIRYFELRNLRNAIPLYEPSLTADNLGWKTWGSS 226

Query: 55  ELLCDYIVEK--SDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFH-KGI 111
            +L   +V++  + + D +AN  T +++    ++ELGSGTGLVGL  A   K+ +     
Sbjct: 227 LILSQLVVDRLHTADMDFVANRGTKRIK----VLELGSGTGLVGLSWASKWKELYGIDNT 282

Query: 112 KVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLS--GAFAPHSEGLSKVTSVDLI 169
           ++ +TD+  +V  ++KN+ LN +   + AE L W  P S    F   +E        D+I
Sbjct: 283 EIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQSFIDRFGYENE-------FDII 335

Query: 170 LAADCVY 176
           L AD +Y
Sbjct: 336 LIADPIY 342

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 15  RPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEKSDE 67
           R  E+CG        R      L   +Q++E        G K W +  +L   +V     
Sbjct: 194 RISENCGRSAQPSMTRDFNLQNLVHVIQLYEPSLTADNLGWKTWGSSLILSQELV----- 248

Query: 68  DDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFF-HKGIKVTITDIDQLVPLMQ 126
           +DL  N +  K +  R ++ELG+GTGLVG+  A   +Q + ++ I++ +TD+  +V  ++
Sbjct: 249 NDLETNKNNKKSKSIRRVLELGAGTGLVGIAWACKWRQLYGNESIEMFVTDLPDIVTNLR 308

Query: 127 KNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVY 176
           KN++ N ++  ++A+ L W  P         E        D IL AD +Y
Sbjct: 309 KNVQNNDLDDFVVADVLDWTNPEDFIKKYSDEKF------DTILIADPIY 352

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 85/176 (48%), Gaps = 21/176 (11%)

Query: 12  VVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEK 64
           V  R  E+CG + M    R      L   +++ E        G K W +  +L + + ++
Sbjct: 152 VTLRISENCGRNAMPSTYREFQINNLKKIVKLFEPSLTNDNLGWKTWGSSLILSNILCDR 211

Query: 65  SDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVAL-LEKQFFHKGIKVTITDIDQLVP 123
            DE+ L       K    + I+ELGSGTGLVG+ VA  LE+       ++ +TD+ ++V 
Sbjct: 212 IDENFL-------KSFNGKRILELGSGTGLVGISVASKLEEIGVLDEYEIYLTDLPEIVT 264

Query: 124 LMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEK 179
            ++KNI +N +   ++++ L W  P S  F  +       T  D++L +D +Y  K
Sbjct: 265 NLEKNISINQLANRVVSDVLDWTNPES--FVSNYGD----TRFDVLLISDPIYSSK 314

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 85/187 (45%), Gaps = 23/187 (12%)

Query: 2   NEIFGSFGDLVVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVW--- 51
           NEI       + +R  E+CG        R      LN A+ ++E        G K W   
Sbjct: 166 NEIVQQLLRELSSRISENCGRTAQPSIIRYFELKNLNSAIPLYEPSLTADNLGWKTWGSS 225

Query: 52  -VAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFH-K 109
            +  +LL DY+   +      AN  T +++    ++ELGSGTGLVGL  A   K+ +   
Sbjct: 226 LILSQLLVDYL--HTTGMPPAANCGTKRIK----VLELGSGTGLVGLSWAAKWKELYGIH 279

Query: 110 GIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLI 169
            I++ +TD+ ++V  ++KN+ LN +   + AE L W  P +                D+I
Sbjct: 280 NIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNPQNFI-----NQFGHEMDFDII 334

Query: 170 LAADCVY 176
           L AD +Y
Sbjct: 335 LVADPIY 341

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 77/153 (50%), Gaps = 18/153 (11%)

Query: 30  RLNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKV--QKFRNII 86
           RL   + ++E        G K W +  +L   +++K      L   +  KV    FR ++
Sbjct: 205 RLQTTVTLYEPSLTNDNLGWKTWGSSLILSRILIDK------LPFPEPPKVGHPPFR-VL 257

Query: 87  ELGSGTGLVGLCVALLEKQFF---HKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEEL 143
           ELGSGTGLVG+  A   ++ +      +++ +TD+ ++V  ++KN++LN +   ++A+ L
Sbjct: 258 ELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVL 317

Query: 144 WWGEPLSGAFAPHSEGLSKVTSVDLILAADCVY 176
            W  P +       E  +   S DLIL AD +Y
Sbjct: 318 DWTNPYN-----FIERYNGEQSFDLILVADPIY 345

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 14/145 (9%)

Query: 34  ALQIHEDG-GESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGT 92
            +Q++E        G K W A  +L   +V       L  N D   +   R ++ELGSGT
Sbjct: 207 VIQLYEPSLTADNLGWKTWGASLILSQKVVNL-----LEKNKDQKHIHPLR-VLELGSGT 260

Query: 93  GLVGLCVALLEKQFF-HKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSG 151
           GLVG+  A   +Q F  + I++ +TD+  +V  ++KN++ N + T + A+ L W  P   
Sbjct: 261 GLVGIAWASKWRQSFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP-DD 319

Query: 152 AFAPHSEGLSKVTSVDLILAADCVY 176
               H +        D+IL AD +Y
Sbjct: 320 FIEKHGD-----EKFDVILVADPIY 339

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 21/154 (13%)

Query: 31  LNPALQIHEDG-GESGCGGKVW----VAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNI 85
           LN A+ ++E        G K W    +  +LL DY+        +  +   S  QK   +
Sbjct: 202 LNNAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYL------HTVGVHITASCNQKKIKV 255

Query: 86  IELGSGTGLVGLCVALLEKQFF-HKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELW 144
           +ELGSGTGLVGL  A   K+ +    +++ +TD+ ++V  ++KN+ LN +   + AE L 
Sbjct: 256 LELGSGTGLVGLSWASKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILD 315

Query: 145 WGEP--LSGAFAPHSEGLSKVTSVDLILAADCVY 176
           W  P      F   +E        D+IL AD +Y
Sbjct: 316 WTNPQDFIDRFGHENE-------FDIILVADPIY 342

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 27/157 (17%)

Query: 29  GRLNPALQIHEDGGES-GCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIE 87
           G L   +++HE    S   G K W A  +L   + E         N+   + Q+   I+E
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCE---------NFSKFERQRDLRILE 248

Query: 88  LGSGTGLVGLCVAL--LEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNT----EMIAE 141
           LG+GTGLVG+ + L  LE    H    + +TD+ ++V  +++N+++NC N+    ++ A+
Sbjct: 249 LGAGTGLVGISLVLKMLESNSGH-NCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYAD 307

Query: 142 ELWWGEPLS--GAFAPHSEGLSKVTSVDLILAADCVY 176
            L W  P S    +  H          D++L AD VY
Sbjct: 308 VLDWTNPDSFEKTYGAH--------KFDVLLIADPVY 336

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 31/179 (17%)

Query: 12  VVARPIEHCGSHDMSFGGR------LNPALQIHEDGGES-GCGGKVWVAGELLCDYIVEK 64
           V  R  E CG        R      L  ++++HE    S   G K W A  +L   I +K
Sbjct: 179 VSLRISEKCGRTAQPAMNRTFEVSGLATSIELHEPALTSDNLGLKTWGASLVLARKICQK 238

Query: 65  SDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF---FHKGIKVTITDIDQL 121
                 L+ ++ S  +  R I+ELG+GTGLVG  +A ++K       +  +V +TD+  +
Sbjct: 239 ------LSTFEPS--ENLR-ILELGAGTGLVG--IAFIQKILEVGSTQKFRVHLTDLPDI 287

Query: 122 VPLMQKNIELN-C---VNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVY 176
           VP +QKN++LN C    N E+  + L W +P S        G  K    D++L AD +Y
Sbjct: 288 VPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSSFQ---EKYGYKK---FDVLLIADPIY 340

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 95/213 (44%), Gaps = 26/213 (12%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVA 100
              S  G + W A   + D+++ +      L        +K  N++E+G+GTG+V L + 
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEP-----LLELVHGDDKKKLNVLEIGAGTGIVSLVLL 183

Query: 101 LLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCV----NTEMIAEELWWGEPLSGAFAPH 156
              +++  K + VT  D D +   +++N ELN      + ++  + LWWG        P 
Sbjct: 184 HKYREYVSK-MYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWG----SDRVPD 238

Query: 157 SEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRR-NADKRFF 215
                    V+L++AAD  Y    FP L + L +    S   V L++   R  + DK F 
Sbjct: 239 --------EVNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSYSTDKEFA 290

Query: 216 R---KIGKHFTVREITDFSTYDQYLKQRTHLFE 245
           +   K+G  ++V   T++    +   + + LF+
Sbjct: 291 QECHKVGLKYSVVTSTEYDRNSEARMEESLLFK 323

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 80/182 (43%), Gaps = 31/182 (17%)

Query: 2   NEIFGSFGDLVVARPIEHCGSHDMSFGGR------LNPALQIHEDGGES-GCGGKVWVAG 54
           NE+         +R  E CG        R      L+ +++++E    S   G K W + 
Sbjct: 165 NELANQILQQASSRISERCGRTAQPSMTRTFKLEGLDTSIKLYEPALTSDNLGLKTWGSS 224

Query: 55  ELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVT 114
            +L   I+                +   + ++ELGSGTGLVG+  AL      +    + 
Sbjct: 225 LMLSQKII---------------GIPAGKRVLELGSGTGLVGISYALTHS--INGDSVIF 267

Query: 115 ITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADC 174
           +TD+ +++P +Q N+ LN +N ++ A+ L W +PLS      +E        D I+ AD 
Sbjct: 268 LTDLPEILPNLQYNVRLNNLN-DVTADVLDWTDPLSFTEKYGNEPF------DTIVIADP 320

Query: 175 VY 176
           +Y
Sbjct: 321 IY 322

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 65/149 (43%), Gaps = 37/149 (24%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   L +Y+V+         N +     +F  I+ELG+GTGL    V+L+  Q 
Sbjct: 134 GFRTWEAALYLAEYLVQ---------NQEYYAQDRFSRILELGAGTGL----VSLVWSQL 180

Query: 107 FHKGIK-VTITDIDQLV--PLMQKNIELNCVNT--------EMIAEELWWGEPLSGAFAP 155
           F   +K + +TD D  +    ++ N +LN V          +   + LWWGE +      
Sbjct: 181 FQATMKELYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKFQRLWWGEDV------ 234

Query: 156 HSEGLSKVTSVDLILAADCVYLEKAFPLL 184
                  V  VD++LAAD  Y     P L
Sbjct: 235 -------VPDVDIVLAADVTYDASVVPSL 256

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (51%), Gaps = 13/135 (9%)

Query: 85  IIELGSGTGLVGLCVA--LLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTE----M 138
           ++ELGSGTGLVG+  +    E +      ++ +TD+ ++VP +QKN+E+N +N++    +
Sbjct: 251 VLELGSGTGLVGITFSCKYKESKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAV 310

Query: 139 IAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPP 198
            A+ L W  P+S        G  K    D+IL AD +Y     P+   T++D     K  
Sbjct: 311 CADVLDWTNPVSFT---EKYGDDK---FDVILIADPIY-SPQHPVWVVTMIDKFLSEKGK 363

Query: 199 VILMAYRKRRNADKR 213
           V L    + + A +R
Sbjct: 364 VYLEVPIRPKYAQER 378

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 61/149 (40%), Gaps = 30/149 (20%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W +   L +Y+ E         N+      KF   +ELG+GTGLV +  A L K +
Sbjct: 124 GFRTWESALYLSEYLAE---------NFPEFSAGKFSRALELGAGTGLVSIAWAKLFKGY 174

Query: 107 FHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIA-------EELWWGEPLSGAFAPHSEG 159
             K + VT  D   +    + N +LN ++T           + LWWGE            
Sbjct: 175 I-KELIVTDGDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGE------------ 221

Query: 160 LSKVTSVDLILAADCVYLEKAFPLLEKTL 188
              V  VD++LAAD  Y     P L   L
Sbjct: 222 -DAVPEVDIVLAADVTYDSSVIPSLTHCL 249

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 73/172 (42%), Gaps = 40/172 (23%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   LC Y+  +        +W    + +   ++E+G+GTGLV   +AL     
Sbjct: 117 GHRTWEASLYLCQYLFRQ--------DW----LPQVNEVLEIGAGTGLVSTALAL----- 159

Query: 107 FHKGIKVTITDIDQL-VPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTS 165
              G +VT TD D + V  ++K   LN VN E  A+ L W             GL K   
Sbjct: 160 --AGHQVTSTDGDPMVVEQLRKTFNLNEVNIE--AQVLEW-------------GLQKPPK 202

Query: 166 VDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRK 217
            DL++AAD  Y     P L   L +    +     L+A   R +    FF++
Sbjct: 203 SDLVVAADVTYDTAVIPSLGNCLRECKTTA-----LVACTIRNSETITFFQE 249

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 73/179 (40%), Gaps = 31/179 (17%)

Query: 44  SGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLE 103
           S  G + W A   LCDYI          +N DT  +     ++ELG+GTGL  L   LL+
Sbjct: 113 STTGFRTWEAASYLCDYI----------SNVDTESLNGCSTVLELGAGTGLCSL--TLLK 160

Query: 104 KQFFHKGIKVTITDID------QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS 157
            +F     KV +TD D      QL+   + N   + +  ++  + L WGE          
Sbjct: 161 GKFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGED--------- 211

Query: 158 EGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRR-NADKRFF 215
              S    +D ++ AD  Y +  F  L K L          + L+A   R    D++F 
Sbjct: 212 ---SIPNDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFL 267

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 81/170 (47%), Gaps = 23/170 (13%)

Query: 15  RPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEKSDE 67
           R  E+CG   +    R       +  ++I+E        G K W +  +L   +++    
Sbjct: 166 RICENCGRTALPTMSRRFTFENFSRNIEIYEPSLTADNLGWKTWGSSFILSQKLIK---- 221

Query: 68  DDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFF-HKGIKVTITDIDQLVPLMQ 126
             ++ +++ +K+ +   ++ELGSGTGL G+   +   +   +  I++  TD+ ++VP ++
Sbjct: 222 --IVPHFNPTKLHR---VLELGSGTGLAGISWLMKWIEIHGNSNIEMFFTDLQEIVPNLR 276

Query: 127 KNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVY 176
           KN+E+N ++   + + L W  P        SE        D+I+ +D +Y
Sbjct: 277 KNVEINGISDNSVVDTLDWTCPEDFVDKYSSEKF------DIIIVSDPIY 320

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 32/186 (17%)

Query: 2   NEIFGSFGDLVVARPIEHCG---SHDMSFGGRLN---PALQIHEDGGES-GCGGKVWVAG 54
           N        +V  R  E CG      M+   R+N     ++++E    S   G K W + 
Sbjct: 157 NPELTQLSTIVAKRIAELCGRTAQPSMTRDFRINNLEKTIKLYEPALTSDNLGHKTWGSS 216

Query: 55  ELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVT 114
            +L + I         L N   S   +   ++ELGSGTGLVG+   +     F    +V 
Sbjct: 217 LVLANRI-------PTLENCSGSSKPR---VLELGSGTGLVGITYTISHSNEFS---QVF 263

Query: 115 ITDIDQLVPLMQKNIELNCVNT--EMIAEELWWGEPLSGAFAPHSEGLSKVTSV--DLIL 170
           +TD+ ++VP ++ N +LN ++T   +IA+ L W          H   + K   +  D+IL
Sbjct: 264 LTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDWTN--------HDSFVEKYGDIQFDIIL 315

Query: 171 AADCVY 176
            AD +Y
Sbjct: 316 IADPIY 321

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 78/181 (43%), Gaps = 29/181 (16%)

Query: 15  RPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEKSDE 67
           R  E+CG        R      L+  ++++E        G K W +  +L   +V     
Sbjct: 194 RVSENCGRTAQPSMTREFKMDNLDQTVKLYEPSLTADNLGWKTWGSSLILSQKMV----- 248

Query: 68  DDLLANWDTSKVQ--KFRNIIELGSGTGLVGLCVALLEKQFFH-------KGIKVTITDI 118
            + L N+  S     K R I+ELG+GTGLVG+  +   K+             ++ +TD+
Sbjct: 249 -NFLNNYKYSNQSDDKLR-ILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDL 306

Query: 119 DQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLE 178
            ++V  +Q+NI +N +N    A  L W  P S      +E        D+IL AD +Y  
Sbjct: 307 PEIVGNLQRNISINNLNDIARASVLDWTNPKSFIQEYSNEKF------DIILVADPIYSP 360

Query: 179 K 179
           K
Sbjct: 361 K 361

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 73/159 (45%), Gaps = 42/159 (26%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLV--GLCVALLEK 104
           G + W A   +  + VE    D +      SK    +NI+ELG+GTGLV  GLC     K
Sbjct: 140 GFRTWEAALFMTSFFVETGYLDTM------SK----KNILELGAGTGLVSIGLC-----K 184

Query: 105 QFFHKGIKVTITDID-QLVP-LMQKNIELNCV--NTEMIAEELWWG---EPLSGAFAPHS 157
           Q+     K+ +TD D QLV   + KN   N +  N  +I ++LWW     PL        
Sbjct: 185 QYEDSIDKIYVTDGDSQLVEGQLLKNFNENELSHNDRVILQKLWWNVDDVPL-------- 236

Query: 158 EGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSK 196
                   +DLI+AAD  Y     P L +T   ++NC K
Sbjct: 237 -------DLDLIVAADVTYDSSVVPDLCET---ISNCFK 265

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 11/106 (10%)

Query: 83  RNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEE 142
           + ++ELG+GTGLVG+  AL           V +TD+ ++VP ++ N+ LN + T + A  
Sbjct: 230 KRVLELGAGTGLVGIAYALANID----ADDVFVTDLPEIVPNLRHNLALNNL-TNVRASV 284

Query: 143 LWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTL 188
           L W +P S     H E        D I  AD +Y      LL +T+
Sbjct: 285 LDWSDPTS-FLHEHGE-----LQFDAIFVADPIYSPNHPQLLVQTV 324

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 61/141 (43%), Gaps = 25/141 (17%)

Query: 47  GGKVWVAGELLCDYIVEKSDE--DDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEK 104
           G + W A   L  ++ + SDE  D+L  +  T        ++ELG+GTG+V +  A L+ 
Sbjct: 142 GFRTWEAALYLSQHLCKNSDEIMDELGKDQIT--------VVELGAGTGIVSMTWAKLQH 193

Query: 105 QFFHKGIKVTITDIDQLVPLMQKNIELNCV-NTEMIAEELWWGEPLSGAFAPHSEGLSKV 163
               K + VT  D   +   M +N +LN V   +   ++LWW                 V
Sbjct: 194 NRLEK-LYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWNS-------------DDV 239

Query: 164 TSVDLILAADCVYLEKAFPLL 184
              DLILAAD  Y     P L
Sbjct: 240 PDNDLILAADVTYDSSVIPDL 260

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 84/187 (44%), Gaps = 27/187 (14%)

Query: 2   NEIFGSFGDLVVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVW--- 51
           NE        V  R  E+CG        R      L+  + +HE        G K W   
Sbjct: 159 NEYVKRILKEVSLRIAENCGRTAQPAIQRKFRIKNLDKTIMLHEPSLTADNLGWKTWGSS 218

Query: 52  -VAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLC-VALLEKQFFHK 109
            + GE++  Y+      ++L + +++++  K R + ELG+GTGLVG+   A    +F + 
Sbjct: 219 LILGEIVVSYL------ENLSSTFESNR--KVRTL-ELGAGTGLVGIAWAAKWRDKFCNS 269

Query: 110 GIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLI 169
             ++ +TD+ ++V  ++ N+++N +     A+ L W  P +      +E        D I
Sbjct: 270 KTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNPDTFTEKYGNERF------DYI 323

Query: 170 LAADCVY 176
           + AD +Y
Sbjct: 324 VIADPIY 330

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 95/218 (43%), Gaps = 29/218 (13%)

Query: 12  VVARPIEHCG-------SHDMSFGGRLNPALQIHEDG-GESGCGGKVWVAGELLCDYIVE 63
           V  R  E+CG       S   +F G  +P ++I+E        G K W A  +L   ++ 
Sbjct: 172 VSLRIAENCGRTAQPAMSRKFTFEGLPSP-IEIYEPSLTADNLGWKTWGASFILSQKLI- 229

Query: 64  KSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKG-IKVTITDIDQLV 122
                ++LA    S       ++ELGSGTGL G+       Q +  G  ++ +TD+  +V
Sbjct: 230 -----NVLAE---STFNFKPRVLELGSGTGLAGISWLCKWVQKYGNGHTEIFLTDLPVIV 281

Query: 123 PLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVT--SVDLILAADCVYLEKA 180
             +QKN+E+N V +      L W +P        ++ ++  T    D+++ +D +Y    
Sbjct: 282 ANLQKNVEVNKVESFATVSALDWTDP--------TDFINSYTDDEFDILIVSDPIYSPNH 333

Query: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKI 218
             L+   +    +      + +  R R  A+++  R++
Sbjct: 334 PELVVNMIKKFLSSQGQCYLEIPLRPRYAAERKRLRQL 371

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 87/203 (42%), Gaps = 22/203 (10%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVA 100
              S  G + W A   + D+++ K  ++ L         +K  N++E+G+GTG+V L + 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQE-LAPVQGQDDGKKKLNVLEVGAGTGIVSLVIL 185

Query: 101 LLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTE----MIAEELWWGEPLSGAFAPH 156
               +F +K + VT  D + +   +++N ELN    E    +  + LWWG        P 
Sbjct: 186 QKYHEFVNK-MYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWG----SDRVPE 240

Query: 157 SEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFF- 215
                    +DL++ AD  Y     P L + L +     +  + L++   R  +  + F 
Sbjct: 241 --------DIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLFS 292

Query: 216 ---RKIGKHFTVREITDFSTYDQ 235
               K+G   T+   T++   ++
Sbjct: 293 QECNKLGLKCTIVTSTEYDANNE 315

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 38/170 (22%)

Query: 78  KVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNTE 137
           ++     ++ELG+GTGLVG+  A+  +       ++ +TD+  +VP ++ NI+LN +   
Sbjct: 233 RIPACEKVLELGAGTGLVGISYAIAHQA---STPQIILTDLPDIVPNLRSNIKLNNLKNV 289

Query: 138 MIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKP 197
             AE  W     S   A H  G  K    D+IL +D +Y                   + 
Sbjct: 290 HAAELDWTDH--STFIAQH--GGDK---FDMILVSDPIY-----------------SPQH 325

Query: 198 PVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFELI 247
           P+ L       N   RF    G+ +      +     +Y  +R HL++L+
Sbjct: 326 PIWLT------NTIARFLSPQGRVY-----IELPIRTRYANERQHLWDLL 364

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 63/154 (40%), Gaps = 27/154 (17%)

Query: 42  GESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVAL 101
            +   G + W A   LC Y+ +      L    D+        ++ELG GTG++ +   +
Sbjct: 110 AQGTTGFRTWEAALFLCHYMTQHPG---LFVTHDSL-------MLELGCGTGIISILYKM 159

Query: 102 L-EKQFFHKGIKVTITDID-QLVPLMQKNIELNCV-----NTEMIAEELWWGEPLSGAFA 154
           + + Q   K   + +TD D  L+  +  N +LN       +  +  + L W E       
Sbjct: 160 IKDSQGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNE------- 212

Query: 155 PHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTL 188
              + LS    +DLILAAD  Y     P L K L
Sbjct: 213 ---DELSNYNEIDLILAADVTYDTSVIPDLVKCL 243

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 71/179 (39%), Gaps = 33/179 (18%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   L   +VE  +            + + + ++ELG GTGL  + V +L++  
Sbjct: 107 GFRTWRAATSLSKLLVEHRE------------LTRGKTVLELGCGTGLSSITVGVLDE-- 152

Query: 107 FHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSV 166
            +K + VT  D   L  +   N+ LN V  ++  + L W    S    P          +
Sbjct: 153 -YKKLYVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWA---SEDRVPG--------DI 200

Query: 167 DLILAADCVYLEKAFPLLEKTLLDLTNCSKPP----VILMAYRKRRNADKRFFRKIGKH 221
           D+++ AD  Y    FP L  T LD   C + P     IL    + R        +  +H
Sbjct: 201 DVVVGADITYDPTVFPEL-CTCLD--ECLQQPKCQCAILACTERNRETVHELHSQCAQH 256

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 24/179 (13%)

Query: 12  VVARPIEHCGSHDMSFGGR------LNPALQIHEDG-GESGCGGKVWVAGELLCDYIVEK 64
           VV R  E+CG        R      L+  ++++E        G K W +  +L  Y++  
Sbjct: 173 VVQRISENCGRTAQPSMTREFKLENLHHIVKLYEPSLTADNLGWKTWGSSLVLSQYLINN 232

Query: 65  SDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFH-------KGIKVTITD 117
            ++     N +   V+K R ++ELG+GTGLVG+      K+          + +++ +TD
Sbjct: 233 FNK---YINVNNCHVRKVR-VLELGAGTGLVGISWGCKWKEEVTSAGNENLQNMELFLTD 288

Query: 118 IDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVY 176
           + ++   + KN+  N ++     + L W +P S     H+E          IL AD +Y
Sbjct: 289 LPEITNNLAKNVSTNELSDFCKVDVLNWTDPTSFTNT-HTE-----EPFQYILIADPIY 341

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 72/181 (39%), Gaps = 19/181 (10%)

Query: 45  GCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEK 104
             G + W A   L  Y++++           ++ V     I+ELGSGTGLV L   L ++
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCA---------SNVVAAPSRILELGSGTGLVSL---LYQQ 176

Query: 105 QFFHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVT 164
            +    + +T  D D +   +  N+ LN +   +  ++L WG P       +        
Sbjct: 177 LYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWG-PRDANSGDNQ------W 229

Query: 165 SVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTV 224
             DLIL +D  Y ++    L + L  L         L+    R  A    F K  + + +
Sbjct: 230 DYDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFEKYMREYKL 289

Query: 225 R 225
           +
Sbjct: 290 Q 290

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 31/174 (17%)

Query: 85  IIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID-QLVPLMQKNIELNCVNTE-MIAEE 142
           ++ELG+GTG+V   +AL          K+ +TD D  L    +KN  LN + T     E+
Sbjct: 162 VLELGAGTGMVSATLALTNPGRLD---KLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQ 218

Query: 143 LWWGE-PLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFP----LLEKTLLDLTNCSKP 197
           L W E P+              T +D ++AAD  Y     P     + ++L   T C   
Sbjct: 219 LRWNEDPVP-------------TKLDYVVAADVTYDSTVVPDLCKCIAQSLTPRTTC--- 262

Query: 198 PVILMAYRKRRNADKRF---FRKIGKHFTVREITDFSTYDQYLKQRTHLFELIR 248
             ++ A  +  N    F    +++G    ++  T+     Q L ++T LF  ++
Sbjct: 263 --LVAATVRNENTTSTFESTAKEMGLDCQLQMTTETDYRSQSLLEKTLLFRPLQ 314

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 30/170 (17%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   L  Y+++     + +            N +ELGSGTG+V +    L K++
Sbjct: 142 GFRTWEAAVYLTKYLIDLGFPPETV----------MENTLELGSGTGMVSIG---LVKKY 188

Query: 107 FHKGIKVTITDIDQ--LVPLMQKNIELNCVNT--EMIAEELWWGEPLSGAFAPHSEGLSK 162
             +   + ITD D   L   + +N+ LN +++   +  ++L W E       P       
Sbjct: 189 KDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNED----HIPD------ 238

Query: 163 VTSVDLILAADCVYLEKAFPLLEKTLLD-LTNCSKPPVILMAYRKRRNAD 211
             ++DLI+AAD  Y     P L   +LD   + +K   +      RRN +
Sbjct: 239 --NLDLIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQE 286

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 17/98 (17%)

Query: 84  NIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQ--KNIELNCV--NTEMI 139
           N++E+G+GTG+V + +  ++ Q       V +TD D+ V   Q  KN +LN +  +T + 
Sbjct: 148 NVVEIGAGTGMVSIGIMKMQGQNIS---SVLVTDGDEYVANKQLPKNFQLNGIVDDTRVK 204

Query: 140 AEELWWGEP-LSGAFAPHSEGLSKVTSVDLILAADCVY 176
            +++ W E  L     P+         VD ++ AD  Y
Sbjct: 205 FQKIRWNEDHLVNGDGPN---------VDYLVGADVTY 233

>ACL114W Chr3 (144800..145759) [960 bp, 319 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJR107W
          Length = 319

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 106 FFHKGIKVTITDIDQLVPLMQKNIELNCVNT---EMIAEELWWGEPLS 150
           + H GI  TITD+D  VPL Q  + L+  NT   E++ + L+ G+ LS
Sbjct: 248 YTHAGILFTITDVDSEVPL-QSGVRLDGCNTKLKELVGDILFSGKLLS 294

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 145 WGEPLSG---AFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTN-CSKPPVI 200
           WG   +    +  P  EG    T+  L+L ++ +Y  +  PL+ +TLLDL      P  +
Sbjct: 274 WGRKFTDIVHSLLPQCEG---TTAASLVLTSETIYQPENLPLITETLLDLKGYIGGPTTV 330

Query: 201 LMAYR 205
           L+A +
Sbjct: 331 LVAAK 335

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 52/146 (35%), Gaps = 46/146 (31%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQF 106
           G + W A   LC Y+ E                 +F  ++ELG+GTG+V L    L+   
Sbjct: 131 GFRTWEAALYLCHYLCESR--------------PRFGTMLELGAGTGIVSLTWHKLQSGQ 176

Query: 107 FHK----------GIKVTITDIDQLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPH 156
           F            G ++  T I   V L + N+ L         + L W           
Sbjct: 177 FMTYATDGDKNIIGKQLKETFISNGVDLDKGNVHL---------QRLLW----------- 216

Query: 157 SEGLSKVTSVDLILAADCVYLEKAFP 182
              +  +   D+ILAAD  Y   A P
Sbjct: 217 --NVDSIPKNDIILAADVTYDHTAIP 240

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 55/139 (39%), Gaps = 34/139 (24%)

Query: 47  GGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNI-IELGSGTGLVGLCVALLEKQ 105
           G + W A   L DY+                +V   +++ +ELG+GTGLV L  A L  +
Sbjct: 129 GHRTWEAALYLADYLC---------------RVPLRQSVALELGAGTGLVSL--AWLRSR 171

Query: 106 FFHKGIKVTITDIDQLVPLMQKNIELNCVNTEMIA--EELWWGEPLSGAFAPHSEGLSKV 163
                  +T  D   L   + +N+ LN + +   A    LWW              + +V
Sbjct: 172 -PESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWW-------------NVDEV 217

Query: 164 TSVDLILAADCVYLEKAFP 182
              D++LAAD  Y     P
Sbjct: 218 PQNDIVLAADVTYDSTVLP 236

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 41  GGESGCGGKVWVAGELLCDYIVEKSDEDDLLANWDTSKVQKFRNI 85
           G   G    + + GEL   YI+ KS  D  + N D   +QK +N+
Sbjct: 613 GTNKGVALTMLLEGELAASYILAKSIRDSEVENHDPRTIQKLKNM 657

>TBLA0G02490 Chr7 complement(647049..648155) [1107 bp, 368 aa] {ON}
           Anc_2.259 YIL110W
          Length = 368

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 44/170 (25%)

Query: 79  VQKFRNIIELGSGTGL-VGLCVALLEKQFFHKGIKVTITDI------------------- 118
           ++KF N+IELG GT L          K   + G+K+ ++D                    
Sbjct: 150 LKKFDNLIELGCGTSLPTEFLFGHYLKSNSNDGLKILLSDYNYSVLRLVSIPNLVITWAK 209

Query: 119 ---------------DQLVPLMQKNIELNCVNTEMIAEELWWG----EPLSGA----FAP 155
                          D+ +P+    I+ +    E   E+L       E +SG+    F+ 
Sbjct: 210 FTLSETECEILQKHQDENMPIRDDEIQFSAKLLETFHEDLKRRNITIELVSGSWGRKFSN 269

Query: 156 HSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLDLTNCSKPPVILMAYR 205
            +E + K +S +L+L ++ +Y     P++ +T+LD    +K   IL+A +
Sbjct: 270 LTENILKNSS-NLVLTSETIYQPITLPVVAETILDYLRIAKDSQILVAAK 318

>NCAS0D03000 Chr4 (570300..571064) [765 bp, 254 aa] {ON} Anc_6.79
           YLR285W
          Length = 254

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 66/153 (43%), Gaps = 21/153 (13%)

Query: 81  KFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNT---- 136
           K +N++ELG+   L  L  AL+       G K+ ++  D   P +  NI+ N  +     
Sbjct: 81  KGKNVLELGAAGALPSLISALI-------GAKMVVS-TDYPDPDLLSNIQYNVDHVVPKD 132

Query: 137 --EMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLD-LTN 193
              ++ E   WG         H +G  K    DLI+ +D V+       L KT  D L  
Sbjct: 133 FKNIVVEGYIWGNEYDDLIK-HIDGDKK---FDLIILSDLVFNHTEHHKLLKTTRDLLAK 188

Query: 194 CSKPPVILMAYR-KRRNADKRFFRKIGKHFTVR 225
             K  V+   +R K  ++D +FF +  K F ++
Sbjct: 189 DGKALVVFSPHRPKLLDSDLQFF-ETAKEFGLK 220

>KLLA0D16753g Chr4 (1418383..1419351) [969 bp, 322 aa] {ON} similar
           to uniprot|Q12367 Saccharomyces cerevisiae YLR137W
           Hypothetical ORF
          Length = 322

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 45/110 (40%), Gaps = 17/110 (15%)

Query: 34  ALQIHEDGGESGCGGKVWVAGELLCDYIVEK-----------SDEDDLLANWDTSKVQKF 82
           +L  + D   S  G  +W     +  +++              DE D+ + +   +  K 
Sbjct: 75  SLNSNRDNNNSTTGYVIWTTSTFILKWLLYNDNATIFTRGGVKDEVDITSIFQCQQDDKL 134

Query: 83  RNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELN 132
           R ++ELG+GT  +   V      F +   K   TD   ++P ++ NI+ N
Sbjct: 135 RYVLELGTGTSPMFPIV------FSNYVDKYVATDQKDILPRLKDNIQEN 178

>Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W
           (REAL)
          Length = 284

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 56/150 (37%), Gaps = 16/150 (10%)

Query: 81  KFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQKNIELNCVNT---- 136
           K + ++ELG+   L  +  AL   Q         +   D   P + +NIE N  +     
Sbjct: 104 KGKAVLELGAAAALPSVICALNGAQM--------VVSTDYPDPDLMENIEYNIKSNVPEE 155

Query: 137 --EMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKTLLD-LTN 193
              +  E   WG   S   A   +  S +   DLI+ +D V+       L +T  D L  
Sbjct: 156 FGNVSTENYIWGNDYSPLLAHIEKVKSNIGKFDLIILSDLVFNHTEHHKLLQTTKDLLAE 215

Query: 194 CSKPPVILMAYR-KRRNADKRFFRKIGKHF 222
             K  V+   +R K    D  FF+     F
Sbjct: 216 NGKALVVFSPHRPKLLKKDLEFFQLANDEF 245

>Kwal_26.9424 s26 (1209573..1215443) [5871 bp, 1956 aa] {ON} YGR271W
           (SLH1) -  [contig 73] FULL
          Length = 1956

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 2   NEIFGSFGDLV---VARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLC 58
           ++IF SFGDL    V   IE   S   S GG +    Q+ E    S    K  V   LL 
Sbjct: 65  DDIFDSFGDLSKTKVLEAIESAASISNSSGGMIRELRQLLEKRNSSNMDTKTVVESILL- 123

Query: 59  DYIVEKSDEDDL 70
             +++ + ED L
Sbjct: 124 --LLQNNSEDSL 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,636,985
Number of extensions: 1130427
Number of successful extensions: 2530
Number of sequences better than 10.0: 67
Number of HSP's gapped: 2503
Number of HSP's successfully gapped: 67
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)