Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034708.850ON46646623830.0
KAFR0A028608.850ON4784749971e-131
Kwal_27.102048.850ON4944359071e-117
KLTH0C03608g8.850ON4954359071e-117
NDAI0E002608.850ON4984449061e-117
KNAG0K006508.850ON4824379041e-117
TBLA0B029008.850ON5204369061e-116
TDEL0B001908.850ON4924849031e-116
Skud_13.4588.850ON5144388991e-115
SAKL0D01166g8.850ON5054378961e-115
Smik_13.5018.850ON5154428951e-115
KAFR0L019608.850ON5114388891e-114
CAGL0I02684g8.850ON4934398781e-113
NCAS0B002708.850ON4764058761e-112
TPHA0I003208.850ON5294378791e-112
Suva_13.4758.850ON5154438761e-112
ZYRO0C14872g8.850ON4964338701e-111
NDAI0K003708.850ON5684398751e-111
YMR285C (NGL2)8.850ON5154438701e-111
NCAS0C003108.850ON5564418681e-110
Kpol_237.18.850ON5034448611e-110
ABL118W8.850ON5044338521e-108
Smik_13.168.850ON5024348521e-108
KLLA0C06248g8.850ON5164398471e-108
Suva_13.258.850ON5024268451e-107
YML118W (NGL3)8.850ON5054338411e-107
Skud_13.238.850ON4984348311e-105
Ecym_46198.850ON4874358181e-104
TBLA0D033008.850ON4804408141e-103
CAGL0B02387g8.850ON4714387314e-91
Ecym_73547.78ON7852221652e-11
ACR288W7.78ON7362181624e-11
Kpol_1040.147.78ON7842341608e-11
TDEL0H037307.78ON7972411599e-11
Skud_1.407.78ON8692351582e-10
TBLA0A046607.78ON8962271529e-10
KLTH0D02310g7.78ON7392191501e-09
Kwal_26.71127.78ON7422281473e-09
ZYRO0D05302g7.78ON8572271473e-09
YAL021C (CCR4)7.78ON8372341464e-09
Smik_1.457.78ON8392351447e-09
Suva_1.457.78ON8312411439e-09
SAKL0B10032g7.78ON7312241421e-08
KAFR0K006707.78ON7952231402e-08
KLLA0F07733g7.90ON3712381354e-08
TPHA0H026807.78ON8722291375e-08
KNAG0D048407.78ON7792281367e-08
KLLA0F15884g7.78ON7901951331e-07
CAGL0F01001g7.90ON3592321302e-07
Suva_15.1277.90ON3632321283e-07
KNAG0L005507.90ON3812461284e-07
Smik_15.1257.90ON3632321274e-07
YOL042W (NGL1)7.90ON3632341267e-07
Skud_15.1157.90ON3632321258e-07
TDEL0H036007.90ON3662351241e-06
NCAS0I005007.90ON3892351231e-06
CAGL0H06149g7.78ON8731881232e-06
Kwal_26.71707.90ON3722651142e-05
KAFR0D012507.90ON3562301133e-05
ZYRO0D05588g7.90ON3562521123e-05
ACR277C7.90ON3782551106e-05
Kpol_1044.67.90ON3722431097e-05
Ecym_26367.90ON3672131081e-04
NDAI0H025207.78ON8982161082e-04
NDAI0A085307.90ON3652321062e-04
KLTH0D02574g7.90ON3682651043e-04
TBLA0E022607.90ON3882071044e-04
SAKL0B09768g7.90ON3682381026e-04
NCAS0F016407.78ON85573960.005
TPHA0L005307.90ON391241800.26
KAFR0A068002.330ON58067741.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03470
         (466 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   922   0.0  
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   388   e-131
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   353   e-117
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   353   e-117
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   353   e-117
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   352   e-117
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   353   e-116
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   352   e-116
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   350   e-115
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   349   e-115
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   349   e-115
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   347   e-114
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   342   e-113
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      342   e-112
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   343   e-112
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   342   e-112
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   339   e-111
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   341   e-111
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   339   e-111
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      338   e-110
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   336   e-110
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   332   e-108
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   332   e-108
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   330   e-108
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   330   e-107
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   328   e-107
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   324   e-105
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   319   e-104
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   318   e-103
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   286   4e-91
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    68   2e-11
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    67   4e-11
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    66   8e-11
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    66   9e-11
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    65   2e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    63   9e-10
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    62   1e-09
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    61   3e-09
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    61   3e-09
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    61   4e-09
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    60   7e-09
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    60   9e-09
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    59   1e-08
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    59   2e-08
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    57   4e-08
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    57   5e-08
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    57   7e-08
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    56   1e-07
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    55   2e-07
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    54   3e-07
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    54   4e-07
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    54   4e-07
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    53   7e-07
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    53   8e-07
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    52   1e-06
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    52   1e-06
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    52   2e-06
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    49   2e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    48   3e-05
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    48   3e-05
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    47   6e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    47   7e-05
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    46   1e-04
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      46   2e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    45   2e-04
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    45   3e-04
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    45   4e-04
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    44   6e-04
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      42   0.005
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    35   0.26 
KAFR0A06800 Chr1 (1372990..1374732) [1743 bp, 580 aa] {ON} Anc_2...    33   1.7  

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/466 (94%), Positives = 442/466 (94%)

Query: 1   MVQKTKLPRSEITPEYIXXXXXXXXXXXXXXXXXXXXXXXXIFIKRPLLEVPYVGGVPCR 60
           MVQKTKLPRSEITPEYI                        IFIKRPLLEVPYVGGVPCR
Sbjct: 1   MVQKTKLPRSEITPEYIERIRALRREKREREKAERADVAREIFIKRPLLEVPYVGGVPCR 60

Query: 61  DGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRI 120
           DGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRI
Sbjct: 61  DGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRI 120

Query: 121 QWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIA 180
           QWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIA
Sbjct: 121 QWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIA 180

Query: 181 ATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKV 240
           ATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKV
Sbjct: 181 ATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKV 240

Query: 241 TDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNS 300
           TDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNS
Sbjct: 241 TDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNS 300

Query: 301 ILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVS 360
           ILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVS
Sbjct: 301 ILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVS 360

Query: 361 LYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWSENATKISDLQAL 420
           LYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWSENATKISDLQAL
Sbjct: 361 LYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWSENATKISDLQAL 420

Query: 421 ERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISLPL 466
           ERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISLPL
Sbjct: 421 ERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISLPL 466

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  388 bits (997), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 208/474 (43%), Positives = 292/474 (61%), Gaps = 26/474 (5%)

Query: 6   KLPRSEITPEYIXXXXXXXXXXXXXXXXXX--XXXXXXIFIKRPLLEVPYVGGVPCRDGY 63
           KLP+S+ITPE+I                           FIKR +L++P V  +   D  
Sbjct: 14  KLPKSQITPEFISKIRKLREKKRAENEENNPEFLNSKYDFIKRAILQLPNVEEL---DNS 70

Query: 64  VRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRIQWD 123
           V +KIMTYNTL+Q+LIRR  +PDA DAIKWH RS+V++ E++YY+ D++C QE D IQWD
Sbjct: 71  VDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIKYYNCDIMCFQEVDVIQWD 130

Query: 124 KFWVEEFDRLGYKGGFF-NFPG-KVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIAA 181
           KFW+ E  +LGY+G F+ +F G KVHGVAI W++++FE    D + +  DD VAG+ I+ 
Sbjct: 131 KFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQ--FDVIKINFDDIVAGNAISK 188

Query: 182 TTGTRTVALAVALRLK--HHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK 239
           TT T  V L VAL+ K  + K    I+  TTHLFWH FGTFERTRQL ++L +  K I  
Sbjct: 189 TTRTWNVGLIVALKFKSSNAKFRSGIVIGTTHLFWHPFGTFERTRQLAILLKKFRKLIDN 248

Query: 240 VTDAHCPR----GQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYS 295
           + +  C        R     TGDFNSQPCD PYLS+T KPV   G AK++IECS +Y++S
Sbjct: 249 L-NTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEAKTVIECSTAYKFS 307

Query: 296 KRR----NSILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLH 351
           +RR    NS  E D +   +   + E  EDE + P DPRP  ++A  EQ + +  L+ +H
Sbjct: 308 RRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATSEQKDLIAKLEKVH 367

Query: 352 NCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWSE-N 410
           N I L+  SL+GI Y  VH    N        EP+LSH ++ W+GLLDYIF++  W+E  
Sbjct: 368 NSINLKATSLFGIAYKKVHSIGLN-----CKNEPELSHTSIFWTGLLDYIFILEPWNEVE 422

Query: 411 ATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISL 464
            T    L+  E++  +++ G L+MP  +E+  + +PH+ +YPSDHL+M+CD+++
Sbjct: 423 KTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLSMICDLNV 476

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/435 (45%), Positives = 269/435 (61%), Gaps = 28/435 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI RP+L +         +G+V  KIMTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 77  FISRPMLPL---DSNYSPEGFV-FKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E  +Y ADV CLQE D IQ+  FW EEF +LGY   F     K HG+AIVWK  +F  T 
Sbjct: 133 EFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLF--TM 190

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTS-RPIIFSTTHLFWH 215
           +DK+ +  D   +G  +   T T+ V L +AL        K+  TS R I+  TTHLFWH
Sbjct: 191 VDKMLVDYDKEPSG-SLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWH 249

Query: 216 LFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
            FGTFERTRQ +V+L+++  FI +V    D   P  ++ Y FF GDFN+QP D PYLS++
Sbjct: 250 PFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQPFDTPYLSMS 308

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            KPV  K RAK++IECS SY +SK R+    DDE     E  + E   D   +P+ P P 
Sbjct: 309 SKPVVYKDRAKTVIECSTSYTFSKARDGEECDDE-----EGGNIEKFGD--GQPEHPVPD 361

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
           TY+A PEQ E VQ +  LHN + ++ +S+Y + Y  VHPEN+ + +T  + EP++S+ A 
Sbjct: 362 TYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNT--HNEPEISNWAE 419

Query: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDYIF I +W+  +  +  +LQ  E++  +KI   LRMP  EEM +H +PHE EY
Sbjct: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479

Query: 452 PSDHLAMMCDISLPL 466
            SDHL++MC+I L L
Sbjct: 480 GSDHLSLMCEIELNL 494

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 267/435 (61%), Gaps = 27/435 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI RP+L +         +G+V  K+MTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 77  FIHRPMLSL---NPSENANGFV-FKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E  +Y++DV+CLQE D IQ+  FW EEF++LGY+  F     K HG+AIVWK  MF  T 
Sbjct: 133 EFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMF--TM 190

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHH-------KTSRPIIFSTTHLFWH 215
           +DK+ +  D   +G  +   T T+ V LA+AL             + R II  TTHLFWH
Sbjct: 191 VDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWH 249

Query: 216 LFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
            FGTFERTRQ +V+L+++ +F+ ++    D    +    Y FF GDFNSQP D PYLS++
Sbjct: 250 PFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVS 309

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            KPV  KGRAK++IECS SY +SK R+    DDE     E  + E   D   +P+ P P 
Sbjct: 310 SKPVTYKGRAKTVIECSTSYTFSKARDGEECDDE-----EGGNIEKFGD--GQPEHPVPE 362

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
            + A  EQ   V+ + +LHN + ++G+S+Y +GY  VH EN+     + N EP++S+ A 
Sbjct: 363 KFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAG-LDNNFN-EPEISNWAE 420

Query: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDYIF I +W   +     +L+A + + GIKI G LRMP  +EM +H +PHE EY
Sbjct: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480

Query: 452 PSDHLAMMCDISLPL 466
            SDHL+MMC++ L +
Sbjct: 481 GSDHLSMMCELELKI 495

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  353 bits (906), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 266/444 (59%), Gaps = 41/444 (9%)

Query: 43  FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FIKRPLL +    P  G +        +KIMTYN LAQ+LI+R  FP +  A+KW RRS+
Sbjct: 72  FIKRPLLTLHDDDPVKGTM--------LKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSK 123

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ EL+YYD+D++ LQE D +Q+ ++W     +LGY   F+   GK+HGV I WK ++F
Sbjct: 124 VLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLF 183

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTS----RPIIFSTTHLFW 214
               +  LP+  D+ ++G  I   T T+ V L +AL   +   S    + +I  TTHLFW
Sbjct: 184 --AKVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFW 240

Query: 215 HLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDK 274
           HLFGTFERTRQ +V++ +++KF+KK+        ++ Y FFTGDFNSQP DAPY+S+T K
Sbjct: 241 HLFGTFERTRQCYVMMDQMDKFMKKLGGI-----EKWYPFFTGDFNSQPKDAPYVSITSK 295

Query: 275 PVQLKGRAKSIIECSLSYRYSKRRNSILE------------DDEDSMVREPSDQESVEDE 322
           PV  +   K +IECS +Y+YSK+RN   E            D  DS   E +D+E  E  
Sbjct: 296 PVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAE-TDEEKEEII 354

Query: 323 TNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVN 382
            N+P + RP  +    EQ E V  L  LHN + L+ +SLY +GY  V PEN+  Y  +  
Sbjct: 355 PNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA--YINNDR 412

Query: 383 QEPQLSHRALHWSGLLDYIFLITEW--SENATKISDLQALERQTGIKINGYLRMPLKEEM 440
            EP+LS  A  WSGLLDYIF +  W    N  K+  L+  ER+  +K+ G L+MP  +EM
Sbjct: 413 GEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEM 472

Query: 441 CDHTEPHENEYPSDHLAMMCDISL 464
           C+H  P++ EYPSDHL MM  + L
Sbjct: 473 CEHAIPYKGEYPSDHLCMMIQLEL 496

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  352 bits (904), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/437 (42%), Positives = 264/437 (60%), Gaps = 22/437 (5%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI+RP+L V   G +      + V +MTYN LAQ LIRR  FPD+  A+KW+RRSQVL+ 
Sbjct: 55  FIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLN 114

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           + ++Y+ DV+CLQE D +QW  FW  EF++LGY   F     K HGVA+VW++ +F  T 
Sbjct: 115 KFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLF--TM 172

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTSRP-IIFSTTHLFWH 215
            DK+ +  D   +G D+   T T    L +AL+        H  T R  I+  TTHLFWH
Sbjct: 173 ADKMLIDFDKEQSG-DVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWH 231

Query: 216 LFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
            FGTFERTRQ +V+L+++ +F+ +V    + +    Q  + FF GDFNSQP DAPYLS+T
Sbjct: 232 PFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMT 291

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            KPV   GRA+++IECS SY +SK+R+      ++       +        ++P  P P 
Sbjct: 292 SKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFG----KDQPHHPVPA 347

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
           T++   EQ   V  ++ LHN + ++ VSLY +GY  VHPEN+   + +   EP++S+ A 
Sbjct: 348 TFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAG--ADNARGEPEISNWAH 405

Query: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEM--CDHTEPHEN 449
            W+GLLDY+F +  W  ++ T +  L+  E+ +G+ +   LRMP K+EM    H +PH  
Sbjct: 406 TWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTG 465

Query: 450 EYPSDHLAMMCDISLPL 466
           EYPSDHLAM+CD+ L L
Sbjct: 466 EYPSDHLAMVCDLELAL 482

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/436 (44%), Positives = 268/436 (61%), Gaps = 28/436 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRP+L++     V    G+ +  +MTYN LAQ LIRR  FP+  DA+KWHRRS+VL+ 
Sbjct: 101 FIKRPILQMHENEPV---KGF-KFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLN 156

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E ++Y+ D++CLQE D +Q+  FW EEF +LGY+  F+  P K HGV++VWK  +FE T 
Sbjct: 157 EFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMT- 215

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR--------PIIFSTTHLFW 214
            D++ +  D  ++G DI   T T  +AL ++L+     T R         I+  TTHLFW
Sbjct: 216 -DRMLVDYDKELSG-DIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFW 273

Query: 215 HLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQ---RCYTFFTGDFNSQPCDAPYLSL 271
           H FGT+ERTRQ ++IL+++ +FI +V        +     Y FF GDFNSQP D+PYLS+
Sbjct: 274 HPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSM 333

Query: 272 TDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRP 331
           T KP++  GR+K++IECS S+++SK+R+    DDE+    E   ++       +PQ P P
Sbjct: 334 TSKPIKYSGRSKTVIECSTSFKFSKKRDGEEGDDEEGGNIEKFGKD-------QPQHPVP 386

Query: 332 YTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRA 391
             Y A  EQ   V  +Q LHN + ++ +SLY  GY  VHPENS     +   EP++S+ A
Sbjct: 387 DDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSG--IDNERNEPEISNWA 444

Query: 392 LHWSGLLDYIFLITEWSENATK-ISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENE 450
             W GLLDY+F I  W     K I  L+  ER+  IKI GYLRMP  +E+  H +P E E
Sbjct: 445 HIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGE 504

Query: 451 YPSDHLAMMCDISLPL 466
           YPSDHL M+C++ L L
Sbjct: 505 YPSDHLCMLCEVELCL 520

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  352 bits (903), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 275/484 (56%), Gaps = 43/484 (8%)

Query: 4   KTKLPRSEITPEYIXXXXXXXXXXXXXXXXXXXXXXX-------XIFIKRPLLEV----P 52
           K + PR E++PE++                                FIKRPLL +    P
Sbjct: 27  KNRNPRKEMSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEP 86

Query: 53  YVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVV 112
             G        +  K++TYN LAQ LIRR  FPD+ D++KW RRS+VL  E ++Y+ADV+
Sbjct: 87  IEG--------LSFKLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVL 138

Query: 113 CLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDD 172
           CLQE D IQ+ +FW +E D+LGY   F+  P K HGV+I WK  +F+ T  D++ +  D 
Sbjct: 139 CLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLT--DRMLIDYDK 196

Query: 173 YVAGDDIAATTGTRTVALAVALRLKH-------HKTSRPIIFSTTHLFWHLFGTFERTRQ 225
             +G  I   T T    L +AL+          H     I+  T+HLFWH FGT+ERTRQ
Sbjct: 197 ESSG-KIEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQ 255

Query: 226 LFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRA 282
            +V+L ++ +F+K+V    + +         FF GDFNSQP D PYLS+T KPV+  GRA
Sbjct: 256 CYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRA 315

Query: 283 KSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRPYTYDAMPEQV 341
           K+++ECS SY +SK RN            E  +  ++E    ++PQ P P T+DA PEQ 
Sbjct: 316 KTVVECSTSYTFSKLRNG-------EEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQ 368

Query: 342 ERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYI 401
           + V+ +Q LHN I ++ +SLY +GY  VHPENS     +   EP++S+ A  W GLLDYI
Sbjct: 369 KLVEEMQELHNSIDMRAISLYAVGYGEVHPENSG--IDNDRGEPEMSNWANTWRGLLDYI 426

Query: 402 FLITEW-SENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMC 460
            LIT+W S +  K+  L+  E++  +K+ G LRMP   EM  H +PHE EY SDHL+MMC
Sbjct: 427 LLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMC 486

Query: 461 DISL 464
            I L
Sbjct: 487 TIEL 490

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  350 bits (899), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 190/438 (43%), Positives = 266/438 (60%), Gaps = 29/438 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI+RPLL +    G P   G+ R K+MTYN LAQ LIRR  FPD+ DA+KW RRS+VL+ 
Sbjct: 92  FIQRPLLSLGE--GEPVT-GF-RFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLN 147

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E +YY+ADV+CLQE D IQ+  FW  +F+++GY G +   P K HGVAI+W+ SMF+   
Sbjct: 148 EFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQK-- 205

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRP---------IIFSTTHLF 213
           +DK+ +  D   +G  +  TT T  V L +AL+      S+          I+  TTHLF
Sbjct: 206 VDKMLIDYDKEASGSILTRTT-TNNVGLVLALKFSKEVLSKLGKKSSKKCGILIGTTHLF 264

Query: 214 WHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRG---QRCYTFFTGDFNSQPCDAPYLS 270
           WH FGT+ERTRQ +V+L ++ +F+ +V              + FF GDFNSQP D PYLS
Sbjct: 265 WHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLS 324

Query: 271 LTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPR 330
           +T KPV  K RAK++IECS S+++SK R+     +E +   E  + E      ++P+ P 
Sbjct: 325 MTSKPVHYKSRAKTVIECSTSFKFSKVRDG----EEGADDEEGGNIEKF--GKDQPESPV 378

Query: 331 PYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHR 390
           P  + A  EQ+E V  +  LHN + ++ +SLY +GY  VHPEN+     +   EP++S+ 
Sbjct: 379 PENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAG--LDNDRGEPEISNW 436

Query: 391 ALHWSGLLDYIFLITEW--SENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHE 448
           A  W GLLDY+F I +W    N  ++ +L   E++  IK  G+LRMP   EM  H +PH 
Sbjct: 437 ANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHV 496

Query: 449 NEYPSDHLAMMCDISLPL 466
            EYPSDHL+M+CD+ L L
Sbjct: 497 GEYPSDHLSMVCDLELQL 514

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/437 (44%), Positives = 262/437 (59%), Gaps = 35/437 (8%)

Query: 43  FIKRPLL----EVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FIKRPLL    E P  G         + KIMTYN LAQ LIRR  FP + +A+KW +RS+
Sbjct: 87  FIKRPLLCLHEEEPVKG--------FKFKIMTYNALAQALIRRKLFPSSGNAVKWFKRSK 138

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E ++YDADV CLQE D IQ+  FW EEF +LGY   F     K HGVAIVW+ S+F
Sbjct: 139 VLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAIVWRCSLF 198

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTH 211
             T +D + +  D   +G DI   T T+   L +AL+      ++        I+  TTH
Sbjct: 199 --TMVDTMLVDYDKEPSG-DIPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILIGTTH 255

Query: 212 LFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQ---RCYTFFTGDFNSQPCDAPY 268
           LFWH FGTFERTRQ +V+L+++ + I +V      + +     Y F  GDFNSQP D PY
Sbjct: 256 LFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPFDTPY 315

Query: 269 LSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQD 328
           LS+T KPV  +GRAK++IECS S+ +SK R+    +DE+    E   +        +P+ 
Sbjct: 316 LSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFGK-------GQPEH 368

Query: 329 PRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLS 388
           P P  + A  EQ   V+ +++LHN + ++ +SLY +GY  VHPEN+   + S   EP++S
Sbjct: 369 PVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDS--GEPEIS 426

Query: 389 HRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPH 447
           + A  W GLLDYIF +  W+  + + +  +   ER+ GIKI G LRMP  EEM  H +PH
Sbjct: 427 NWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPH 486

Query: 448 ENEYPSDHLAMMCDISL 464
           E EYPSDHL+MMC+I L
Sbjct: 487 EGEYPSDHLSMMCEIEL 503

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  349 bits (895), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/442 (42%), Positives = 264/442 (59%), Gaps = 37/442 (8%)

Query: 43  FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FIKRP L +    P  G         R K+MTYN LAQ LIRR  FPD+ DA+KW+RRS+
Sbjct: 93  FIKRPFLVLHEKEPVTG--------FRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSR 144

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E +YY ADV+CLQE D IQ+  FW +EF++LGY G ++    K HGVAI+W+  MF
Sbjct: 145 VLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMF 204

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR---------PIIFST 209
           +   +DK+ +  D   + ++I+  T T  V L +AL+      S           I+  T
Sbjct: 205 QQ--VDKMLIDYDKETS-ENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGILIGT 261

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266
           THLFWH FGT+ERTRQ +V+L ++ +F+ +V    + +       + FF GDFNSQP D 
Sbjct: 262 THLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDT 321

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRP 326
           PYLS+T KPV  K RAK++IECS S+++SK R+     DE +   E  + E      ++P
Sbjct: 322 PYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDG----DESADDEEGGNIEKY--GKDQP 375

Query: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386
           + P P  Y A  EQ+E V  +  LHN + ++ +SLY +GY  VHPEN+     +   EP+
Sbjct: 376 ESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAG--LDNDRGEPE 433

Query: 387 LSHRALHWSGLLDYIFLITEWS--ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHT 444
           +S+ A  W GLLDY+F + +W    N  ++ +L   E+   +K  G+LRMP  +EM  H 
Sbjct: 434 ISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHG 493

Query: 445 EPHENEYPSDHLAMMCDISLPL 466
           +PH  EY SDHL+M+CD+ L L
Sbjct: 494 QPHVGEYASDHLSMVCDLELEL 515

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  347 bits (889), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/438 (42%), Positives = 263/438 (60%), Gaps = 30/438 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI+RPLL +          G+   KIMTYN LAQ LIRR  FPD+ +A+KW RRS+VL+ 
Sbjct: 90  FIRRPLLALSKAESTA---GF-EFKIMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLN 145

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E +YYD+DV+CLQE DRIQ+  FW EEFD+LGY   F   P K HG++I+WK S+F  T 
Sbjct: 146 EFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISILWKRSLF--TM 203

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTHLFWH 215
            DK+ +  D  ++G +I   T T  V L +AL+       R        II  TTHLFWH
Sbjct: 204 TDKMLIDYDKEISG-NIPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGIIVGTTHLFWH 262

Query: 216 LFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQ---RCYTFFTGDFNSQPCDAPYLSLT 272
            FGT+ERTRQ +++L++  +F+ +V        +     YTFF GDFNSQP D PYLS+T
Sbjct: 263 PFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMT 322

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRP 331
            KPV+   RAK++IECS SY +SK R+            E  +  ++E    ++P  P P
Sbjct: 323 SKPVKYSNRAKTVIECSTSYTFSKSRDG-------EEDAEDEEGGNIEKFGKDQPATPVP 375

Query: 332 YTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRA 391
             +DA  EQ   V +++ LHN + ++ +SLY +GY  VH EN+   +T    EP++S+ A
Sbjct: 376 SFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNT--RGEPEISNWA 433

Query: 392 LHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCD--HTEPHE 448
             W+GLLDY+F+I  W   +  ++  L+  E +  +K+  +L+MP K EM    H +PH 
Sbjct: 434 HAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHV 493

Query: 449 NEYPSDHLAMMCDISLPL 466
            EYPSDHL+M+C + L L
Sbjct: 494 GEYPSDHLSMICKLELKL 511

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/439 (42%), Positives = 262/439 (59%), Gaps = 36/439 (8%)

Query: 43  FIKRPLL----EVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FI+R +L    E P  G        +++KIM+YN LAQ LIRR  FPD+ +A+KW+RRS+
Sbjct: 73  FIRRNMLKLHEEEPVEG--------LKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSR 124

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E ++YD DV+CLQE D IQ+  FW EEF +LGY   F   P K HGV I+WK   F
Sbjct: 125 VLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKF 184

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL---------KHHKTSRPIIFST 209
           E +  D++ +  D   +G DI   T T   AL +AL+          K       I+  T
Sbjct: 185 EMS--DRMLIDFDSEKSG-DIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGT 241

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266
           THLFWH FGT+ERTRQ +V+L+++ +F+ +V    + +       Y FF GDFNSQP D+
Sbjct: 242 THLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDS 301

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRP 326
           PYLS+T KP++   RAK++IECS S+++SK+R    E  ED+   E  + E      ++P
Sbjct: 302 PYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR----ESGEDAEDEEGGNIEKF--GKDQP 355

Query: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386
           Q P P  + A  EQ + V  ++ LHN + ++ VSLY + YH VHPENS     +   EP+
Sbjct: 356 QTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSG--LDNERGEPE 413

Query: 387 LSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445
           +S+ A  W GLLDY+F+I  W  ++ T+I  L+  E    IKI G LRMP   EM  H +
Sbjct: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473

Query: 446 PHENEYPSDHLAMMCDISL 464
           PH  EYPSDHL ++ ++ L
Sbjct: 474 PHVGEYPSDHLCLLSEVEL 492

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/405 (43%), Positives = 252/405 (62%), Gaps = 18/405 (4%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWV 127
           I+TYN LAQ LI R  FP++ +A+KW RRS+ +I EL+YY+ D++CLQE D     +FW 
Sbjct: 80  ILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWS 139

Query: 128 EEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGTRT 187
            +F  LGY   FF    K+HGV I W+ S+F+    D+  +  D+ +AG DI   T TR 
Sbjct: 140 VQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKF--YDQCQVDFDELLAG-DIPPRTKTRN 196

Query: 188 VALAVALRLKHHKTSRP------IIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVT 241
           + L VAL+   +  + P      I+ +TTHLFWH FGTFERTRQ +++LSE+NKF+  + 
Sbjct: 197 IGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN 256

Query: 242 DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSI 301
           +         Y F TGDFNSQP DAPY+S+T KP+Q     +++IECS SY YSK+RN  
Sbjct: 257 EHSGITN--WYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGD 314

Query: 302 LEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSL 361
           ++ +E        D+E ++ +   P DPRP  +    EQ   V  +Q LHN +P + +SL
Sbjct: 315 MDVNEKEQSDSEEDEEFIKKQ---PTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISL 371

Query: 362 YGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWS--ENATKISDLQA 419
           Y +GY  VHPENS  +  +   EP+ S   +HWSGLLDYIF I  W+  +    +  L+ 
Sbjct: 372 YSVGYRNVHPENS--FINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLET 429

Query: 420 LERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISL 464
            E+   +KI G+L++PL++EM  H++P+E EYPSDHLA+MC + L
Sbjct: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  343 bits (879), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/437 (42%), Positives = 258/437 (59%), Gaps = 30/437 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI+RPLL +      P +       +MTYN LAQ LIRR  FPD+ +A+KW+RRS+VL+ 
Sbjct: 106 FIRRPLLTLH--DDEPEKS--FTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLN 161

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E +YY+ D++CLQE D IQ+  FW EEF ++GY   F     K HGVAIVWK ++F  T 
Sbjct: 162 EFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLT- 220

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKH----------HKTSRPIIFSTTHL 212
            D++ +  D  ++G DI   T T    L ++L+             +     II  TTHL
Sbjct: 221 -DRMLIDFDKELSG-DILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHL 278

Query: 213 FWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYL 269
           FWH FGT+ERTRQ FV+L+++ +F K+V    + +         FF GDFNSQP D PYL
Sbjct: 279 FWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYL 338

Query: 270 SLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQD 328
           S+T KPV+ K RAK +IECS SY YSK RN            E  +  ++E    ++PQ 
Sbjct: 339 SITSKPVEYKERAKIVIECSTSYTYSKLRNGD------DDEAEDEEGGNIEKFGKDQPQT 392

Query: 329 PRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLS 388
           P P +Y   PEQ + V  +++LHN + ++  SLY +GY  VHPENS     +   EP++S
Sbjct: 393 PVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSG--LDNKKGEPEIS 450

Query: 389 HRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPH 447
           + A  W GLLDYIF +  W   +  ++ D +  E++  +K+ GYLRMP   EM  + +PH
Sbjct: 451 NWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPH 510

Query: 448 ENEYPSDHLAMMCDISL 464
           + EYPSDHL+MMC I L
Sbjct: 511 QGEYPSDHLSMMCKIEL 527

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/443 (41%), Positives = 259/443 (58%), Gaps = 39/443 (8%)

Query: 43  FIKRPLL----EVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FIKRP L    E P  G         R K+MTYN LAQ LIRR  FPD+ DA+KW+RRS+
Sbjct: 93  FIKRPFLSLHEEEPVTG--------FRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSR 144

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E  +Y+ADV+CLQE D IQ+  FW EEF +LGY+G +     K HGVAI+W+  MF
Sbjct: 145 VLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMF 204

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL---------KHHKTSRPIIFST 209
           +   +DK+ +  D  V+G +I   T T  V L +AL+          K       I+  T
Sbjct: 205 QQ--VDKMLIDFDKEVSG-NIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGT 261

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266
           +HLFWH FGT+ERTRQ +++L ++ +F+ +V    + +       + FF GDFNSQP D 
Sbjct: 262 SHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDT 321

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNR 325
           PYLS+T KPV  + RAK++IECS S+++SK R+            +  +  ++E    ++
Sbjct: 322 PYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDG-------EEGADEEEGGNIEKFGKDQ 374

Query: 326 PQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEP 385
           P+ P P  + A  EQ+E V  +  LHN + ++ VSLY + Y  VHPEN+     +   EP
Sbjct: 375 PESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAG--LDNDRGEP 432

Query: 386 QLSHRALHWSGLLDYIFLITEWS--ENATKISDLQALERQTGIKINGYLRMPLKEEMCDH 443
           ++S+ A  W GLLDY+F I +W    N  ++  L   E+   IK  G+LRMP   EM  H
Sbjct: 433 EISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKH 492

Query: 444 TEPHENEYPSDHLAMMCDISLPL 466
            +PH  EY SDHL+M+CDI L L
Sbjct: 493 GQPHVGEYASDHLSMVCDIELQL 515

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/433 (43%), Positives = 262/433 (60%), Gaps = 26/433 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRP+L +     V   +G+ + K+MTYN LAQ LIRR  FP + DA+KW+RRS+VL+ 
Sbjct: 77  FIKRPILPLHKGENV---EGF-KFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLN 132

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E +YY+ADV+CLQE D IQ+  FW +E  +LGY   F     K HGVAIVWK   F  T 
Sbjct: 133 EFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMT- 191

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTSRPIIFSTTHLFWHL 216
            DK+ +  D   +G DI   T T    L ++L+       +H+     II  TTHLFWH 
Sbjct: 192 -DKMLIDFDRESSG-DIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHP 249

Query: 217 FGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTD 273
           FGTFERTRQ +V+L+++ +F  +V    + +       Y FF GDFNSQP D+PYLS+T 
Sbjct: 250 FGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTR 309

Query: 274 KPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDPRPY 332
           KP++   RAK++IECS SY +SK R+            E  +  ++E   T++P  P P 
Sbjct: 310 KPIEYSKRAKTVIECSTSYTFSKMRDGE------EDDAEEEEGGNIEKFGTDQPDHPVPQ 363

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
            Y+A   + E V+ +Q+LHN + ++ VSLY + Y  VHPEN+     +   EP++S+ A 
Sbjct: 364 HYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAG--LDNERGEPEISNWAH 421

Query: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDY+F I  W   +  +I  L++ ER+  +KI G LR+P  +EM +H +PH  EY
Sbjct: 422 TWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEY 481

Query: 452 PSDHLAMMCDISL 464
           PSDHL M+C++ L
Sbjct: 482 PSDHLCMLCELEL 494

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  341 bits (875), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/439 (41%), Positives = 268/439 (61%), Gaps = 36/439 (8%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRP+L   Y+       G+ +  +MTYN LAQ LIRR  FPD+ DA+KW+RRS+VL+ 
Sbjct: 148 FIKRPIL---YLHEEEPVQGF-KFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLN 203

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E  YY  D++CLQE D IQ+  FW  EF++LGY+  +     K HGV+I+W+ S+F  T 
Sbjct: 204 EFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLF--TM 261

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALR--------LKHHKTSRP-IIFSTTHLF 213
            DK+ +  D   +G ++   T T  V L ++L+         K+ +T++  II  TTHLF
Sbjct: 262 TDKMLIEFDKESSG-NVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLF 320

Query: 214 WHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQ---RCYTFFTGDFNSQPCDAPYLS 270
           WH FGT+ERTRQ +V+L+++ +F+ +V        +     Y FF GDFNSQP D+PYLS
Sbjct: 321 WHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLS 380

Query: 271 LTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRPQDP 329
           +  KPV+  GRAK++IECS SY++SK+R+            +  +  ++E    ++PQ P
Sbjct: 381 MVRKPVEYSGRAKTVIECSTSYKFSKKRDG-------EEDVDDEEGGNIEKFGIDQPQTP 433

Query: 330 RPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQ---EPQ 386
            P  + A  EQ   V+ ++ LHN + ++ +SLYG+GY  VHPEN+     S++    EP+
Sbjct: 434 VPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENA-----SIDNECGEPE 488

Query: 387 LSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445
           +S+ A  W+GLLDY+  + EW+  + TK   L+  E    ++I G+LRMP   EM  H +
Sbjct: 489 ISNWAHTWNGLLDYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQ 548

Query: 446 PHENEYPSDHLAMMCDISL 464
           PH  EYPSDHL+M+C I L
Sbjct: 549 PHVGEYPSDHLSMLCSIEL 567

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/443 (41%), Positives = 262/443 (59%), Gaps = 39/443 (8%)

Query: 43  FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FI+RP L +    P  G         R K+MTYN LAQ LIRR  FPD+ DA+KW+RRS+
Sbjct: 93  FIRRPFLSLHEAEPVTG--------FRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSK 144

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E +YY++DV+CLQE D IQ+  FW +EF +LGY G ++    K HGVAI+W+  +F
Sbjct: 145 VLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAIMWRRELF 204

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKH-------HKTSRP--IIFST 209
               +DK+ L   D  + + I+  T T  V L +AL+           K+S+   I+  T
Sbjct: 205 HQ--VDKM-LIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGT 261

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266
           THLFWH FGT+ERTRQ +++L ++ +F+ +V    + +       + FF GDFNSQP D 
Sbjct: 262 THLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDT 321

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSIL-EDDEDSMVREPSDQESVEDETNR 325
           PYLS+T KPV  + RAK++I CS SY++SK R+     DDE+    E   ++       +
Sbjct: 322 PYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGGNIEKYGKD-------Q 374

Query: 326 PQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEP 385
           P+ P P  + A  EQ E V  +  LHN + ++ +SLY +GY  VHPEN+     +   EP
Sbjct: 375 PESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAG--LDNDRGEP 432

Query: 386 QLSHRALHWSGLLDYIFLITEW--SENATKISDLQALERQTGIKINGYLRMPLKEEMCDH 443
           ++S+ A  W GLLDY+F + +W    N  ++  L   E++  +K  G+LRMP   EM  H
Sbjct: 433 EISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKH 492

Query: 444 TEPHENEYPSDHLAMMCDISLPL 466
            +PH  EY SDHL+M+CD+ L L
Sbjct: 493 GQPHVGEYASDHLSMVCDLELQL 515

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 265/441 (60%), Gaps = 39/441 (8%)

Query: 43  FIKRPLL----EVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FI+RP+L    E P  G         ++ IMTYN LAQ LIRR  FPD+ DA+KW +RS+
Sbjct: 135 FIQRPILHLHEEEPVTG--------FKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSK 186

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL  E ++Y+ DV+CLQE D +Q+  FW  EF+++GY+  F     K HGVAI+W+  +F
Sbjct: 187 VLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELF 246

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR--------PIIFSTT 210
             T  DK+ +  D   +G +I   T T    LA++L+      S+         II  TT
Sbjct: 247 --TLTDKMLIDFDKEPSG-EIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTT 303

Query: 211 HLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAP 267
           HLFWH FGT+ERTRQ +V+L+++ +F+ ++    + +       Y FF GDFNSQP D P
Sbjct: 304 HLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTP 363

Query: 268 YLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRP 326
           YLS+T KP+  KGRAK++IECS SY++SK+R+            +  +  ++E    ++P
Sbjct: 364 YLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDG-------EEDADEEEGGNIEKFGKDQP 416

Query: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386
           Q P P  + A  EQ + V++++ LHN + ++ +SLYG+GY  VHPEN+   +     EP+
Sbjct: 417 QTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDC--GEPE 474

Query: 387 LSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCD--H 443
           +S+ A  W+GLLDYI  I  W  ++   +  L+  E++  IK+ GYLRMP   EM    H
Sbjct: 475 ISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGH 534

Query: 444 TEPHENEYPSDHLAMMCDISL 464
            +PH  EYPSDHL+M+C++ L
Sbjct: 535 GQPHTGEYPSDHLSMICELEL 555

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  336 bits (861), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/444 (42%), Positives = 264/444 (59%), Gaps = 43/444 (9%)

Query: 43  FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98
           FIKRP+L +    P  G            +MTYN LAQ LIRR  FPD+ +A+KW RRS+
Sbjct: 83  FIKRPMLHLHQDEPVTG--------FNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSK 134

Query: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158
           VL+ E ++Y++DV+CLQE D IQ+  FW  EF++LGY+  F     K HGVAIVWK  MF
Sbjct: 135 VLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMF 194

Query: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL---------KHHKTSRPIIFST 209
           + T  D++ +  D   +  DI   T T    L ++L+          K+ KT+  II  T
Sbjct: 195 KMT--DRMLIDFDKETSS-DIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTT-GIIIGT 250

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266
           THLFWH FGT+ERTRQ +V+L+++ +F+ +V    + +         FF GDFNSQP D+
Sbjct: 251 THLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDS 310

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDE---T 323
           PYLS+T KP++   RAK++I+CS SY++SK RN   E+D D       D+E    E    
Sbjct: 311 PYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNG--EEDVD-------DEEGGNIEKFGK 361

Query: 324 NRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQ 383
           ++PQ P P T+ A  EQ   V+ +  +HN + ++  SLY +GY  VH EN+   +T    
Sbjct: 362 DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNT--RG 419

Query: 384 EPQLSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCD 442
           EP +S+ A  W GLLDYIF +  W  +N   +  L+  E +  I++ G+LRMPL  EM  
Sbjct: 420 EPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPK 479

Query: 443 HTEPHENEYPSDHLAMMCDISLPL 466
           H +PHE EY SDHL+M+C+I L L
Sbjct: 480 HGQPHEGEYASDHLSMICNIELLL 503

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 175/433 (40%), Positives = 253/433 (58%), Gaps = 28/433 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRPLL    V       G+V  ++MTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 87  FIKRPLL----VCNGDEAKGFV-FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLS 141

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           EL+YY+ DV+CLQE D  Q+  FW++     GY   F    GK HG+AIVW+ S+F    
Sbjct: 142 ELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLF--NK 199

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTHLFWH 215
           +D+  +  D+  +G +I   T T+ V L VAL        R        I+  T+HLFWH
Sbjct: 200 VDETLIDFDEEQSG-EIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258

Query: 216 LFGTFERTRQLFVILSELNKFIKK---VTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
            FGT+ER RQ ++ILS +  F+K+   +    C    + + FF GDFNSQP DAPYLS+ 
Sbjct: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            KP+  +GRA+++IECS SY++S  R+    D+E+    E            +P+ P P 
Sbjct: 319 SKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFG-------AGQPETPVPD 371

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
           ++D  PEQ   V  +Q+LHN + ++ +SLY + Y  VHPEN+   +     EP++S+ A 
Sbjct: 372 SFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNN--RGEPEISNWAH 429

Query: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDYI  +  W   + T++ D+   ++ T + +   LR+P   EM  H +PHE EY
Sbjct: 430 AWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEY 489

Query: 452 PSDHLAMMCDISL 464
           PSDHL++MC++ L
Sbjct: 490 PSDHLSLMCELEL 502

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/434 (41%), Positives = 260/434 (59%), Gaps = 29/434 (6%)

Query: 43  FIKRPLLEVPYVGG--------VPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWH 94
           FI+RPLL +             +      + +KIMTYNTLAQTLIRR  FP +  A+KWH
Sbjct: 79  FIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWH 138

Query: 95  RRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWK 154
           +RS+VL+ EL+ Y  D+V LQE D  +  KFW E F +LG+   F    GK HG+ + W 
Sbjct: 139 KRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRRNGGKTHGLLVAWN 197

Query: 155 TSMFEDTPLD-KLPLCLDDYVAGDDIAATTGTRTVALAVALRLK--HHKTSRPIIFSTTH 211
              F+   LD +  L  D  +AG+ I+A T T+ +AL V+LR K   + ++  I+ + TH
Sbjct: 198 NEKFQ---LDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTH 254

Query: 212 LFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSL 271
           LFWH FG FER RQ +++L +    I+++ D   P+    ++   GDFN++P + PYL++
Sbjct: 255 LFWHPFGVFERLRQSYLVLQK----IQEIKD--FPKYHGWHSLLMGDFNTEPEEPPYLAI 308

Query: 272 TDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRP 331
           T KP+ L G  ++++ECSL+YRYSK+RN    D +D    E S  E      N+P++P+P
Sbjct: 309 TSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSRGER---NLNQPKNPKP 365

Query: 332 YTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRA 391
             + A  E+ + V  L  LHN + ++G+SLYG+GY  VHPEN+N+     + EP+LS+ A
Sbjct: 366 KHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANE----GHGEPELSNWA 421

Query: 392 LHWSGLLDYIFLITEWSEN-ATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENE 450
             W GLLDYIF I     N A +   L   E   G+ + GYLRMP K+EM  H++P E E
Sbjct: 422 NTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGE 481

Query: 451 YPSDHLAMMCDISL 464
           Y SDH+++MC I L
Sbjct: 482 YASDHISLMCQIRL 495

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  330 bits (847), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/439 (40%), Positives = 255/439 (58%), Gaps = 35/439 (7%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRP+L VP             + IMTYN LAQ LIRRT FP + +A+KW +RSQVL+ 
Sbjct: 94  FIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLN 153

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E +YY+ DV+CLQE D +Q+  FW  EF +LGY   F   P K HGV I WK  +F+ T 
Sbjct: 154 EFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMT- 212

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTHLFWH 215
            DK+ +  D    G  I   T T+ V + ++L+ K     +        II  TTHLFWH
Sbjct: 213 -DKMLIDYDKETTG-AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWH 270

Query: 216 LFGTFERTRQLFVILSELNKFIKKVT---------DAHCPRGQRCYTFFTGDFNSQPCDA 266
            FGT+ERTRQ +++L ++ +F  ++          ++H P       FF GDFNSQP DA
Sbjct: 271 PFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWP------AFFCGDFNSQPFDA 324

Query: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRP 326
           PYLS+T KPV+  GRAK++IECS S+ +SK R+    + E+    E   +        +P
Sbjct: 325 PYLSITSKPVEYTGRAKTVIECSTSFTFSKLRDGDEGEGEEGGNIEKFGK-------GQP 377

Query: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386
           + P P ++    EQ +  ++++ LHN I ++ +SLY I Y  VHPENS     +   EP+
Sbjct: 378 ETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSG--LDNKRNEPE 435

Query: 387 LSHRALHWSGLLDYIFLITEWSE-NATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445
           +S+ A  W GLLDY++ +T W   + TKI +L   E+  G+++   LR+P  +EM +H +
Sbjct: 436 ISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQ 495

Query: 446 PHENEYPSDHLAMMCDISL 464
           PHE EYPSDHL M+  + +
Sbjct: 496 PHEGEYPSDHLCMIVKLGI 514

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  330 bits (845), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/426 (41%), Positives = 257/426 (60%), Gaps = 22/426 (5%)

Query: 43  FIKRPLLEVPY---VGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQV 99
           FIKRP L + +    G        + VKIMTYNTLAQTLIRR  FP +  A+KWH+RS+V
Sbjct: 81  FIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKV 140

Query: 100 LIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFE 159
           L+ EL+ Y  D+V LQE D  +  KFW E F +LG+   F    GK HG+ I W +  F+
Sbjct: 141 LVHELKTYKPDIVSLQEVDYNEL-KFWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQ 199

Query: 160 DTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKH--HKTSRPIIFSTTHLFWHLF 217
               ++  L  D+ +AG+ I A T T+ +AL  +LRLK+    ++  +I + THLFWH F
Sbjct: 200 LE--NEWMLDYDNILAGNAIPARTRTKNIALIASLRLKNISDPSTDGVIVANTHLFWHPF 257

Query: 218 GTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQ 277
           G FER RQ +++L+++ +         CP+    ++   GDFN++P + PYL++T KPV 
Sbjct: 258 GVFERLRQSYLVLAKIQEI------KACPKYNGWHSVLMGDFNTEPEEPPYLAITRKPVA 311

Query: 278 LKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAM 337
           L G A+ + ECSL+YRYSK+RN      +D    E  +Q   E   N+PQ+P+P ++ A 
Sbjct: 312 LTGSARVMAECSLAYRYSKKRNGEEGGQDD---EECDEQSRGEGRFNQPQNPKPKSFTAT 368

Query: 338 PEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGL 397
            EQ   V  L  LHN + ++GVSLYG+GY  V PENS++     N EP+LS+ A  W GL
Sbjct: 369 SEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHE----SNGEPELSNWANSWCGL 424

Query: 398 LDYIFLITEWSENATKISD-LQALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHL 456
           LDYIF I    E++    + +   E +  +++ GYL+MP  +EM  H++P E EY SDH+
Sbjct: 425 LDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHV 484

Query: 457 AMMCDI 462
           ++MC +
Sbjct: 485 SLMCQL 490

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  328 bits (841), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/433 (42%), Positives = 258/433 (59%), Gaps = 28/433 (6%)

Query: 43  FIKRPLLEVPYVGG-------VPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHR 95
           FI+RP L + +          +      + VKIMTYNTLAQTLIRR  FP++  A+KWH+
Sbjct: 79  FIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHK 138

Query: 96  RSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKT 155
           RS+VL+ EL+ Y  DVV LQE D  + + FW E F +LG+   F    GK HG+ + W  
Sbjct: 139 RSKVLVHELKKYRPDVVSLQEVDYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNN 197

Query: 156 SMFEDTPLDK-LPLCLDDYVAGDDIAATTGTRTVALAVALRLKH--HKTSRPIIFSTTHL 212
             F+   LD    L  D+ +AG+ I+A T T+ +AL ++L  K     +SR II + THL
Sbjct: 198 KKFQ---LDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHL 254

Query: 213 FWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
           FWH FG FER RQ +++L ++ +         C +    ++   GDFN++P + PYL++T
Sbjct: 255 FWHPFGVFERLRQSYLVLQKIQEI------KACSKYNGWHSLLMGDFNTEPEEPPYLAIT 308

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            +P+ LKG  ++++ECSL+YRYSK+RN    D +D    E S  E   D+   PQ+P+P 
Sbjct: 309 KRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQ---PQNPKPE 365

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
           ++ A  E+   V  L  LHN + ++GVSLYGIGY  VHPEN+N      + EP LS+ A 
Sbjct: 366 SFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENAN----GSHGEPGLSNWAN 421

Query: 393 HWSGLLDYIFLI-TEWSENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDYIF I  + +++  +   L A E    +KI GYLRMP  +EM  H++P E EY
Sbjct: 422 TWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEY 481

Query: 452 PSDHLAMMCDISL 464
            SDH+++MC I L
Sbjct: 482 ASDHISLMCQIRL 494

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/434 (41%), Positives = 262/434 (60%), Gaps = 31/434 (7%)

Query: 43  FIKRPLLEV-------PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHR 95
           FI+RP L V           G+      + V+IMTYNTLAQTLIRR  FP +  A+KWH+
Sbjct: 81  FIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHK 140

Query: 96  RSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKT 155
           RS+VL+ EL+ Y  D+V LQE D  +   FW E F +LG+   F    GK HG+ + W  
Sbjct: 141 RSKVLVHELKTYKPDIVSLQEVDYNELG-FWHENFHKLGFGSTFRRHEGKTHGLMVAWNN 199

Query: 156 SMFEDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKH--HKTSRPIIFSTTHLF 213
             F+    ++  L  D  +AG+ I+A T T+ +AL V+L +K+  + ++  +I + THLF
Sbjct: 200 EKFQQD--NEWMLDYDTILAGNAISARTRTKNIALIVSLSVKNMTNLSTSGVIVANTHLF 257

Query: 214 WHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTD 273
           WH FG FER RQ F++L ++ +         CP+    ++   GDFN++P + PY+++T 
Sbjct: 258 WHPFGVFERLRQSFLVLKKIEEI------KTCPKYYGWHSLLMGDFNTEPEEPPYMAITR 311

Query: 274 KPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESV-EDETNRPQDPRPY 332
           +P+ L G A+++ ECSL+YRYSK RN   E D+D    E  D+ES  E + ++PQ+P+P 
Sbjct: 312 RPLTLTGSARAMTECSLAYRYSKMRNG-EESDQD----EECDEESTGEGQHDQPQNPKPK 366

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
            + A  EQ   V  L  LHN + ++G+SLYG+ Y  VHP+NS +     + EP+LS+ A 
Sbjct: 367 YFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNSKEN----HGEPELSNWAN 422

Query: 393 HWSGLLDYIFLITEWSENATKISD--LQALERQTGIKINGYLRMPLKEEMCDHTEPHENE 450
            W GLLDYIF I E ++N +   D  ++  E Q  +KI GYLRMP  EEM  H++P E E
Sbjct: 423 TWCGLLDYIFYI-ERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGE 481

Query: 451 YPSDHLAMMCDISL 464
           Y SDH+++MC + L
Sbjct: 482 YASDHISLMCQLRL 495

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  319 bits (818), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/435 (40%), Positives = 252/435 (57%), Gaps = 29/435 (6%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FI RP+L +     V    G+    +MTYN LAQ+LIRR+ FP +  A+KW +RS VL++
Sbjct: 71  FIARPMLPLKVTQTV--HKGF-SFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLK 127

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162
           E ++Y+ADV+CLQE D  Q+  FW+     LGY   F     K HGVAI WK  +F    
Sbjct: 128 EFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLF--IW 185

Query: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHH-KTSRP------IIFSTTHLFWH 215
           +D++ +  D+  +G +I     T  V + +AL      K S P      II  T+HLFWH
Sbjct: 186 MDQMLINFDNEDSG-EIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWH 244

Query: 216 LFGTFERTRQLFVILSELNKFIKKV---TDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272
            FGT+ERTRQ +VIL+++ +FI +V    + H     + Y FF GDFNSQP DAPYLS+T
Sbjct: 245 PFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSIT 304

Query: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332
            KPV   GRAK++IECS +Y++          D  +  R  ++      E +RP DP P 
Sbjct: 305 SKPVLYSGRAKTVIECSAAYKFP---------DLGAGARGANEDGGTVGE-DRPVDPVPE 354

Query: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392
           ++    E    VQ ++ LHN + ++ +SLY + Y  VHP+N+     +   EP++S+ A 
Sbjct: 355 SFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGL--DNERGEPEISNWAY 412

Query: 393 HWSGLLDYIFLITEW-SENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451
            W GLLDYI  IT W + N  ++  L++ E+ + I +   LRMP  +EM  H +PH+ EY
Sbjct: 413 TWRGLLDYIMYITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEY 472

Query: 452 PSDHLAMMCDISLPL 466
           PSDHLAMMC + + +
Sbjct: 473 PSDHLAMMCKLEVEM 487

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/440 (39%), Positives = 258/440 (58%), Gaps = 35/440 (7%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102
           FIKRP+L +P+ G    R G+ +  +MTYN LAQ +IRR  F D+  A+KW RRS+VL+ 
Sbjct: 52  FIKRPILYLPHHGH-SNRKGF-KFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLMN 109

Query: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFD-RLGYKGGFFNFPGKVHGVAIVWKTSMFEDT 161
           E+ YY+ D++CLQE D  Q++ FW ++ +  L     ++    K HGV I WK S+F+  
Sbjct: 110 EITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQ- 168

Query: 162 PLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR--------------PIIF 207
            +D + +  DD V   +IA  T TR +A+ VAL+      ++                I 
Sbjct: 169 -VDHMVVDFDD-VKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFII 226

Query: 208 STTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAP 267
           STTHLFWH FGTFERTRQ +++L ++ KFI  + +         Y F  GDFNS P DAP
Sbjct: 227 STTHLFWHPFGTFERTRQCYILLEKMKKFI-DILNVKDHLKTHWYPFICGDFNSTPRDAP 285

Query: 268 YLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQ 327
           YLS+T KP++  GR K +IECS +Y++SKRRN  + D         SD+E  +   N+P+
Sbjct: 286 YLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGD---------SDEEEEKKLINQPK 336

Query: 328 DPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQL 387
           D  P ++    EQ + V  LQ+LHN + L+  SLYG+ Y +V P N N    +   EP+ 
Sbjct: 337 DMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVN--INNDRGEPEF 394

Query: 388 SHRALHWSGLLDYIFLITEW--SENATKISD-LQALERQTGIKINGYLRMPLKEEMCDHT 444
           +  A  W G+LDYI  +  W  +E  ++I + L+  E+   + I G L+MPL ++M  HT
Sbjct: 395 TSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHT 454

Query: 445 EPHENEYPSDHLAMMCDISL 464
           +P E EYPSDH++++C++ +
Sbjct: 455 QPFEREYPSDHISILCEMEI 474

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  286 bits (731), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 177/438 (40%), Positives = 243/438 (55%), Gaps = 43/438 (9%)

Query: 43  FIKRPLLEVPYVGGVPCRDGYVR---VKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQV 99
           FI+RP+L VP+       D Y R   + IMTYN LAQTLIRR  FP++  A+KW  RS+V
Sbjct: 60  FIERPILLVPH------GDNYERGLPLSIMTYNCLAQTLIRREMFPESGPALKWFVRSKV 113

Query: 100 LIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFE 159
           L+ E+++Y+AD+ CLQE D +Q+D FW EE  + GYK  +F+   K HGV I WK  +F+
Sbjct: 114 LLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAWKEELFQ 173

Query: 160 DTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVAL--------RLKHHKTSRP-IIFSTT 210
              L+       D  A   I   T T  V L VAL        R    +TSR  +I  T 
Sbjct: 174 ---LESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVIIGTF 230

Query: 211 HLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLS 270
           HLFWH FGT++RTRQ  VI  ++ +F   V   +C         FTGDFNSQP   PYL 
Sbjct: 231 HLFWHPFGTYDRTRQCLVIKKKILEFAGTVKGDYC-------KMFTGDFNSQPNSVPYLV 283

Query: 271 LTDKPVQLKGRAKSIIECSLSYRYSKRRN---SILEDDEDSMVREPSDQESVEDETNRPQ 327
           LT    QL  + ++ IE S +YRYS+RRN       ++E+    E   +E   D+   P 
Sbjct: 284 LTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYDQGTDPW 343

Query: 328 D-PRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386
           + PRP  +D+  EQ + V +L +  N +PL   SLY IGYH V P +      + + EP+
Sbjct: 344 NTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTH-----IADHHEPE 398

Query: 387 LSHRALHWSGLLDYIFLITEWSENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEP 446
           LS  +  W+GLLDYIF + +      + S     E    I I GYL+MP   +M +H++P
Sbjct: 399 LSSWSTKWAGLLDYIFYVNQ------RPSTPATFETANNIAIAGYLQMPTHAQMHNHSQP 452

Query: 447 HENEYPSDHLAMMCDISL 464
           +  EYPSDH++MMC + +
Sbjct: 453 YTGEYPSDHISMMCALEI 470

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 93/222 (41%), Gaps = 30/222 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L +E+  Y  DV+CLQE +   +++FW
Sbjct: 447 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEEFW 506

Query: 127 VEEFDRLGYKGGF----------FNFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           +   ++ GY G F               KV G  I +K S F     D +          
Sbjct: 507 LPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKHK 566

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ ++LKH  +   +   TTHL W       +T Q
Sbjct: 567 KFQRTEDYL-------NRAMNKDNIALIVKLKHELSGEHVWVVTTHLHWDPHFNDVKTFQ 619

Query: 226 LFVILSELNKFIKKVTDAHCPR-GQRCYTFFTGDFNSQPCDA 266
           + V+L  + K +K+ ++   P+  ++      GDFNSQ   A
Sbjct: 620 VGVLLDYIEKLLKQQSNIGNPQEKKKVPLIICGDFNSQSHSA 661

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 90/218 (41%), Gaps = 30/218 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L  E+  Y  D++CLQE +   +++FW
Sbjct: 400 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEEFW 459

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           +   ++ GY G F               KV G  I +K S F     D +          
Sbjct: 460 LPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMKHK 519

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ ++L+H +T   +   TTHL W       +T Q
Sbjct: 520 KFQRTEDYL-------NRAMNKDNVALIIKLRHERTGEHVWVVTTHLHWDPHFNDVKTFQ 572

Query: 226 LFVILSELNKFIKKVTDAHCPRGQRCYTF-FTGDFNSQ 262
           + V+L  + K +K+      P+ ++       GDFNSQ
Sbjct: 573 VAVMLDYIEKLLKQHGGVGSPQDKKKIPLVICGDFNSQ 610

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 97/234 (41%), Gaps = 30/234 (12%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L  ++  + +DV+CLQE +   +++FW
Sbjct: 454 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEEFW 513

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           +    + GY G F+              KV G  I +K S F     D +          
Sbjct: 514 LPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHK 573

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ ++L+H K+   +   TTHL W       +T Q
Sbjct: 574 KFQRTEDYL-------NRAMNKDNVALYMKLEHIKSGESVWVVTTHLHWDPQFNDVKTFQ 626

Query: 226 LFVILSELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQL 278
           + ++L  L + +K   +A   +  ++C     GD NS    A Y  L+   VQ+
Sbjct: 627 VGILLDHLEELLKDNNNASSKQEIRKCPVIICGDLNSHLDSAVYELLSTGHVQV 680

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 34/241 (14%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L +++  Y  DV+CLQE +   ++++W
Sbjct: 466 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYW 525

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
                + GY G F               KV G  + ++ + F+    D +          
Sbjct: 526 APLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQKHK 585

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ L+L+H K+   +   TTHL W       +T Q
Sbjct: 586 KFQRTEDYL-------NRAMNKDNVAIYLKLQHIKSGESVWIVTTHLHWDPQFNDVKTFQ 638

Query: 226 LFVILSELNKFIKKVTDAHCPR-GQRCYTFFTGDFNSQPCDAPYLSLTDKPVQ----LKG 280
           + V++  +   +K+ ++A   +  ++C     GD NS+   A Y  L+   VQ    +KG
Sbjct: 639 VGVLMDHIENLLKEQSNAQSKQEAKKCPVILCGDLNSEIHSAVYELLSTGRVQAHDDIKG 698

Query: 281 R 281
           R
Sbjct: 699 R 699

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 97/235 (41%), Gaps = 32/235 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L +++  YD+DV+CLQE +   ++ +W
Sbjct: 539 VLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFEDYW 598

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           V   D+ GY G F+              KV G  I +K   F+    D +          
Sbjct: 599 VPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMKHK 658

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ L+L+H  +   I   TTHL W       +T Q
Sbjct: 659 KFQRTEDYL-------NRAMNKDNVALFLKLQHVSSGDTIWVVTTHLHWDPKFNDVKTFQ 711

Query: 226 LFVILSELNKFIKKVTDAHCPRG--QRCYTFFTGDFNSQPCDAPYLSLTDKPVQL 278
           + V+L  L   +K+ T  H  R   ++      GDFNS    A Y  ++   VQ+
Sbjct: 712 VGVLLDHLESLLKEDT-THNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQV 765

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 95/227 (41%), Gaps = 18/227 (7%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L  ++  + +D++CLQE +   +D FW
Sbjct: 566 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDDFW 625

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMF-----EDTPLDKLPLCLD 171
                + GYKG F               KV G  I +K S F     E      + +   
Sbjct: 626 EPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMKHK 685

Query: 172 DYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILS 231
           ++   +D       +   +A+ ++L+H K+       TTHL W       +T Q+ V+L 
Sbjct: 686 NFQRTEDYLNRAMNKD-NVAIYMKLQHIKSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLD 744

Query: 232 ELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQ 277
            L   +K+ ++ H  +  ++C     GD NS    A Y  L+   V+
Sbjct: 745 HLESLLKEHSNIHSKQDVKKCPIIICGDLNSYLDSAVYELLSTGHVE 791

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 92/219 (42%), Gaps = 20/219 (9%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           I++YNTL Q       +      A+ W  R + L +++  Y+ D+VCLQE +   ++ FW
Sbjct: 410 ILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFW 469

Query: 127 VEEFDRLGYKGGFFNF----------PGKVHGVAIVWKTSMF-----EDTPLDKLPLCLD 171
                  GY G F               KV G    +K S F     E      + +   
Sbjct: 470 APLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHK 529

Query: 172 DYVAGDD-IAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVIL 230
            +   +D +        VAL V  +L+H K+   +  +TTHL W       +T Q+ V+L
Sbjct: 530 KFQRTEDYLNRAMNKDNVALVV--KLQHIKSGEHVWAATTHLHWDPQFNDVKTFQVGVLL 587

Query: 231 SELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPY 268
             + K IK+  + +  +  ++      GDFNSQ   A Y
Sbjct: 588 DYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVY 626

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 101/228 (44%), Gaps = 20/228 (8%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L +++ YY  D++CLQE +   ++ FW
Sbjct: 412 LLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFW 471

Query: 127 VEEFDRLGYKGGFF------NFPG----KVHGVAIVWKTS----MFEDT-PLDKLPLCLD 171
                  GY G F          G    KV G  + ++ S    +F+DT     + +   
Sbjct: 472 APLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHK 531

Query: 172 DYVAGDD-IAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVIL 230
            +   +D +        VAL V  +L+H K+   +  +TTHL W       +T Q+ V+L
Sbjct: 532 KFQRTEDYLNRAMNKDNVALLV--KLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLL 589

Query: 231 SELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQ 277
             + K IK+ +  +  +  ++      GDFNSQ   A Y  L+   V+
Sbjct: 590 DHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVR 637

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 93/227 (40%), Gaps = 18/227 (7%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           IM+YN L Q       +      A+ W  R Q L +E+  Y  D+VCLQE +   +++ W
Sbjct: 526 IMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEEHW 585

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAG 176
                + GY G F               KV G  + +K S F+    D++      ++  
Sbjct: 586 APLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFS-STWMKH 644

Query: 177 DDIAATTGTRTVAL-----AVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILS 231
                T      A+      + ++L H K+   +  +TTHL W       +T Q+ +++ 
Sbjct: 645 KKFQRTEDYLNRAMNKDNVVIYIKLNHLKSGESVWIATTHLHWDPQFNDVKTFQVGILMD 704

Query: 232 ELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQ 277
            L + IK+       +  ++      GDFNSQ   A Y  L+   VQ
Sbjct: 705 HLEELIKEHGSPSSRQDPKKSPVIICGDFNSQKDSAVYELLSTGHVQ 751

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 96/234 (41%), Gaps = 30/234 (12%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L +++  YD+D++CLQE +   ++++W
Sbjct: 507 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYW 566

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           V   D+ GY G F               KV G  I +K   F+    D +          
Sbjct: 567 VPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHK 626

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ L+L+H  +   I   TTHL W       +T Q
Sbjct: 627 KFQRTEDYL-------NRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDVKTFQ 679

Query: 226 LFVILSELNKFIKKVTDAHCPRGQRCY-TFFTGDFNSQPCDAPYLSLTDKPVQL 278
           + V+L  L   +K+ T  +  +  + +     GDFNS    A Y  +    VQ+
Sbjct: 680 VGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELINTGRVQI 733

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 96/235 (40%), Gaps = 30/235 (12%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L +++  YD+D++CLQE +   ++ +W
Sbjct: 509 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYW 568

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           V   D+ GY G F               KV G  I +K   F+    D +          
Sbjct: 569 VPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHK 628

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ L+L+H  +   I   TTHL W       +T Q
Sbjct: 629 KFQRTEDYL-------NRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDVKTFQ 681

Query: 226 LFVILSELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQLK 279
           + V+L  L   +++ T  +  +  ++      GDFNS    A Y  ++   VQ+ 
Sbjct: 682 VGVLLDHLETLLREETTHNFRQDIKKSPVLICGDFNSYINSAVYELISTGRVQIN 736

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 95/241 (39%), Gaps = 32/241 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L +++  Y +DV+CLQE +   ++ +W
Sbjct: 501 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYW 560

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
           V   ++ GY G F               KV G  I +K   F+    D +          
Sbjct: 561 VPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHK 620

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ L+L+H  +   I   TTHL W       +T Q
Sbjct: 621 KFQRTEDYL-------NRAMNKDNVALFLKLQHVSSGDTIWVVTTHLHWDPKFNDVKTFQ 673

Query: 226 LFVILSELNKFIKKVTDAHCPRG--QRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAK 283
           + V+L  L   +K+ T  H  R   ++      GDFNS    A Y  ++   VQ      
Sbjct: 674 VGVLLDHLETLLKEDT-THNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQAHQEGS 732

Query: 284 S 284
           S
Sbjct: 733 S 733

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 91/224 (40%), Gaps = 30/224 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L +++  + ADVVCLQE +   ++ FW
Sbjct: 401 LLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFEDFW 460

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
                + GY G F               KV G  + +K S F+    D +          
Sbjct: 461 APFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHK 520

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY     +        VAL V  +L+H KT+  I  +TTHL W       +T Q
Sbjct: 521 KFQRTEDY-----LNRAMNKDNVALFV--KLQHLKTNEQIWVTTTHLHWDPQFNDVKTFQ 573

Query: 226 LFVILSELNKFIKKVTD-AHCPRGQRCYTFFTGDFNSQPCDAPY 268
           + V+L  + K ++      +    ++      GDFNSQ   A Y
Sbjct: 574 VGVLLDYMEKLLRDQNGVGNNQEMKKVPLVICGDFNSQLDSAVY 617

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 31/223 (13%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           I++YNTL Q       +      A++W  R + L +++  Y  D++CLQE +   ++ FW
Sbjct: 468 ILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFW 527

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
               ++ GY G F               KV G  + +K S F+    + L          
Sbjct: 528 APLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQKHK 587

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ ++L+H ++   +   TTHL W       +T Q
Sbjct: 588 RFQRTEDYL-------NRAMNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQ 640

Query: 226 LFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPY 268
           + V+L  +   IK+       +  +     TGDFNS    A Y
Sbjct: 641 VGVLLDHMESIIKEENPKQDVK--KFPIIITGDFNSYLTSAVY 681

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 97/238 (40%), Gaps = 48/238 (20%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQELEY-YDADVVCLQETDRIQW 122
           R  ++TYN L+   +    +   KD  K W  R ++L  EL Y Y +D++CLQE     +
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 123 DKFWVEE-FDRLGYKGGFFNFPGK------------VHGVAIVWKTSMFE-----DTPLD 164
           ++FW ++  +R+ Y     NF  K            + GV I +    FE        L+
Sbjct: 93  NEFWKKQMMNRMNYGS---NFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLN 149

Query: 165 KLPLCLDD----YVAGDDIAATTGTRTVA--------------LAVALRLKHHKTSRPII 206
            L    D     Y+   +I  T G   V               + + + L+H ++   I+
Sbjct: 150 DLVGTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIV 209

Query: 207 FSTTHLFWHLFGTFERTR--QLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNS 261
              THL+W     ++  +  Q  +I+ +L + IK  +              F+GDFNS
Sbjct: 210 VINTHLYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNS 263

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 92/229 (40%), Gaps = 20/229 (8%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +       + W  R + L  ++    +DV+CLQE +   ++ FW
Sbjct: 542 VLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYEDFW 601

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMF-----EDTPLDKLPLCLD 171
           +    + GY G F               KV G  I +K S F     E      + +   
Sbjct: 602 LPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMKHK 661

Query: 172 DYVAGDD-IAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVIL 230
            +   +D +        VAL V  +L+H  +   +   TTHL W       +T Q+ V+L
Sbjct: 662 KFQRTEDYLNRAMNKDNVALFV--KLEHINSGESVWVVTTHLHWDPQFNDVKTFQVGVLL 719

Query: 231 SELNKFIKKVTDAHCPRG-QRCYTFFTGDFNSQPCDAPYLSLTDKPVQL 278
             L   +K   +A   +  ++C     GD NS    A Y  L+   V++
Sbjct: 720 DHLESLLKDYNNASSKQEIRKCPVIICGDLNSHLQSAVYELLSTGHVKV 768

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 93/228 (40%), Gaps = 23/228 (10%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R   L  ++  Y  D++CLQE +   ++ FW
Sbjct: 437 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFW 496

Query: 127 VEEFDRLGYKGGF----------FNFPGKVHGVAIVWKTSMF-----EDTPLDKLPLCLD 171
           +   ++ GY G F               KV G  + +K + F     E+       +  +
Sbjct: 497 LPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHE 556

Query: 172 DYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILS 231
            +   +D       +   +A+  +L+H  +   I  +TTHL W       +T Q+ V+L 
Sbjct: 557 KFQRTEDFLNRAMNKD-NIALYFKLQHIASGEHIWVATTHLHWDPKFNDVKTFQVGVLLD 615

Query: 232 ELNKFIKKVTDAHCPRG--QRCYTFFTGDFNSQPCDAPYLSLTDKPVQ 277
            L   I++      PR   ++      GDFNS    A Y  L+   V+
Sbjct: 616 HLQTLIRQDN----PRQDVKKAPVIICGDFNSYIDSAVYELLSSGSVK 659

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 79/195 (40%), Gaps = 29/195 (14%)

Query: 90  AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFF--------- 140
           A+ W  R + L ++L  +D DV+CLQE + + ++++WV   ++  Y   F          
Sbjct: 479 ALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEEYWVPLMEKYNYSCLFHAKTRAKTMH 538

Query: 141 -NFPGKVHGVAIVWKTSMFEDTPLDKLPLC-----------LDDYVAGDDIAATTGTRTV 188
                KV G AI +K   F+    D +               +DY+              
Sbjct: 539 AKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRSHKKFHRTEDYL-------NRAMNKD 591

Query: 189 ALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRG 248
            +A+   LKH  T+  +   TTHL W       +T Q+ V+L  L   IK+    +    
Sbjct: 592 NVALIAELKHLNTNENVWVVTTHLHWDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNNND 651

Query: 249 -QRCYTFFTGDFNSQ 262
            ++      GDFNSQ
Sbjct: 652 IKKIPMVICGDFNSQ 666

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 98/232 (42%), Gaps = 42/232 (18%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQWDKF 125
           +++YN L+ + +    +    +  K W+ R ++L QEL + Y AD++CLQE     +  F
Sbjct: 24  LLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSNF 83

Query: 126 W--------------------------VEEFDRLG--YKGGFFNFPGKVHGVAIVWKTSM 157
           W                          VE+ D +G  Y    F F  +  G+ +     +
Sbjct: 84  WKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISR-SGIYLNQLLGV 142

Query: 158 FEDTPLDKL---PLCLDDYVAGDDIAATTGTRTVA----LAVALRLKHHKTSRPIIFSTT 210
           F +  L+ L   P+ L D  AG+ +   +  + +     +A+ + LKH +T    +   T
Sbjct: 143 FSNNELEYLEKKPVTLTD-GAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINT 201

Query: 211 HLFWHLFGTFERTRQLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNS 261
           HL+W       +  Q  +I+ EL + I+K +         +    FTGD NS
Sbjct: 202 HLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIKILFTGDLNS 251

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 97/232 (41%), Gaps = 37/232 (15%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           R  ++TYN L+ + +    +    +  K W+ R ++L +EL   + AD++CLQE     +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDY 85

Query: 123 DKFWVEEFD-RLGYKGGFFN-FPGK--------VHGVAIVWKTSMFE-----DTPLDKLP 167
           + +W       + Y   F +  P K        + GV+I +    F+        L++L 
Sbjct: 86  ENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLL 145

Query: 168 LCLDD----YVAGDDIAATTGTRTVA--------------LAVALRLKHHKTSRPIIFST 209
              ++    Y+    +  T G   V               + + + LKH +T+   +   
Sbjct: 146 NVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTIFVVLN 205

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
           THL+W       +  Q  +I+ EL+K IK++        ++    FTGD NS
Sbjct: 206 THLYWKYDEV--KLTQCMIIMRELSKIIKQLLPGDANAQEKVKILFTGDLNS 255

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 97/246 (39%), Gaps = 40/246 (16%)

Query: 52  PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDA 109
           P  G +P  D   R  ++TYN L+   +    +    +  K W  R  +L QEL   Y A
Sbjct: 27  PLPGALPKHDN--RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKA 84

Query: 110 DVVCLQETDRIQWDKFWV----------EEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFE 159
           D++C+QE  +  + +FW            EF        +   P ++ GVAI +   MF+
Sbjct: 85  DIMCIQEMTKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFD 144

Query: 160 DTP-----LDKLPLCLDD----YVAGDDIAATTGTRTVA--------------LAVALRL 196
                   L+++    +D    Y+    +  T G                   +++ + L
Sbjct: 145 FVSSKGIYLNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSL 204

Query: 197 KHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK-VTDAHCPRGQRCYTFF 255
           +H  T    +   THL+W       +  Q  VI+ EL++ I   + D      ++    F
Sbjct: 205 QHKSTGMYFVVINTHLYWKYDEV--KLTQCMVIMRELSQIIDDLLKDVPDVTKEKVKIIF 262

Query: 256 TGDFNS 261
           TGD NS
Sbjct: 263 TGDLNS 268

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 94/232 (40%), Gaps = 37/232 (15%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           R  ++TYN L+ + +    +    +  K W  R ++L +EL   + AD++CLQE     +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDY 85

Query: 123 DKFWVEEFD-RLGYKGGFF---------NFPGKVHGVAIVWKTSMFE-----DTPLDKLP 167
           + +W +     + Y   F          N    + GV+I +    F+        L++L 
Sbjct: 86  EDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLL 145

Query: 168 LCLDD----YVAGDDIAATTGTRTVA--------------LAVALRLKHHKTSRPIIFST 209
              ++    Y+    +  T G   +               + + + LKH +T    +   
Sbjct: 146 NVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFVVLN 205

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
           THL+W       +  Q  +I+ EL+K IK++        ++    FTGD NS
Sbjct: 206 THLYWKYDEV--KLTQCMIIMRELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 99/234 (42%), Gaps = 41/234 (17%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           R  ++TYN L+ + +    +    +  K W  R ++L +EL   + AD++CLQE     +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDY 85

Query: 123 DKFWVEEFD-RLGYKGGFFN-FPGK--------VHGVAIVWKTSMFE-----DTPLDKL- 166
           + +W +     + Y   F +  P K        + GV+I +  + F+        L++L 
Sbjct: 86  EDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLL 145

Query: 167 --------------PLCLDD---YVAGDD--IAATTGTRTVALAVALRLKHHKTSRPIIF 207
                          + L D    V G+D  +    G   V L V+LR  H +T    + 
Sbjct: 146 NVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLR--HKETGTIFVV 203

Query: 208 STTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
             THL+W       +  Q  +I+ EL+K IK++        +R    FTGD NS
Sbjct: 204 LNTHLYWKYDEV--KLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNS 255

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 96/232 (41%), Gaps = 37/232 (15%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           R  ++TYN L+ + +    +    +  K W  R ++L +EL   + AD++CLQE  R  +
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDY 85

Query: 123 DKFWVEEFD-RLGYKGGFFN-FPGK--------VHGVAIVWKTSMFE-----DTPLDKLP 167
           + +W +     + Y   F +  P K        + GV+I +    F+        L++L 
Sbjct: 86  EDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLL 145

Query: 168 LCLDD----YVAGDDIAATTGTRTVA--------------LAVALRLKHHKTSRPIIFST 209
              ++    Y+    +  T G   V               + + + LKH +T    +   
Sbjct: 146 NVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDTIFVVLN 205

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
           THL+W       +  Q  +I+ EL+K I+++         +    FTGD NS
Sbjct: 206 THLYWKYDEV--KLTQCMIIMRELSKIIEQLLPGDAKGRGKVKILFTGDLNS 255

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 89/235 (37%), Gaps = 42/235 (17%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQE-LEYYDADVVCLQETDRIQW 122
           +   MTYN L+   +    +    D  K W+ R ++L +E L  Y AD++CLQE     +
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDY 87

Query: 123 DKFWVEEFDR-LGYKGGFFNFP---------GKVHGVAIVWKTSMFE-----DTPLDKLP 167
            ++W E  DR   Y   F   P           V GV I +  + F+        L+ L 
Sbjct: 88  HQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLI 147

Query: 168 LCLD----DYVAGDDIAATTGT----------------RTVALAVALRLKHHKTSRPIIF 207
              D     Y+    +  T G                   V L VAL  KH  T+   + 
Sbjct: 148 GSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVAL--KHKDTNTIFVV 205

Query: 208 STTHLFWHLFGTFERTRQLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNS 261
             THL+W       +  Q  +I+ +L K I+  +   H     +    F GD NS
Sbjct: 206 INTHLYWKYDEV--KLTQCLIIMRKLAKIIRDLLVGEHGTTYNKMKVVFAGDLNS 258

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 94/235 (40%), Gaps = 44/235 (18%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           +  ++TYN L+ + +    +    D  K W  R ++L  EL   Y AD++CLQE     +
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 123 DK-----------------------FWVEEFDRLGYKGGFFNFPG----KVHGVAIVWKT 155
           ++                       +W  E D +   G F+N          G+ +    
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 156 SMFEDTPLDKL---PLCLDDYVAGDDIA------ATTGTRTVALAVALRLKHHKTSRPII 206
           ++F  T L+ L    L L D  AG  I         +G   V L V+L  KH +T    +
Sbjct: 149 NVFSSTELEYLHSKRLVLTD-GAGVPIGEKNLLDVISGKNQVCLFVSL--KHKETGEMFV 205

Query: 207 FSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
              THL+W       +  Q  +I+ EL+K I ++       G +    FTGD NS
Sbjct: 206 VINTHLYWKYDEV--KLTQCMIIMRELSKIIDELVKGVDDPG-KVKILFTGDLNS 257

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 80/188 (42%), Gaps = 17/188 (9%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L +++  ++ D++CLQE +   ++ FW
Sbjct: 540 MLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDFW 599

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMF-----EDTPLDKLPLCLD 171
               ++ GY G F               KV G    +KTS F     E      L +   
Sbjct: 600 QPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKHK 659

Query: 172 DYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILS 231
            +   +D       +   +A+ ++L+H ++   +   TTHL W       +T Q+ V+L 
Sbjct: 660 KFQRTEDYLNRAMNKD-NVAIVMKLQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVGVLLD 718

Query: 232 ELNKFIKK 239
            +   +K+
Sbjct: 719 HMETLLKE 726

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 102/265 (38%), Gaps = 57/265 (21%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQE-LEYYDADVVCLQETDRIQWDKF 125
            MTYN L+   +    +    +  K W  R ++L +E L  Y AD++C+QE     +D F
Sbjct: 36  FMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYDGF 95

Query: 126 WVEEF-DRLGYKGGFFNF---------PGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVA 175
           W   F  ++ Y   F +          P ++ GV I +    FE   +    + L+D + 
Sbjct: 96  WKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEH--ISTTSIYLNDLIG 153

Query: 176 GDDIAATT---------------------------GTRTVALAVALRLKHHKTSRPIIFS 208
             +I+                              G   V+L V+L   H +T    +  
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLM--HKETRTLFVVI 211

Query: 209 TTHLFWHLFGTFERTR--QLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNSQPCD 265
            THL+W     ++  +  Q   I+ +L++ IK  +         +    F GD NS P D
Sbjct: 212 NTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGREGVTYSKVKILFAGDLNSAP-D 266

Query: 266 APYLSLTDKPVQLKGRAKSIIECSL 290
           +P +        LKG +    + SL
Sbjct: 267 SPVVKF------LKGESVHRADLSL 285

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 99/230 (43%), Gaps = 39/230 (16%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQE-LEYYDADVVCLQETDRIQWDKF 125
           ++TYN L+Q+ +    +       K W  R ++L  E L+ Y+AD++CLQE     ++ +
Sbjct: 24  LLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEYY 83

Query: 126 WVEEFDRLGYKGGFF-NFPGK--------VHGVAIVWKTSMFE--DTPLDKLP--LCLD- 171
           W ++  +      F    P K        + GV I +   MFE  D+   +L   L  D 
Sbjct: 84  WRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLISDF 143

Query: 172 -----DYVAGDDIAATTGT-RTVALA-------------VALRLKHHKTSRPIIFSTTHL 212
                DY+A   +  T G  R + ++             + + LKH +T   ++  TTHL
Sbjct: 144 EQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTTHL 203

Query: 213 FWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQ 262
           +W  +   + T Q  +I+ +L+K +K           +    F GD NS 
Sbjct: 204 YWK-YDEIKLT-QCMIIMRQLSKIMKDQLKKDGSSFVK--VLFAGDLNSN 249

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 100/252 (39%), Gaps = 45/252 (17%)

Query: 49  LEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQE-LEY 106
           L +P    +P  +   ++ ++TYN L+   +    +    D  K W+ R ++L +E L  
Sbjct: 6   LLIPVRSSIPGSNP-AKLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGL 64

Query: 107 YDADVVCLQETDRIQWDKFWVEEF-DRLGYKGGFFNFP---------GKVHGVAIVWKTS 156
           Y AD++CLQE   + + ++W +   ++  Y   +   P          ++ GV + +  +
Sbjct: 65  YRADIMCLQELTSLDYQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLN 124

Query: 157 MF--------------------EDTPLDKLPLCLDDYVAGDDIAATT------GTRTVAL 190
            F                    E   L+   L L D   G+ +   T      G   V +
Sbjct: 125 KFDYISSTGIYLNDLFGTFDLKEQNYLEHKMLQLTD-GQGNPMEKMTLSDVLKGRNQVCM 183

Query: 191 AVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK-VTDAHCPRGQ 249
            V+LR  H  T+  +I   THL+W       +  Q  +I+  L+K IK  +         
Sbjct: 184 FVSLR--HKATNTFLIVINTHLYWKYDEV--KLAQCMIIMRRLSKIIKDLLIGVQDTTYN 239

Query: 250 RCYTFFTGDFNS 261
           +    F GD NS
Sbjct: 240 KVKIIFAGDMNS 251

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 98/255 (38%), Gaps = 41/255 (16%)

Query: 44  IKRPLLEVPYVGGVP--CRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVL 100
           I R LL V Y G     CR    R  ++TYN L+   +    +    +  K W  R ++L
Sbjct: 20  INRQLLPV-YSGSASAGCRSER-RFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 101 IQELEY-YDADVVCLQETDRIQWDKFWVEEFD-RLGYKGGFFNFP---------GKVHGV 149
             EL + Y AD++CLQE     ++KFW ++   R+ ++  +   P          ++ GV
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 150 AIVWKTSMFED--TPLDKLPLCL-------DDYVAGDDIAATTGTRTVALAVALR----- 195
              +    FE   T L+ L   L        +++A   +  T  T  V    +L+     
Sbjct: 138 GTFYNADKFEHVATDLEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQ 197

Query: 196 ---------LKHHKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCP 246
                    L H  T    +   T L+W       +  Q F+I+  L   +K++      
Sbjct: 198 RNQVCLFVTLLHKPTGSLFVVVNTQLYWKYDEV--KLAQCFIIMRRLKAIVKRLLTRKDT 255

Query: 247 RGQRCYTFFTGDFNS 261
                    +GD NS
Sbjct: 256 SYSNIKVLLSGDLNS 270

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 93/243 (38%), Gaps = 41/243 (16%)

Query: 56  GVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVC 113
            +P R    +  ++TYN L+   +    +    D  K W  R  +L  EL   Y ADV+C
Sbjct: 27  NIPRRIPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMC 86

Query: 114 LQETDRIQWDKFWVEEFDR-LGYKGGFF-NFPGK--------VHGVAIVWKTSMFEDTPL 163
           LQE     +  +W   F + L Y   F    P K        + G  I +    FE   +
Sbjct: 87  LQELTWEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFE--YI 144

Query: 164 DKLPLCLDDYV---------------------AGDDIAATTGTRTVA----LAVALRLKH 198
               L L+D V                     AG+ +   T    +     + + + LKH
Sbjct: 145 SSTRLFLNDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKH 204

Query: 199 HKTSRPIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGD 258
            +T+   +   THL+W       +  Q  +I+ +L++ I ++     P   +   F TGD
Sbjct: 205 KETNNVFVVINTHLYWKYDEV--KLTQCMIIMRKLSQIINELLIGADPSLSKDVIFITGD 262

Query: 259 FNS 261
            NS
Sbjct: 263 LNS 265

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 85/213 (39%), Gaps = 41/213 (19%)

Query: 66  VKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQELEY-YDADVVCLQETDRIQWD 123
           + ++TYN L+   +    +    D  K W+ R ++L  EL Y + AD++CLQE     ++
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 124 KFWVEEFD-RLGYKGGFFNFP---------GKVHGVAIVWKT-----------------S 156
           +FW ++   RL Y   F + P          ++ GV   + T                 S
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 157 MFEDTPLDKLPLCLDDYVAGDDIAATTGT--------RTVALAVALRLKHHKTSRPIIFS 208
           MF    LD +         G +   TT +          V L V LR K   T   I+  
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREK--DTKSLIVVV 207

Query: 209 TTHLFWHLFGTFERTRQLFVILSELNKFIKKVT 241
            THL+W       +  Q   I+ +L + I K+T
Sbjct: 208 NTHLYWKYDEV--KLSQCLTIMRKLKQVINKLT 238

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 85/216 (39%), Gaps = 31/216 (14%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           I++YNTL Q       +      A+ W  R + L +++  Y +D++CLQE +   +++FW
Sbjct: 571 ILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEEFW 630

Query: 127 VEEFDRLGYKGGFF----------NFPGKVHGVAIVWKTSMFEDTPLDKLPLC------- 169
               ++  Y+G F               KV G  I +K S F+    + +          
Sbjct: 631 GPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMKHK 690

Query: 170 ----LDDYVAGDDIAATTGTRTVALAVALRLKHHKTSRPIIFSTTHLFWHLFGTFERTRQ 225
                +DY+               +A+ ++L+   +   +   TTHL W       +T Q
Sbjct: 691 KFQRTEDYL-------NRAMNKDNVALYMKLQSITSGETVWVVTTHLHWDPKFNDVKTFQ 743

Query: 226 LFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
           + ++L  +   +K+       +  +      GD NS
Sbjct: 744 VGILLDHMETLLKEENPKQDVK--KANVVICGDLNS 777

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 97/232 (41%), Gaps = 39/232 (16%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVL-IQELEYYDADVVCLQETDRIQW 122
           +  +++YN L+ + +    +    D  K W+ R  +L ++ L+ Y AD++C+QE  +  +
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 123 DKFWVEEFDR-LGYKGGFF-NFPGK--------VHGVAIVWKTSMFEDTPLDKLPL--CL 170
             +W  +    +GY   F    P K        + GVAI +    F+      + L   L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 171 D-------DYVAGDDIAATTGT------RTVALAVALR--------LKHHKTSRPIIFST 209
           D        Y+    +  T G       +T+   ++++        LKH +T +  I   
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN 208

Query: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNS 261
           THL+W       +  Q  +I+ EL+K I ++      R  +    F GD NS
Sbjct: 209 THLYWKYDEV--KLSQCIIIMRELSKIIDELLQD--VRHSKVKIIFAGDLNS 256

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 105/265 (39%), Gaps = 57/265 (21%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQE-LEYYDADVVCLQETDRIQWDKF 125
           +MTYN L+   +    +    +  K W  R ++L +E L  Y AD++C+QE     ++ F
Sbjct: 32  LMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYEGF 91

Query: 126 WVEEFD-RLGYKGGFF-NFPGK--------VHGVAIVWKTSMFEDTPLDKLPLCLDDYV- 174
           W   F  ++ Y   +    P K        + GV I +  + FE   +    + L+D + 
Sbjct: 92  WKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEH--ISTSSIYLNDLIG 149

Query: 175 --------------------AGDDIAATT------GTRTVALAVALRLKHHKTSRPIIFS 208
                               AG+ I   +      G   V+L V+L   H +T    +  
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLL--HKETRTLFVVV 207

Query: 209 TTHLFWHLFGTFERTR--QLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNSQPCD 265
            THL+W     ++  +  Q   I+ +L++ IK  +         +    F GD NS P D
Sbjct: 208 NTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNSAP-D 262

Query: 266 APYLSLTDKPVQLKGRAKSIIECSL 290
           +P +        LKG +    + SL
Sbjct: 263 SPVIKF------LKGESVHRADLSL 281

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 85/207 (41%), Gaps = 43/207 (20%)

Query: 93  WHRRSQVLIQE-LEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFF---NFPG---- 144
           W  R  +L +E L+ Y +D++C+QE   I +  FW +   +    G  F   N P     
Sbjct: 72  WKYRHNLLEKEILDKYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTK 131

Query: 145 ---KVHGVAIVWKTSMFE-----DTPLDKLPLCLD----DYVAGDDIAATTGTRTVA--- 189
              ++ GV I +   MF+        L+ L    D    DY+A  +I    G   V    
Sbjct: 132 SLVEMDGVGIFYNLDMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKE 191

Query: 190 ----LAVA------LRLKHHKTSRPI-IFSTTHLFWHLFGTFERTR--QLFVILSELNKF 236
               LA++        +  HK S+ + +   THL+W     +E  +  Q  +I+ +L K 
Sbjct: 192 SLYELALSKNQVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKI 247

Query: 237 IKKV---TDAHCPRGQRCYTFFTGDFN 260
           + ++    ++      +    F+GD N
Sbjct: 248 VNELLFNAESRDMNYNKVKILFSGDLN 274

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 91/238 (38%), Gaps = 46/238 (19%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           +  ++TYN L+   +    +    +  K W  R ++L  EL + Y AD++CLQE     +
Sbjct: 29  KFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDY 88

Query: 123 DKFWVEEF-DRLGYKGGFFN-FPGK--------VHGVAIVWKTSMFEDTPLDKLPLCLDD 172
             FW ++  + L Y   F +  P K        + GV I +    FE   +    + L+D
Sbjct: 89  HNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFE--YISSSSIYLND 146

Query: 173 YV---------------------AGDDIAATT------GTRTVALAVALRLKHHKTSRPI 205
            +                     AG+ I          G   V L V+LR  H  T+   
Sbjct: 147 VLGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLR--HKDTNTVF 204

Query: 206 IFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK-VTDAHCPRGQRCYTFFTGDFNSQ 262
           +   THL+W       +  Q   I+ +L + IK  +         +    F+GD NS 
Sbjct: 205 VVINTHLYWKYDEV--KLSQCLTIMRKLERIIKSLLMGVEGVTYSKVKILFSGDLNSN 260

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 68  IMTYNTLAQTLIRRTTFPDAKD-AIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFW 126
           +++YNTL Q       +      A+ W  R + L  ++  Y +D++CLQE +   +++FW
Sbjct: 528 LLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFW 587

Query: 127 VEEFDRLGYKGGF 139
               ++  Y+G F
Sbjct: 588 SPLLEKYDYQGIF 600

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 91/241 (37%), Gaps = 48/241 (19%)

Query: 65  RVKIMTYNTLAQTLIRRTTFPDAKDAIK-WHRRSQVLIQEL-EYYDADVVCLQETDRIQW 122
           +  ++TYN L+   +    +    D  K W  R ++L  EL + Y AD++CLQE     +
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 123 DKFWVEEFD-RLGYKGGFF---------NFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDD 172
             +W  + + ++ Y   F              ++ G  I +    FE     K  L L+D
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTK--LFLND 164

Query: 173 YVA-----------------GDDIAATTGTR---TVA-----LAVALRLKHHKTSRPIIF 207
            V                   D     TGT    TVA     + + + L+H  T+   + 
Sbjct: 165 VVGTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVV 224

Query: 208 STTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPR-------GQRCYTFFTGDFN 260
             THL+W       +  Q  +I+ +L+  I ++      +        +     F+GD N
Sbjct: 225 INTHLYWKYDEV--KLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDLN 282

Query: 261 S 261
           S
Sbjct: 283 S 283

>KAFR0A06800 Chr1 (1372990..1374732) [1743 bp, 580 aa] {ON}
           Anc_2.330 YDL109C
          Length = 580

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 79  IRRTTFPDAKDAIKWHRRSQVLIQELE----YYDADVVCLQETDRIQWDKFWVEEFDRLG 134
           + +TT  + KD I WH +S++ I ++E     Y  ++    +   +   KF      R G
Sbjct: 1   MEKTTHSNKKDKILWHSKSRIQIAQIERFIIKYSGELPVWLKVKNVSKFKF------RAG 54

Query: 135 YKGGFFN 141
           Y GG FN
Sbjct: 55  YLGGPFN 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,564,094
Number of extensions: 2196537
Number of successful extensions: 7599
Number of sequences better than 10.0: 87
Number of HSP's gapped: 7629
Number of HSP's successfully gapped: 93
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)