Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G03460singletonON40040020520.0
KNAG0E007905.58ON39739716300.0
NCAS0D012805.58ON40040016130.0
KAFR0E023405.58ON40039916010.0
NCAS0J01750singletonON40040016010.0
CAGL0I02574g5.58ON40140115980.0
NCAS0C02260singletonON45240015960.0
Kpol_1018.121na 1ON40039915900.0
Smik_8.2635.58ON40039915870.0
Kpol_1054.16singletonON40039915790.0
Suva_15.3795.58ON40040015760.0
YHR179W (OYE2)5.58ON40039915750.0
Kpol_534.36singletonON39939915700.0
KAFR0F03530singletonON40040015690.0
NDAI0A08130singletonON40140015680.0
Skud_8.2435.58ON40039915630.0
TDEL0G008205.58ON39839715620.0
TPHA0A02230na 1ON40040015390.0
SAKL0H22044g5.58ON40040015280.0
CAGL0I02024gsingletonON40040015240.0
NDAI0C034605.58ON39940015240.0
SAKL0C00396gsingletonON40039815220.0
NDAI0B009205.58ON42639715060.0
NCAS0E038905.58ON39339115000.0
YPL171C (OYE3)na 2ON40039914970.0
KLTH0E07920g5.58ON40039714960.0
KLTH0E07898gsingletonON40039714770.0
Kwal_47.16561singletonON39939514740.0
TBLA0A10550singletonON40040014730.0
TBLA0J00530singletonON40039814510.0
TBLA0G03670singletonON40039914490.0
KAFR0B07070singletonON40039614240.0
TBLA0I03570singletonON40040014220.0
KLLA0A09075g5.58ON39839914190.0
KAFR0F03540singletonON40040014120.0
TBLA0C01370singletonON42340014140.0
ZYRO0C11902g5.58ON40039514040.0
TDEL0E00270singletonON40239014030.0
Suva_16.139na 2ON39139913880.0
CAGL0L09537gsingletonON40040013760.0
KLTH0G01584gsingletonON40039613690.0
CAGL0K10890gsingletonON40040013660.0
NCAS0B00730singletonON39539413610.0
TBLA0E03220singletonON40040013300.0
NCAS0B01090na 3ON39539413190.0
KAFR0F03550singletonON40040013160.0
Kpol_370.3singletonON40040113071e-180
NDAI0E00850singletonON39939513051e-180
TBLA0D00160singletonON41839413031e-179
TBLA0G00610singletonON39940313001e-179
NDAI0A00330singletonON39739512871e-177
ZYRO0F13618gsingletonON40239712841e-176
KNAG0L00690singletonON39839712781e-175
TBLA0D03290singletonON40040012781e-175
KNAG0B05410singletonON39839712741e-175
KAFR0E00120singletonON40040012671e-174
TBLA0B02130singletonON39839712591e-173
ZYRO0F12144gsingletonON39739712541e-172
NDAI0E01890singletonON39939512381e-169
KNAG0D03170singletonON41339512371e-169
TPHA0H02440singletonON39739712321e-168
TBLA0E00660singletonON39539112221e-167
NCAS0D04260singletonON41938912131e-165
NCAS0C04110singletonON38839012051e-164
KNAG0J00330na 3ON39839711981e-163
AGR329CsingletonON39938911311e-153
TBLA0C07300singletonON30630610621e-144
ZYRO0C11924gsingletonON38838910281e-138
TPHA0P01030singletonON39339910221e-137
Kpol_370.4singletonON3893959831e-131
TBLA0D03340singletonON2892898051e-105
TBLA0A04730singletonON2692727266e-94
ZYRO0F16852gsingletonON3373536632e-83
KAFR0I00110singletonON2072076346e-81
NDAI0A07930singletonON1471476071e-77
ZYRO0G15444gsingletonON3393454021e-44
TBLA0D03350singletonON1611533652e-41
Smik_6.368singletonOFF3283663722e-40
NDAI0C04500singletonON81702781e-29
KAFR0B044855.58ON2723422229e-20
SAKL0C01738g1.53ON4292221853e-14
KAFR0D040901.53ON3812101808e-14
CAGL0K05687g1.53ON3882101763e-13
KLLA0C01672g1.53ON4092281746e-13
Kpol_2000.911.53ON3822011443e-09
Kwal_47.175195.58ON65551224e-08
TPHA0B047401.53ON3932161311e-07
Skud_16.110singletonON70351067e-06
NDAI0F043701.53ON4351251142e-05
Skud_16.109na 2ON3431932e-04
Skud_16.111singletonON3334888e-04
NDAI0C017605.393ON65698741.3
KNAG0K026003.9ON102586722.5
KLTH0E03564g5.380ON71072713.3
AFL206C5.393ON64898703.7
Kpol_1059.405.393ON64998704.5
ZYRO0A06710g5.393ON64657704.7
Suva_2.5115.393ON607100687.0
KAFR0B029208.295ON4933128687.3
NCAS0H018705.393ON68198687.9
Skud_4.6105.393ON60798679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03460
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03460 Chr7 (741939..743141) [1203 bp, 400 aa] {ON}              795   0.0  
KNAG0E00790 Chr5 (142962..144155) [1194 bp, 397 aa] {ON} Anc_5.5...   632   0.0  
NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {O...   625   0.0  
KAFR0E02340 Chr5 (470967..472169) [1203 bp, 400 aa] {ON} Anc_5.5...   621   0.0  
NCAS0J01750 Chr10 complement(324339..325541) [1203 bp, 400 aa] {...   621   0.0  
CAGL0I02574g Chr9 (232393..233598) [1206 bp, 401 aa] {ON} highly...   620   0.0  
NCAS0C02260 Chr3 complement(425626..426984) [1359 bp, 452 aa] {O...   619   0.0  
Kpol_1018.121 s1018 complement(320805..322007) [1203 bp, 400 aa]...   617   0.0  
Smik_8.263 Chr8 (439298..440500) [1203 bp, 400 aa] {ON} YHR179W ...   615   0.0  
Kpol_1054.16 s1054 (39314..40516) [1203 bp, 400 aa] {ON} (39314....   612   0.0  
Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179...   611   0.0  
YHR179W Chr8 (462502..463704) [1203 bp, 400 aa] {ON}  OYE2Conser...   611   0.0  
Kpol_534.36 s534 (89925..90272,90276..91127) [1200 bp, 399 aa] {...   609   0.0  
KAFR0F03530 Chr6 (702060..703262) [1203 bp, 400 aa] {ON}              608   0.0  
NDAI0A08130 Chr1 complement(1863451..1864656) [1206 bp, 401 aa] ...   608   0.0  
Skud_8.243 Chr8 (433873..435075) [1203 bp, 400 aa] {ON} YHR179W ...   606   0.0  
TDEL0G00820 Chr7 complement(168417..169613) [1197 bp, 398 aa] {O...   606   0.0  
TPHA0A02230 Chr1 (461324..462526) [1203 bp, 400 aa] {ON}              597   0.0  
SAKL0H22044g Chr8 (1926684..1927886) [1203 bp, 400 aa] {ON} high...   593   0.0  
CAGL0I02024g Chr9 complement(172231..173433) [1203 bp, 400 aa] {...   591   0.0  
NDAI0C03460 Chr3 (792929..794128) [1200 bp, 399 aa] {ON} Anc_5.58     591   0.0  
SAKL0C00396g Chr3 complement(35526..36728) [1203 bp, 400 aa] {ON...   590   0.0  
NDAI0B00920 Chr2 (212588..213868) [1281 bp, 426 aa] {ON} Anc_5.58     584   0.0  
NCAS0E03890 Chr5 complement(763948..765129) [1182 bp, 393 aa] {O...   582   0.0  
YPL171C Chr16 complement(226169..227371) [1203 bp, 400 aa] {ON} ...   581   0.0  
KLTH0E07920g Chr5 (728285..729487) [1203 bp, 400 aa] {ON} highly...   580   0.0  
KLTH0E07898g Chr5 (725950..727152) [1203 bp, 400 aa] {ON} highly...   573   0.0  
Kwal_47.16561 s47 (4316..5515) [1200 bp, 399 aa] {ON} YHR179W (O...   572   0.0  
TBLA0A10550 Chr1 (2607210..2608412) [1203 bp, 400 aa] {ON}            572   0.0  
TBLA0J00530 Chr10 complement(103254..104456) [1203 bp, 400 aa] {...   563   0.0  
TBLA0G03670 Chr7 complement(974043..975245) [1203 bp, 400 aa] {O...   562   0.0  
KAFR0B07070 Chr2 complement(1474959..1476161) [1203 bp, 400 aa] ...   553   0.0  
TBLA0I03570 Chr9 complement(855914..857116) [1203 bp, 400 aa] {O...   552   0.0  
KLLA0A09075g Chr1 complement(792171..793367) [1197 bp, 398 aa] {...   551   0.0  
KAFR0F03540 Chr6 (703965..705167) [1203 bp, 400 aa] {ON}              548   0.0  
TBLA0C01370 Chr3 (311585..312856) [1272 bp, 423 aa] {ON}              549   0.0  
ZYRO0C11902g Chr3 (931466..932668) [1203 bp, 400 aa] {ON} highly...   545   0.0  
TDEL0E00270 Chr5 (60549..61757) [1209 bp, 402 aa] {ON}                545   0.0  
Suva_16.139 Chr16 complement(235387..236562) [1176 bp, 391 aa] {...   539   0.0  
CAGL0L09537g Chr12 (1029031..1030233) [1203 bp, 400 aa] {ON} hig...   534   0.0  
KLTH0G01584g Chr7 complement(114328..115530) [1203 bp, 400 aa] {...   531   0.0  
CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} hig...   530   0.0  
NCAS0B00730 Chr2 (110836..112023) [1188 bp, 395 aa] {ON}              528   0.0  
TBLA0E03220 Chr5 complement(808667..809869) [1203 bp, 400 aa] {O...   516   0.0  
NCAS0B01090 Chr2 (180367..181554) [1188 bp, 395 aa] {ON}              512   0.0  
KAFR0F03550 Chr6 (706557..707759) [1203 bp, 400 aa] {ON}              511   0.0  
Kpol_370.3 s370 (3999..5201) [1203 bp, 400 aa] {ON} (3999..5201)...   508   e-180
NDAI0E00850 Chr5 complement(170233..171432) [1200 bp, 399 aa] {O...   507   e-180
TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON}      506   e-179
TBLA0G00610 Chr7 complement(133711..134910) [1200 bp, 399 aa] {O...   505   e-179
NDAI0A00330 Chr1 (47534..48727) [1194 bp, 397 aa] {ON}                500   e-177
ZYRO0F13618g Chr6 (1122697..1123905) [1209 bp, 402 aa] {ON} simi...   499   e-176
KNAG0L00690 Chr12 complement(110526..111722) [1197 bp, 398 aa] {...   496   e-175
TBLA0D03290 Chr4 complement(821240..822442) [1203 bp, 400 aa] {O...   496   e-175
KNAG0B05410 Chr2 complement(1046164..1047360) [1197 bp, 398 aa] ...   495   e-175
KAFR0E00120 Chr5 (19340..20542) [1203 bp, 400 aa] {ON}                492   e-174
TBLA0B02130 Chr2 (488878..490074) [1197 bp, 398 aa] {ON}              489   e-173
ZYRO0F12144g Chr6 complement(986860..988053) [1194 bp, 397 aa] {...   487   e-172
NDAI0E01890 Chr5 complement(384211..385410) [1200 bp, 399 aa] {O...   481   e-169
KNAG0D03170 Chr4 complement(567087..568328) [1242 bp, 413 aa] {O...   481   e-169
TPHA0H02440 Chr8 complement(575387..576580) [1194 bp, 397 aa] {O...   479   e-168
TBLA0E00660 Chr5 complement(130778..131965) [1188 bp, 395 aa] {O...   475   e-167
NCAS0D04260 Chr4 complement(805403..806662) [1260 bp, 419 aa] {O...   471   e-165
NCAS0C04110 Chr3 (838638..839804) [1167 bp, 388 aa] {ON}              468   e-164
KNAG0J00330 Chr10 complement(52717..53913) [1197 bp, 398 aa] {ON}     466   e-163
AGR329C Chr7 complement(1346011..1347210) [1200 bp, 399 aa] {ON}...   440   e-153
TBLA0C07300 Chr3 complement(1778734..1779654) [921 bp, 306 aa] {...   413   e-144
ZYRO0C11924g Chr3 (932751..933917) [1167 bp, 388 aa] {ON} simila...   400   e-138
TPHA0P01030 Chr16 (207281..208462) [1182 bp, 393 aa] {ON}             398   e-137
Kpol_370.4 s370 (5694..6863) [1170 bp, 389 aa] {ON} (5694..6863)...   383   e-131
TBLA0D03340 Chr4 (832010..832879) [870 bp, 289 aa] {ON}               314   e-105
TBLA0A04730 Chr1 complement(1173457..1174266) [810 bp, 269 aa] {...   284   6e-94
ZYRO0F16852g Chr6 complement(1402055..1403068) [1014 bp, 337 aa]...   259   2e-83
KAFR0I00110 Chr9 (21926..22549) [624 bp, 207 aa] {ON}                 248   6e-81
NDAI0A07930 Chr1 complement(1823416..1823859) [444 bp, 147 aa] {...   238   1e-77
ZYRO0G15444g Chr7 (1256468..1257487) [1020 bp, 339 aa] {ON} weak...   159   1e-44
TBLA0D03350 Chr4 (835570..836055) [486 bp, 161 aa] {ON}  OYE fam...   145   2e-41
Smik_6.368 Chr6 (596883..597008,597012..597242,597246..597401,59...   147   2e-40
NDAI0C04500 Chr3 complement(1020217..1020462) [246 bp, 81 aa] {O...   111   1e-29
KAFR0B04485 Chr2 (930962..931780) [819 bp, 272 aa] {ON}                90   9e-20
SAKL0C01738g Chr3 complement(147860..149149) [1290 bp, 429 aa] {...    76   3e-14
KAFR0D04090 Chr4 (808332..809477) [1146 bp, 381 aa] {ON} Anc_1.53      74   8e-14
CAGL0K05687g Chr11 (555370..556536) [1167 bp, 388 aa] {ON} simil...    72   3e-13
KLLA0C01672g Chr3 complement(131543..132772) [1230 bp, 409 aa] {...    72   6e-13
Kpol_2000.91 s2000 (205107..206255) [1149 bp, 382 aa] {ON} (2051...    60   3e-09
Kwal_47.17519 s47 (437989..438186) [198 bp, 65 aa] {ON} YHR179W ...    52   4e-08
TPHA0B04740 Chr2 (1116411..1117592) [1182 bp, 393 aa] {ON} Anc_1...    55   1e-07
Skud_16.110 Chr16 complement(198564..198761,198765..198776) [210...    45   7e-06
NDAI0F04370 Chr6 (1070446..1071753) [1308 bp, 435 aa] {ON} Anc_1...    49   2e-05
Skud_16.109 Chr16 complement(198429..198530) [102 bp, 34 aa] {ON...    40   2e-04
Skud_16.111 Chr16 complement(198785..198808,198812..198886) [99 ...    39   8e-04
NDAI0C01760 Chr3 (384545..386515) [1971 bp, 656 aa] {ON} Anc_5.3...    33   1.3  
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...    32   2.5  
KLTH0E03564g Chr5 (320984..323116) [2133 bp, 710 aa] {ON} simila...    32   3.3  
AFL206C Chr6 complement(46599..48545) [1947 bp, 648 aa] {ON} Syn...    32   3.7  
Kpol_1059.40 s1059 (90774..92723) [1950 bp, 649 aa] {ON} (90774....    32   4.5  
ZYRO0A06710g Chr1 (548548..550488) [1941 bp, 646 aa] {ON} highly...    32   4.7  
Suva_2.511 Chr2 complement(909401..911224) [1824 bp, 607 aa] {ON...    31   7.0  
KAFR0B02920 Chr2 complement(600352..615153) [14802 bp, 4933 aa] ...    31   7.3  
NCAS0H01870 Chr8 complement(359166..361211) [2046 bp, 681 aa] {O...    31   7.9  
Skud_4.610 Chr4 complement(1087702..1089525) [1824 bp, 607 aa] {...    30   9.3  

>KNAG0G03460 Chr7 (741939..743141) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/400 (96%), Positives = 386/400 (96%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ
Sbjct: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG
Sbjct: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN
Sbjct: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARF              KK
Sbjct: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFALEVVDALVEAVGAKK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE
Sbjct: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR
Sbjct: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ
Sbjct: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400

>KNAG0E00790 Chr5 (142962..144155) [1194 bp, 397 aa] {ON} Anc_5.58
           YHR179W
          Length = 397

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/397 (74%), Positives = 337/397 (84%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF PVALGDTNL +PI++G+ QLQHR V+PPLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MPFVKDFTPVALGDTNLFKPIKIGNSQLQHRCVLPPLTRMRAHHPGNVPNKDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+++ITEG F  PQAGGYDNAPGIWS+EQVAQW KIF +IH+N SFVYVQLW LG
Sbjct: 61  RSRRPGTMLITEGAFTCPQAGGYDNAPGIWSEEQVAQWKKIFAKIHENKSFVYVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYD+ SD  YM EEQKERALK+NNPQHG+TK EIK+YIK YV AA N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDEEQKERALKSNNPQHGITKDEIKEYIKAYVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N R DEYGGS+ENRARF               K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNHRIDEYGGSIENRARFTLEVVDALVDAIGADK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTM+GG    IVAQYAY+VGELQ+RAN G+ LA+IHLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFGTMSGGAECSIVAQYAYVVGELQKRANAGKPLAFIHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y+ GTNDFVYSIW GP+IRAGNLALHP+   ++++D+RTLIGYGRFWIANPD+V R
Sbjct: 301 GEGEYHQGTNDFVYSIWKGPVIRAGNLALHPEEVKKLVEDDRTLIGYGRFWIANPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           ++ G PLNKY+RD FY M+ EGYLDYPTY+EA+KLG+
Sbjct: 361 IEKGQPLNKYNRDAFYSMTSEGYLDYPTYDEAVKLGY 397

>NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {ON}
           Anc_5.58
          Length = 400

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/400 (73%), Positives = 334/400 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF PVALGDTNL +PI++G+ QLQHR V+PPLTRMRA HPGNVPNKDWA EYYNQ
Sbjct: 1   MPFVKDFTPVALGDTNLFKPIKIGNNQLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+L+ITEG FI  QAGGYDNAPGIWSDEQV QW KIF +IH+N SFV+VQLWALG
Sbjct: 61  RSQRPGTLLITEGAFICAQAGGYDNAPGIWSDEQVEQWKKIFAKIHENKSFVWVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYD+ SD  YM  EQ+ERA KANNPQHGLTK EIK+YIK YV AA N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDAEQEERAKKANNPQHGLTKEEIKEYIKCYVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDALVDAIGEDK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYGTFGTM+GG +P ++AQYAY++GEL++RA  G++LA++HLVEPRVT+PFLTE
Sbjct: 241 VGVRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G YN GTNDF YSIW G IIRAGNLALHP+   +M+ D+RTLIGYGRF+IANPD+V R
Sbjct: 301 GQGEYNDGTNDFAYSIWKGAIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ G   NKYDRDTFY M+  GY DYPTY+EA+KLGWDKQ
Sbjct: 361 LEKGQQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 400

>KAFR0E02340 Chr5 (470967..472169) [1203 bp, 400 aa] {ON} Anc_5.58
           YHR179W
          Length = 400

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/399 (72%), Positives = 335/399 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKDF PVAL DTNL +PI++G+ +L HR V+PPLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MSFVKDFTPVALKDTNLFKPIKIGNTELLHRCVLPPLTRMRAHHPGNVPNKDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  GS++ITEG F  PQAGGYDNAPGIWS EQ+ QW  IF +IH+N SFV+VQLW LG
Sbjct: 61  RSKRAGSMLITEGAFTCPQAGGYDNAPGIWSPEQIEQWKNIFAKIHENKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQS+AD L RDGLRYD+ SD  YM EEQKE+ALK+NNPQHG+TK EIK+YIK YV+AA N
Sbjct: 121 RQSFADVLARDGLRYDSASDDIYMDEEQKEKALKSNNPQHGITKEEIKEYIKNYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAIVDAIGNDK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SPYGTFGTM+GG +P IVAQYAY++GEL+RRA EG++LA++HLVEPRVT+PFLTE
Sbjct: 241 VGIRLSPYGTFGTMSGGADPSIVAQYAYVLGELERRAKEGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGAY  GTNDF YSIW GPIIRAGNLALHP+   +M+ D+RTLIGYGRFWI+NPD+V R
Sbjct: 301 GEGAYVDGTNDFAYSIWKGPIIRAGNLALHPEAVQDMVADDRTLIGYGRFWISNPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKYDR TFY M+++GYLDYPTYEEA+KLG+DK
Sbjct: 361 LEKGLPLNKYDRSTFYAMTEKGYLDYPTYEEAIKLGYDK 399

>NCAS0J01750 Chr10 complement(324339..325541) [1203 bp, 400 aa] {ON}
           
          Length = 400

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/400 (72%), Positives = 336/400 (84%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF PVALG+TNL +PI++G+ +LQHR V+PPLTRMRA HPGNVPNKDWA EYYNQ
Sbjct: 1   MPFVKDFTPVALGETNLFKPIKIGNNKLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+L+ITEG FI  QAGGYDNAPGIWSDEQV +W KIF +IH+N SFV+VQLWALG
Sbjct: 61  RSQRPGTLLITEGAFICAQAGGYDNAPGIWSDEQVEEWKKIFAQIHENKSFVWVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYD+ SD  YM  EQ+ERA K++NPQHGLTK EIK+YIK YV+AA N
Sbjct: 121 RQSYADTLARDGLRYDSASDNVYMDAEQEERAKKSSNPQHGLTKEEIKEYIKCYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           S  AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SFAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGEEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+RFSPYGTFGTM+GG +P ++AQYAYI+GEL++RA  G++LA++HLVEPRVTDPFLTE
Sbjct: 241 VGVRFSPYGTFGTMSGGADPTLLAQYAYILGELEKRAKAGKRLAFVHLVEPRVTDPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G YN GTNDF YSIW G IIRAGNLALHP+   +M+ D+RTLIGYGRF+IANPD+V R
Sbjct: 301 GQGEYNDGTNDFAYSIWKGVIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           ++ G   NKYDRDTFY M+  GY DYPTY+EA+KLGWDKQ
Sbjct: 361 VEKGEQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 400

>CAGL0I02574g Chr9 (232393..233598) [1206 bp, 401 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 401

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/401 (72%), Positives = 339/401 (84%), Gaps = 1/401 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKP+AL DTN+ +PI++G+ ++ HR VMPPLTRMRA HPGNVPNK+WA EYY Q
Sbjct: 1   MPFVKDFKPIALKDTNMFKPIKIGNTEVAHRVVMPPLTRMRAHHPGNVPNKEWAVEYYKQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++IITEG F   QAGGYDNAPGIWS+EQVA+WTKIFK IHDN SFV+VQLW LG
Sbjct: 61  RSQRPGTMIITEGAFPCAQAGGYDNAPGIWSEEQVAEWTKIFKAIHDNKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ DTL RDGLRYD+ SD  YM +E +E+A K+NNPQHG+TK EIKQYIK+YV+AA N
Sbjct: 121 RQAFPDTLARDGLRYDSASDEVYMDKESEEKAKKSNNPQHGITKDEIKQYIKDYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAIVDAIGPEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
            GIRFSPYGTFGTM+GG  PLIVAQYAY++GEL++RA  G++LA++HLVEPRVT+PF TE
Sbjct: 241 TGIRFSPYGTFGTMSGGAEPLIVAQYAYVLGELEKRAKAGKKLAFVHLVEPRVTNPFFTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEML-KDNRTLIGYGRFWIANPDLVR 359
           G+G Y  GTNDF YSIWTGPIIRAGN ALHP++A E +  D+RTLIGYGRF+IANPD+V 
Sbjct: 301 GQGEYKDGTNDFAYSIWTGPIIRAGNYALHPEIAKEHVNNDDRTLIGYGRFFIANPDIVD 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           R++ GLPLNKYDRDTFY M+ EGYLDYPTY+EA+K+GWDKQ
Sbjct: 361 RIEKGLPLNKYDRDTFYAMTTEGYLDYPTYDEAIKMGWDKQ 401

>NCAS0C02260 Chr3 complement(425626..426984) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/400 (72%), Positives = 334/400 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF PVALGDTNL +PI++G+ +LQHR V+PPLTRMRA HPGNVPNKDWA EYYNQ
Sbjct: 53  MPFVKDFTPVALGDTNLFKPIKIGNNKLQHRVVLPPLTRMRATHPGNVPNKDWAVEYYNQ 112

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+++ITEG F+  QAGGYDNAPGIWSDEQV QW KIF +IH+N SFV+VQLWALG
Sbjct: 113 RSQRPGTMLITEGAFVCAQAGGYDNAPGIWSDEQVEQWKKIFAKIHENKSFVWVQLWALG 172

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRY + SD  YM  EQ+ERA K+NNPQHGLTK EIK+YIK YV+AA N
Sbjct: 173 RQSYADTLARDGLRYYSASDNVYMDAEQEERAKKSNNPQHGLTKKEIKEYIKCYVQAAKN 232

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGA+GVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 233 SIAAGANGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDALVDAIGEEK 292

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+RFSPYG FGTM+GG +P ++AQYAYI+GEL++RA  G++LA++HLVEPRVTDPFLTE
Sbjct: 293 VGVRFSPYGIFGTMSGGADPTLLAQYAYILGELEKRAKAGKRLAFVHLVEPRVTDPFLTE 352

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G Y  GTNDF YSIW G IIRAGNLALHP+   +M+ D+RTLIGYGRF+IANPD+V R
Sbjct: 353 GQGEYTDGTNDFAYSIWKGVIIRAGNLALHPESVKQMVADDRTLIGYGRFFIANPDIVDR 412

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           ++ G   NKYDRDTFY M+  GY DYPTY+EA+KLGWDKQ
Sbjct: 413 VEKGQQFNKYDRDTFYAMTAHGYTDYPTYDEAIKLGWDKQ 452

>Kpol_1018.121 s1018 complement(320805..322007) [1203 bp, 400 aa]
           {ON} complement(320805..322007) [1203 nt, 401 aa]
          Length = 400

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/399 (71%), Positives = 341/399 (85%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKP+AL DTNL +PI++G+ +L+HRAV+PPLTRMRA HPGNVPNK+WA EYY+Q
Sbjct: 1   MPFVKDFKPIALKDTNLFKPIKIGNNELKHRAVLPPLTRMRAHHPGNVPNKEWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+++ITEG F SPQAGGYDNAPG+WS+EQ+A+W KIF ++H+N SF++ QLW LG
Sbjct: 61  RSKREGTMLITEGVFPSPQAGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYD+ SD  YMS EQ+  A K+NNPQHGLTK EIKQYIKEYV+AA N
Sbjct: 121 RQSYADTLARDGLRYDSASDEVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I  GADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVEAIGHER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTM+G  +P ++AQYAY+VGEL++RA EG++LAYIHLVEPRVTDPFLTE
Sbjct: 241 VGIRFSPYGTFGTMSGASDPSLIAQYAYVVGELEKRAREGKRLAYIHLVEPRVTDPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTNDFVYSIW GPIIRAGNLALHP+   EM++D+RTLIGYGR++I+NPD+V R
Sbjct: 301 GEGEYLDGTNDFVYSIWKGPIIRAGNLALHPEAVKEMVEDDRTLIGYGRYFISNPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           ++ GLPLNKYDRDTFY M+ +GYLDYPTY+EA+K+GWDK
Sbjct: 361 VEKGLPLNKYDRDTFYAMTPKGYLDYPTYDEAIKMGWDK 399

>Smik_8.263 Chr8 (439298..440500) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/399 (72%), Positives = 334/399 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKP ALGDTNL +PI++G  +L HRAV+PPLTRMRA HPGNVPNKDWA EYY Q
Sbjct: 1   MPFVKDFKPQALGDTNLFKPIKIGKNELLHRAVIPPLTRMRAHHPGNVPNKDWAVEYYAQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG+LI+TEGTFISPQ+GGYDNAPGIWS+EQ+ +WTKIFK IHD  SF +VQLW LG
Sbjct: 61  RAQRPGTLIVTEGTFISPQSGGYDNAPGIWSEEQMKEWTKIFKAIHDRKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             ++ DTL RDGLRYD+ SD  YMS EQ+E+A KANNPQH LTK EIKQYIKEYV+AA N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMSAEQEEKAKKANNPQHSLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAIVDAIGHEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYG F +M+GG    IVAQ+AY++GEL+RRA  G++LA++HLVEPRVT+PFL E
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQFAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y+ G+NDFVYSIW GPIIRAGN ALHP+V  E +KD RTLIGYGRF+I+NPDLV R
Sbjct: 301 GEGEYHGGSNDFVYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKYDRDTFY+MS EGY+DYPTYEEALKLGWDK
Sbjct: 361 LEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGWDK 399

>Kpol_1054.16 s1054 (39314..40516) [1203 bp, 400 aa] {ON}
           (39314..40516) [1203 nt, 401 aa]
          Length = 400

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/399 (71%), Positives = 336/399 (84%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV+DFKP+AL DTN+ +PI++G+ +L+HRAV+PPLTRMRA HPGNVPNKDWA EYYNQ
Sbjct: 1   MPFVQDFKPIALKDTNMFKPIKIGNTELKHRAVLPPLTRMRAHHPGNVPNKDWAVEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+++ITEG F S Q+GGYDNAPG+WS+EQ+A+W KIF ++H+N SF++ QLW LG
Sbjct: 61  RSKREGTMLITEGVFPSAQSGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYD+ SD  YMS EQ+  A K+NNPQHGLTK EIKQYIKEYV+AA N
Sbjct: 121 RQSYADTLARDGLRYDSASDDVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I  GADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAIVEAVGHEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYG FGTM+G   P ++AQYAY++GEL++RA EG++LAYIH+VEPRVTDPFLTE
Sbjct: 241 VGIRFSPYGKFGTMSGAAEPTLLAQYAYVIGELEKRAREGKRLAYIHIVEPRVTDPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTNDFVYSIW GPIIRAGN ALHP+   EM+KD+RTLI YGRF+IANPD+V R
Sbjct: 301 GEGVYLDGTNDFVYSIWKGPIIRAGNFALHPEDVEEMVKDDRTLIAYGRFFIANPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           ++ GLPLNKYDRDTFY MSD+GYLDYPTY+EA+K+GW K
Sbjct: 361 IEKGLPLNKYDRDTFYAMSDKGYLDYPTYDEAIKMGWGK 399

>Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/400 (71%), Positives = 332/400 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKDFKP ALGDTNL +PI++G+ +L HRAV+PPLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNVPNKDWAVEYYSQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG++IITEG FISPQAGGYDNAPG+WS+EQ+A+WTKIF  IH+  SFV+VQLW LG
Sbjct: 61  RAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMAEWTKIFNAIHEKKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             ++ DTL RDGLRYD+ SD  YM  EQ+ +A KANNPQH LTK EIKQYI+EYV+AA N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMDAEQEAKAKKANNPQHSLTKDEIKQYIREYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGQEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYG F +M+GG    IVAQYAY++GEL+RRA  G++LA++HLVEPRVT+PFL E
Sbjct: 241 VGVRLSPYGVFNSMSGGAETSIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG YN G+NDFVYSIW GPIIRAGN ALHP+V  E +KD RTLIGYGRF+I+NPDLV R
Sbjct: 301 GEGEYNEGSNDFVYSIWKGPIIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKYDR+TFY+MS  GY DYPTYEEALKLGWDK+
Sbjct: 361 LEKGLPLNKYDRNTFYQMSAHGYTDYPTYEEALKLGWDKK 400

>YHR179W Chr8 (462502..463704) [1203 bp, 400 aa] {ON}  OYE2Conserved
           NADPH oxidoreductase containing flavin mononucleotide
           (FMN), homologous to Oye3p with different ligand binding
           and catalytic properties; may be involved in sterol
           metabolism, oxidative stress response, and programmed
           cell death
          Length = 400

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/399 (71%), Positives = 334/399 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKP ALGDTNL +PI++G+ +L HRAV+PPLTRMRA HPGN+PN+DWA EYY Q
Sbjct: 1   MPFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNIPNRDWAVEYYAQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG+LIITEGTF SPQ+GGYDNAPGIWS+EQ+ +WTKIFK IH+N SF +VQLW LG
Sbjct: 61  RAQRPGTLIITEGTFPSPQSGGYDNAPGIWSEEQIKEWTKIFKAIHENKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             ++ DTL RDGLRYD+ SD  YM+ EQ+E+A KANNPQH +TK EIKQY+KEYV+AA N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMNAEQEEKAKKANNPQHSITKDEIKQYVKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAVVDAIGPEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYG F +M+GG    IVAQYAY++GEL+RRA  G++LA++HLVEPRVT+PFLTE
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG YN G+N F YSIW GPIIRAGN ALHP+V  E +KD RTLIGYGRF+I+NPDLV R
Sbjct: 301 GEGEYNGGSNKFAYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKYDRDTFY+MS EGY+DYPTYEEALKLGWDK
Sbjct: 361 LEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGWDK 399

>Kpol_534.36 s534 (89925..90272,90276..91127) [1200 bp, 399 aa] {ON}
           (89925..90272,90276..91127) [1200 nt, 400 aa]
          Length = 399

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/399 (71%), Positives = 337/399 (84%), Gaps = 1/399 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV+DFKP+AL DTN+ +PI++G+ +L+HRAV+PPLTRMRA HPGNVPNKDWA EYYNQ
Sbjct: 1   MPFVQDFKPIALKDTNMFKPIKIGNTELKHRAVLPPLTRMRAHHPGNVPNKDWAVEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+++ITEG FIS Q+GGYDNAPG+WS+EQ+A+W KIF ++H+N SF++ QL ALG
Sbjct: 61  RSKREGTMLITEGVFISAQSGGYDNAPGVWSEEQLAEWKKIFAKVHENKSFIWPQL-ALG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQSYADTL RDGLRYDA SD  YMS EQ+  A K+NNPQHGLTK EIKQYIKEYV+AA N
Sbjct: 120 RQSYADTLARDGLRYDAASDDVYMSAEQEALAKKSNNPQHGLTKDEIKQYIKEYVQAAKN 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I  GADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 180 VIGVGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAIVEAVGHEK 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYG FGTM+G   P ++AQYAY++GEL++RA EG+++AYIHL+EPRVTDPFLTE
Sbjct: 240 VGIRFSPYGKFGTMSGAAEPTLLAQYAYVIGELEKRAREGKRIAYIHLMEPRVTDPFLTE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTNDFVYSIW GPIIRAGN ALHP+   EM+KD+RTLI YGRF+IANPD+V R
Sbjct: 300 GEGVYLDGTNDFVYSIWKGPIIRAGNFALHPEDVEEMVKDDRTLIAYGRFFIANPDIVDR 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           ++ GLPLNKYDRDTFY M+D+GYLDYPTY+EA+K+GW K
Sbjct: 360 IEKGLPLNKYDRDTFYAMTDKGYLDYPTYDEAIKMGWGK 398

>KAFR0F03530 Chr6 (702060..703262) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/400 (71%), Positives = 332/400 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF P+AL DTNL +PI++G+++LQHRAVMPPLTRMRA HPG++PNKDW  EYY+Q
Sbjct: 1   MPFVKDFTPIALNDTNLFKPIKIGNIELQHRAVMPPLTRMRAHHPGHIPNKDWTAEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+LIITEG FIS QAGGYDNAPGIWS EQV +W KIF RIH N SFVYVQLW LG
Sbjct: 61  RSQRPGTLIITEGAFISEQAGGYDNAPGIWSQEQVEEWKKIFARIHKNKSFVYVQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    + RDGLRYD+ SD  YM EE++  A KA   QHG+TK EIKQYIKEYV+AA N
Sbjct: 121 RQAEPAAMARDGLRYDSASDEIYMDEEKESSAKKAGIKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI+AGADGVEIHSAN YLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 SIEAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALVEAIGHER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGT+GTM+G   PLIVAQY+YI+GEL++RA EG++L+++HLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTYGTMSGSAEPLIVAQYSYILGELEKRAKEGKRLSFVHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGA   GTNDF YSIW GPIIRAGNLALHP+    ++ DNRTLIGYGRF+IANPD+V R
Sbjct: 301 GEGADEDGTNDFAYSIWKGPIIRAGNLALHPESVKTLVADNRTLIGYGRFFIANPDVVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKYDR+TFY MSD+GYLDYPTY EA+KLGWDK+
Sbjct: 361 LEKGLPLNKYDRNTFYAMSDKGYLDYPTYAEAIKLGWDKE 400

>NDAI0A08130 Chr1 complement(1863451..1864656) [1206 bp, 401 aa]
           {ON} 
          Length = 401

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/400 (71%), Positives = 334/400 (83%), Gaps = 1/400 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF P+AL DTN+ +PI+VG+ +L++R VMPPLTRMRA HPGNVPNK+WA EYY Q
Sbjct: 1   MPFVKDFTPIALADTNVFKPIKVGNNELKNRVVMPPLTRMRATHPGNVPNKEWAVEYYKQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q  G+++ITEGTFIS QAGGYDNAPGIWS EQ+ +WTKI K +HD  SFV+VQLWALG
Sbjct: 61  RAQAEGTMLITEGTFISAQAGGYDNAPGIWSQEQMNEWTKIIKGVHDKKSFVWVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQS+ DTL RDGLRYD+ SD  YM EE K +A K+NNPQHGLTK EIK+YIK YV+AA N
Sbjct: 121 RQSFPDTLARDGLRYDSASDAVYMDEESKTKAEKSNNPQHGLTKDEIKEYIKNYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRT-DEYGGSVENRARFXXXXXXXXXXXXXXK 239
           SI  GADG+EIHSANGYLLNQFLDP +N RT DEYGGS+ENRARF               
Sbjct: 181 SIACGADGIEIHSANGYLLNQFLDPISNKRTDDEYGGSIENRARFALEVVDAIVDAIGED 240

Query: 240 KVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLT 299
           KVGIR SPYGTFGTM+GG +P ++AQYAY++GEL++RA  G++LA++HLVEPRVT+PF+T
Sbjct: 241 KVGIRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFMT 300

Query: 300 EGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVR 359
           EGEG YN GTNDF YSIW G IIRAGNLALHP+VA E++ ++RTL+GYGRF+IANPDLV 
Sbjct: 301 EGEGEYNDGTNDFAYSIWKGVIIRAGNLALHPEVARELVANDRTLLGYGRFFIANPDLVE 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           RL  GLPLNKY+RDTFY M+ EGYLDYPTYEEALKLGWDK
Sbjct: 361 RLAKGLPLNKYNRDTFYAMTQEGYLDYPTYEEALKLGWDK 400

>Skud_8.243 Chr8 (433873..435075) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/399 (72%), Positives = 331/399 (82%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKDFKP AL DTNL +PI++G+ +L HRAV+PPLTRMRA HPGNVPNKDWA EYY Q
Sbjct: 1   MSFVKDFKPQALNDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNVPNKDWAVEYYTQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG+LIITEGTFISPQ+GGYDNAPGIWS+EQ+ +WTKIFK IH+  SF +VQLW LG
Sbjct: 61  RAQRPGTLIITEGTFISPQSGGYDNAPGIWSEEQMKEWTKIFKAIHEKKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             ++ DTL RDGLRYD+ SD  YMS EQ+E+A KANNPQH LTK EIKQYIKEYV+AA N
Sbjct: 121 WAAFPDTLARDGLRYDSASDNVYMSAEQEEKAKKANNPQHSLTKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAIVEAIGQEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYG F +M+GG    IVAQYAY++GEL+RRAN G++LA++HLVEPRVT+PFL E
Sbjct: 241 VGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRANAGKRLAFVHLVEPRVTNPFLAE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGAY+ G+N FVYSIW G IIRAGN ALHP+V  E +KD RTLIGYGRF+I+NPDLV R
Sbjct: 301 GEGAYDGGSNQFVYSIWKGAIIRAGNYALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKYDR TFY MS +GY+DYPTYEEALKLGWDK
Sbjct: 361 LEKGLPLNKYDRTTFYSMSAKGYIDYPTYEEALKLGWDK 399

>TDEL0G00820 Chr7 complement(168417..169613) [1197 bp, 398 aa] {ON}
           Anc_5.58 YHR179W
          Length = 398

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 332/397 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV+DFKP+AL DT L +PI++G+ +L HR VMPPLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MSFVQDFKPIALADTKLFKPIKIGNNELAHRVVMPPLTRMRATHPGNVPNKDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+LIITEG F S Q+GGYDN PGIWS  Q+ QW KIF +IH+N SFV+VQLW LG
Sbjct: 61  RSKRPGTLIITEGAFPSAQSGGYDNVPGIWSPAQLEQWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQS+ADTL RDGLRYD+ SDG YM EEQ+ERA+K+NNPQHGLTK EIKQYI EYV+AA  
Sbjct: 121 RQSFADTLARDGLRYDSASDGVYMDEEQRERAVKSNNPQHGLTKAEIKQYISEYVDAAKK 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI+AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIEAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVTEAIGCDK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SPYGTFGTM+GG  PLIVAQ+AY++GEL++R   G++L+++HLVEPRVT+PF TE
Sbjct: 241 VGIRLSPYGTFGTMSGGSEPLIVAQFAYVLGELEKRGKAGKRLSFVHLVEPRVTNPFYTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G Y  GTNDF YS+W GPIIRAGNLALHP+V  +M++D+RTLIGYGRF+I+NPD+V R
Sbjct: 301 GQGEYTEGTNDFAYSVWKGPIIRAGNLALHPEVVKKMVEDDRTLIGYGRFFISNPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           ++ GLPLNKY+RDTFY M+  GYLDYPTY+EA+KLG+
Sbjct: 361 VEKGLPLNKYNRDTFYAMTANGYLDYPTYDEAVKLGY 397

>TPHA0A02230 Chr1 (461324..462526) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/400 (69%), Positives = 332/400 (83%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV DFKP+AL DTNL +PI+VG+ +L HRA++PPLTRMRA HPGNVPNK+WA +YY+Q
Sbjct: 1   MPFVADFKPIALKDTNLFKPIKVGNCELSHRAILPPLTRMRATHPGNVPNKEWAADYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+L+ITEG FISPQAGGYDNAPG+WS+EQ+A+W KIF R+H N SF++ QLWALG
Sbjct: 61  RSKREGTLLITEGAFISPQAGGYDNAPGVWSEEQLAEWKKIFARVHANKSFIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQS  DTL RDGL+Y + SD  Y  E +K  A+K+NNPQHGLTK EIKQYI +YV+AA N
Sbjct: 121 RQSEPDTLARDGLKYVSASDDLYRDETEKALAIKSNNPQHGLTKDEIKQYIADYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I+AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENR+RF              +K
Sbjct: 181 VIEAGADGVEIHSANGYLLNQFLDPISNNRTDEYGGSIENRSRFTLEVVDALIEAIGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFG+++GG  PLIVAQ+A+++GE+++RA EG++LA+IHLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFGSLSGGAEPLIVAQFAHVIGEIEKRAKEGKRLAFIHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTNDFVYSIW G I RAGN A HP+V  E++KD RTLIGYGR WI+NPDLV R
Sbjct: 301 GEGEYQDGTNDFVYSIWKGIIFRAGNYAYHPEVVKEVVKDERTLIGYGRLWISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLN Y+RDTFY M+ EGYLDYPTY+EA+K+GW KQ
Sbjct: 361 LEKGLPLNAYNRDTFYAMTSEGYLDYPTYDEAIKMGWGKQ 400

>SAKL0H22044g Chr8 (1926684..1927886) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/400 (68%), Positives = 334/400 (83%), Gaps = 1/400 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV+D+KP+ L +TNL +PI++G+  +QHR VMPPLTRMRA HPGN+PN+DWA EYY+Q
Sbjct: 1   MPFVQDYKPIPLKNTNLFKPIKIGNTTVQHRVVMPPLTRMRAHHPGNIPNRDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG++II+EG F SPQ+GGYDNAPGIWS+EQ+ +W KIF +IH+N SFV+VQLW LG
Sbjct: 61  RSRRPGTMIISEGAFPSPQSGGYDNAPGIWSEEQITEWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++AD L RDGLRYD+ SD  YM E+ K+RAL + N QHG+TK EIKQYIKEYV+AA N
Sbjct: 121 RQAFADVLARDGLRYDSASDEIYMDEDSKKRALTSGNKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGADK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFG+++GG +P ++AQYAY++GEL++RA+EG++LA++HLVEPRVT+PF TE
Sbjct: 241 VGIRFSPYGTFGSVSGGSDPTLLAQYAYVIGELEKRAHEGKRLAFVHLVEPRVTNPFFTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAI-EMLKDNRTLIGYGRFWIANPDLVR 359
           GEG Y  GTNDFVYSIW GPIIRAGN ALHP+ A  ++  D RTLIGYGRF+I+NPDLV 
Sbjct: 301 GEGVYKDGTNDFVYSIWKGPIIRAGNYALHPEAAARDVGVDERTLIGYGRFFISNPDLVD 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           R++ GLPLNKY+RD FY M+D+GY DYPTY+EA+KLGW K
Sbjct: 361 RVEKGLPLNKYNRDLFYAMTDKGYTDYPTYDEAIKLGWGK 400

>CAGL0I02024g Chr9 complement(172231..173433) [1203 bp, 400 aa] {ON}
           highly similar to uniprot|Q03558 Saccharomyces
           cerevisiae YHR179w OYE2 NADPH dehydrogenase or
           uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/400 (67%), Positives = 328/400 (82%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF KDF+PVA  DTN+ +P++VG+  + HRA +PPLTRMRA HPG++PN++WA EYY Q
Sbjct: 1   MPFSKDFEPVAFKDTNMFKPMKVGNTTILHRAALPPLTRMRAHHPGHIPNREWAVEYYKQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++++TEG F S Q+GGYDNAPGIWS+EQ+ +W KIF  +HDN SF +VQLW LG
Sbjct: 61  RSQRPGTMLVTEGVFPSAQSGGYDNAPGIWSEEQMVEWRKIFNAVHDNKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ + D+L RDGLRYD+ SDG YMS EQ+E A K+NNPQHG+TK EIKQYIK+YV+ A N
Sbjct: 121 RQGFPDSLARDGLRYDSASDGIYMSAEQEELAKKSNNPQHGITKDEIKQYIKDYVQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADG+EIHSAN YLLNQF+DP++N RTDEYGGS+ENRARF              ++
Sbjct: 181 AIAAGADGIEIHSANSYLLNQFIDPKSNKRTDEYGGSIENRARFTLEVVDAIVDAIGPER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
             IR SPYGT+G M+GG  PLIVAQYAYI+GEL+RRA EG++LAY+HLVEPRV DPF  E
Sbjct: 241 TAIRLSPYGTYGDMSGGAEPLIVAQYAYIIGELERRAKEGKRLAYLHLVEPRVLDPFAPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GE  YN GT DF YSIW GPI+RAGN A+HP+VA+E+LKD+RT++GYGR++IANPDLV R
Sbjct: 301 GEDVYNEGTTDFAYSIWKGPIMRAGNYAIHPEVAMEVLKDDRTIVGYGRYFIANPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKYDR TFY MS EGY+DYPTYEEA+K+GWDKQ
Sbjct: 361 LEKGLPLNKYDRSTFYAMSAEGYIDYPTYEEAIKMGWDKQ 400

>NDAI0C03460 Chr3 (792929..794128) [1200 bp, 399 aa] {ON} Anc_5.58
          Length = 399

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/400 (69%), Positives = 329/400 (82%), Gaps = 1/400 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVK+F PVALGDTNL +PI+VG+ +LQHR VMPPLTRMRA HPGN+PN DWA EYY+Q
Sbjct: 1   MPFVKNFPPVALGDTNLFKPIKVGNTELQHRVVMPPLTRMRAHHPGNIPN-DWAVEYYSQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG++IITEG F SPQ+G YDNAPGIWS+EQ+ QW KIF +IH+N SFV+VQLW LG
Sbjct: 60  RTQRPGTMIITEGAFPSPQSGSYDNAPGIWSEEQMKQWKKIFDKIHENKSFVWVQLWVLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ  AD L RDGLR+D PSDG YM EE + RA K+NNP HG+TK EIKQYIKEYV+AA N
Sbjct: 120 RQGLADVLARDGLRFDGPSDGVYMDEETEARAKKSNNPLHGITKDEIKQYIKEYVQAAKN 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI +GADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 180 SIASGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVAAIGEDK 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+RFSPYGTFG M+ G +P ++AQYAY++GEL++RA  G+++AYIHLVEP VT+ F+TE
Sbjct: 240 VGVRFSPYGTFGKMSSGYDPTLLAQYAYVIGELEKRAKAGKRIAYIHLVEPLVTNLFMTE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTNDFVYSIW GPIIRAGNLAL+P +  EM+KD RTLIGYGRF+IANPD+V R
Sbjct: 300 GEGEYKDGTNDFVYSIWKGPIIRAGNLALNPQLVREMVKDERTLIGYGRFFIANPDIVDR 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           ++ G   N+YD+DTFY MS++GY DYPTY EA+KLGWDK+
Sbjct: 360 VEKGQQFNQYDKDTFYAMSEKGYNDYPTYPEAIKLGWDKK 399

>SAKL0C00396g Chr3 complement(35526..36728) [1203 bp, 400 aa] {ON}
           highly similar to uniprot|Q03558 Saccharomyces
           cerevisiae YHR179W OYE2 Widely conserved NADPH
           oxidoreductase containing flavin mononucleotide (FMN)
           homologous to Oye3p with slight differences in ligand
           binding and catalytic properties may be involved in
           sterol metabolism
          Length = 400

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/398 (68%), Positives = 329/398 (82%), Gaps = 1/398 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF +DFKP  L +TNL +PI++G+  +QHR VMPPLTRMRA HPGN+PN+DWA EYY+Q
Sbjct: 1   MPFAQDFKPQPLKNTNLFKPIKIGNTTVQHRVVMPPLTRMRAHHPGNIPNRDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG++IITEGTF SPQ+GGYDNAPGIWS+EQ+ +W KIF +IH+N SFV+VQLW LG
Sbjct: 61  RSRRPGTMIITEGTFPSPQSGGYDNAPGIWSEEQITEWKKIFAKIHENKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++AD L RDGLRYD+ SD  YM E+ K+RAL + N QHG+TK EIKQYIKEYV+AA N
Sbjct: 121 RQAFADVLARDGLRYDSASDEIYMDEDSKKRALTSGNKQHGITKDEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFTLEVVDAVVDAIGADK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFG+++GG +P ++AQYAY++GEL++RA  G++LA++HLVEPRVT+PF TE
Sbjct: 241 VGIRFSPYGTFGSVSGGSDPTLLAQYAYVIGELEKRARAGKRLAFVHLVEPRVTNPFFTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLK-DNRTLIGYGRFWIANPDLVR 359
           GEG Y  GTNDFVYSIW GPIIRAGN ALHP+ A + +  D RTLIGYGRF+I+NPDLV 
Sbjct: 301 GEGVYKDGTNDFVYSIWKGPIIRAGNYALHPEAAAKDVGVDERTLIGYGRFFISNPDLVD 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           R++ GLPLNKYDRD FY M+D+GY DYPTYE+AL LGW
Sbjct: 361 RVEKGLPLNKYDRDLFYAMTDKGYTDYPTYEQALALGW 398

>NDAI0B00920 Chr2 (212588..213868) [1281 bp, 426 aa] {ON} Anc_5.58
          Length = 426

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 328/397 (82%), Gaps = 3/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV +F+PVAL DTNL +P ++G+ +L+HRAVMPPLTRMRA HPGN+PN+ WA EYY Q
Sbjct: 1   MPFVTNFQPVALKDTNLFKPTKIGNTELKHRAVMPPLTRMRAEHPGNIPNRKWAYEYYKQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+++ITEGTFISPQAGGYDNAPGIWS EQ+ QW  IFK +HDN SF++VQLW+LG
Sbjct: 61  RSQRPGTMLITEGTFISPQAGGYDNAPGIWSQEQMDQWKHIFKGVHDNKSFIWVQLWSLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGN---YMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEA 177
            Q++ DTL RDGLRYD+ +DG+   YM EE + +A KANNPQHGLTK EIKQYI+EYV+A
Sbjct: 121 WQAFPDTLARDGLRYDSATDGSANIYMDEESELKAKKANNPQHGLTKNEIKQYIEEYVQA 180

Query: 178 AVNSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXX 237
           A NSI  GADG+EIHSANGYLLNQFLDP +N RTDEYG S+ENRARF             
Sbjct: 181 AKNSIACGADGIEIHSANGYLLNQFLDPMSNQRTDEYGNSIENRARFVLEVTDAVVKAVG 240

Query: 238 XKKVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPF 297
            ++VGIRFSPYG FG M+GG +P ++A+Y YI+GEL++RA  G++LAY+HLVEPRVT+PF
Sbjct: 241 PERVGIRFSPYGKFGNMSGGSDPDLLAEYCYILGELEKRAKNGKRLAYVHLVEPRVTNPF 300

Query: 298 LTEGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDL 357
           L EGEG Y  GTNDF YSIW GPIIR+GNLALHP++A ++L+D+RTL+GYGRF+IANPDL
Sbjct: 301 LKEGEGEYTDGTNDFAYSIWKGPIIRSGNLALHPEIAKDLLQDDRTLLGYGRFFIANPDL 360

Query: 358 VRRLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           V RL+ G PLNKYDR TFY M+D+GYLDYPTY+E  +
Sbjct: 361 VDRLEYGEPLNKYDRSTFYAMTDKGYLDYPTYDETFE 397

>NCAS0E03890 Chr5 complement(763948..765129) [1182 bp, 393 aa] {ON}
           Anc_5.58
          Length = 393

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/391 (70%), Positives = 323/391 (82%), Gaps = 2/391 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MP+ KDF+PVAL +TNL +PI+VGD +++ R VMPPLTRMRA HPGNVPNK WA  YY+Q
Sbjct: 1   MPYAKDFEPVALKNTNLFKPIKVGDTEMKQRIVMPPLTRMRAEHPGNVPNKKWAYTYYHQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++IITEGTFISPQAGGYDNAPGIWS EQ+ QWTKIF+ IHDN SFV+VQLWALG
Sbjct: 61  RSQRPGTMIITEGTFISPQAGGYDNAPGIWSKEQIEQWTKIFQGIHDNKSFVWVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R S+ DTL R+GLRYDAPSDG YM +E +E+A+K+ N QHGLT+ EIKQYIKEYV+AA N
Sbjct: 121 RASFPDTLARNGLRYDAPSDGVYMDKESEEKAIKSGNLQHGLTQAEIKQYIKEYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGA+GVEIH+ANGYLLNQFLDP AN RTDEYGGS+E RARF               K
Sbjct: 181 SIAAGANGVEIHAANGYLLNQFLDPIANKRTDEYGGSIEKRARFVLEVVDALVAAVGASK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQ-LAYIHLVEPRVTDPFLT 299
           VGIRFSPYG F TM+GG +P ++AQYAY++GEL++RA E +Q LAY+HLVEPRVT+PFLT
Sbjct: 241 VGIRFSPYGLFNTMSGGADPTLLAQYAYVLGELEKRAIEKKQRLAYVHLVEPRVTNPFLT 300

Query: 300 EGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDN-RTLIGYGRFWIANPDLV 358
           EGEG Y  GTNDF YSIW GPIIRAGNLALHPDVA +++  N RTL+ YGR++IANPDLV
Sbjct: 301 EGEGEYGDGTNDFAYSIWKGPIIRAGNLALHPDVASQLVNANDRTLLAYGRYFIANPDLV 360

Query: 359 RRLKDGLPLNKYDRDTFYRMSDEGYLDYPTY 389
            RL+ GLPLNKYDR  FY M+ EGY+DYP Y
Sbjct: 361 DRLEQGLPLNKYDRSQFYSMTSEGYIDYPEY 391

>YPL171C Chr16 complement(226169..227371) [1203 bp, 400 aa] {ON}
           OYE3Conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN), homologous to Oye2p with different
           ligand binding and catalytic properties; has potential
           roles in oxidative stress response and programmed cell
           death
          Length = 400

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/399 (68%), Positives = 322/399 (80%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVK F+P++L DTNL +PI++G+ QL HRAVMPPLTRMRA HPGN+PNK+WA  YY Q
Sbjct: 1   MPFVKGFEPISLRDTNLFEPIKIGNTQLAHRAVMPPLTRMRATHPGNIPNKEWAAVYYGQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG++IITEGTFISPQAGGYDNAPGIWSDEQVA+W  IF  IHD  SF +VQLW+LG
Sbjct: 61  RAQRPGTMIITEGTFISPQAGGYDNAPGIWSDEQVAEWKNIFLAIHDCQSFAWVQLWSLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             S+ D L RDGLRYD  SD  YM+   +E+A  ANN +H LTK +IKQYIK+Y+ AA N
Sbjct: 121 WASFPDVLARDGLRYDCASDRVYMNATLQEKAKDANNLEHSLTKDDIKQYIKDYIHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGG++ENRARF              ++
Sbjct: 181 SIAAGADGVEIHSANGYLLNQFLDPHSNKRTDEYGGTIENRARFTLEVVDALIETIGPER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYGTF +M+GG  P I+AQY+Y++GEL++RA  G++LA++HLVEPRVTDP L E
Sbjct: 241 VGLRLSPYGTFNSMSGGAEPGIIAQYSYVLGELEKRAKAGKRLAFVHLVEPRVTDPSLVE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y+ GTNDF YSIW GPIIRAGN ALHP+V  E +KD RTLIGYGRF+I+NPDLV R
Sbjct: 301 GEGEYSEGTNDFAYSIWKGPIIRAGNYALHPEVVREQVKDPRTLIGYGRFFISNPDLVYR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L++GLPLNKYDR TFY MS EGY DYPTYEEA+ LGW+K
Sbjct: 361 LEEGLPLNKYDRSTFYTMSAEGYTDYPTYEEAVDLGWNK 399

>KLTH0E07920g Chr5 (728285..729487) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/397 (68%), Positives = 326/397 (82%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKD KP+AL DT L +PI++GD  ++HRAVM PLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHPGNVPNKDWALEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG++IITEGTF SPQ GGYDNAPGIWS EQ+ QW KIF +IH+N SF +VQLW LG
Sbjct: 61  RSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAKIHENKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ DTL RDGLRYD+ SD  YM +  +++A++ +N QHG+TK EIKQY+K+YV+AA N
Sbjct: 121 RQAFPDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGITKEEIKQYVKDYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              KK
Sbjct: 181 SIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAIGEKK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTM+G  +P ++AQYAY+VGEL++RA  G++LAYIHLVEPRVT+PF TE
Sbjct: 241 VGIRFSPYGTFGTMSGASDPGLIAQYAYVVGELEKRAKAGKRLAYIHLVEPRVTNPFFTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAI-EMLKDNRTLIGYGRFWIANPDLVR 359
           G+G Y  G+NDFVYSIW GP+IRAGN AL P  A  ++ K++RTLIGYGR +I+NPDLV+
Sbjct: 301 GQGWYKEGSNDFVYSIWKGPVIRAGNYALDPRAARDDVQKNDRTLIGYGRLFISNPDLVQ 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLG 396
           RLK+GLPLNKYDRDTFY M+D+GY+DYPTY EA K+ 
Sbjct: 361 RLKEGLPLNKYDRDTFYAMTDKGYVDYPTYAEATKVA 397

>KLTH0E07898g Chr5 (725950..727152) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/397 (67%), Positives = 323/397 (81%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKD KP+AL DT L +PI++GD  ++HRAVM PLTRMRA HPGNVPNKDWA EYY+Q
Sbjct: 1   MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHPGNVPNKDWALEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG++IITEGTF SPQ GGYDNAPGIWS EQ+ QW KIF +IH+N SF +VQLW LG
Sbjct: 61  RSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAKIHENKSFAWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+  DTL RDGLRYD+ SD  YM +  +++A++ +N QHG+TK EIKQY+K+YV+AA N
Sbjct: 121 RQAPCDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGITKEEIKQYVKDYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              KK
Sbjct: 181 SIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAIGEKK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFG M+G  +P ++AQYAY+VGEL++RA  G++LAYIHLVEPRVT+  LTE
Sbjct: 241 VGIRFSPYGTFGNMSGASDPGLIAQYAYVVGELEKRAKAGKRLAYIHLVEPRVTNLSLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAI-EMLKDNRTLIGYGRFWIANPDLVR 359
           G+G Y  G+NDFVYSIW GP+IRAGN AL P  A  ++ K++RTLIGYGR +I+NPDLV+
Sbjct: 301 GQGWYKEGSNDFVYSIWKGPVIRAGNYALDPSAARDDVQKNDRTLIGYGRLFISNPDLVQ 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLG 396
           RLK+GLPLNKYDRDTFY M+D+GY+DYPTY EA K+ 
Sbjct: 361 RLKEGLPLNKYDRDTFYAMTDKGYIDYPTYAEATKVA 397

>Kwal_47.16561 s47 (4316..5515) [1200 bp, 399 aa] {ON} YHR179W
           (OYE2) - 1:1 [contig 376] FULL
          Length = 399

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/395 (67%), Positives = 320/395 (81%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVKDFKP++L DT L +PI++G+  +QHRAVM PLTRMRA  PGNVPNK+WA EYYNQ
Sbjct: 1   MTFVKDFKPISLKDTALFKPIQIGETIVQHRAVMCPLTRMRAHSPGNVPNKEWALEYYNQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++IITEGTF SPQ GGYDNAPGIWS EQ+A+W KIF +IHDN SFV+VQLW LG
Sbjct: 61  RSQAPGTMIITEGTFPSPQCGGYDNAPGIWSQEQLAEWKKIFAKIHDNKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ DTL RDGLRYD+ SD  YM E  +++A++ +N QHGLTK EIKQYIK+YV+A+ N
Sbjct: 121 RQAFPDTLKRDGLRYDSASDEVYMDESSEKKAIECDNRQHGLTKDEIKQYIKDYVQASKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              KK
Sbjct: 181 AIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDTIGEKK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTM+G   P ++AQYAY++GEL++RA  G++LA++ LVEPRVT+PF  E
Sbjct: 241 VGIRFSPYGTFGTMSGAAEPTLIAQYAYVIGELEKRAKAGKRLAFVDLVEPRVTNPFFKE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  G+NDFVYS+W GP+IRAGN AL P  A   ++ +RTLIGYGR +I+NPDLV R
Sbjct: 301 GEGWYKEGSNDFVYSVWKGPVIRAGNYALDPTAAKSDVEKDRTLIGYGRLFISNPDLVHR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKL 395
           L +GLPLNKYDRDTFY M+D+GY DYP+Y +A K+
Sbjct: 361 LYEGLPLNKYDRDTFYAMTDKGYTDYPSYADASKI 395

>TBLA0A10550 Chr1 (2607210..2608412) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/400 (68%), Positives = 322/400 (80%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF PVAL DTNL +PI+VGD +L+HRAV+PPLTRMRA HPG+VPNKDWA EYY+Q
Sbjct: 1   MPFVKDFTPVALKDTNLFKPIKVGDNELKHRAVLPPLTRMRAHHPGHVPNKDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PGSL++TEG FIS QAGGYDNAPG +SDEQ+A+W KI   +H N SF++ QLWALG
Sbjct: 61  RSKRPGSLLVTEGVFISEQAGGYDNAPGCYSDEQIAEWKKICDVVHKNHSFIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             + A ++ RDGLRYD  +D  Y +++    A + N   HGLT  +IKQYIK+YV AA  
Sbjct: 121 WAADAKSMSRDGLRYDGATDNVYSNDKYGILAKENNIKIHGLTTDDIKQYIKDYVNAAKR 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I AGADGVEIHSANGYLLNQFLD  +N RTD+YGGS+ENRARF              +K
Sbjct: 181 VIAAGADGVEIHSANGYLLNQFLDENSNKRTDQYGGSIENRARFPLEVVDALIEAVGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTF  MAGGKN LIVAQ+AYI+GEL++RA  G +LAYIHLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFNDMAGGKNSLIVAQFAYIIGELEKRAKAGNRLAYIHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G Y  GTNDFVYSIW G IIRAGNLALHP++A ++LKD+RTL+GYGR WIANPDLV R
Sbjct: 301 GQGEYLDGTNDFVYSIWKGIIIRAGNLALHPEIAKDLLKDDRTLLGYGRLWIANPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKYDRD+FY M+ EGYLDYPTY EA+KLGWDK+
Sbjct: 361 LEKGLPLNKYDRDSFYSMTSEGYLDYPTYAEAIKLGWDKK 400

>TBLA0J00530 Chr10 complement(103254..104456) [1203 bp, 400 aa] {ON}
           
          Length = 400

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/398 (63%), Positives = 319/398 (80%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV+DF P+ L DTNL +PI VGD  L++R VMPPLTRMRA +PGN+PN+ WA +YY+Q
Sbjct: 1   MAFVEDFTPIPLEDTNLFKPIRVGDCMLRNRIVMPPLTRMRAHYPGNIPNRFWARKYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG++IITEG FISPQAGGYDNAPG+WS EQ+ +W  IFK++H+N S+++ QLWALG
Sbjct: 61  RSKSPGTMIITEGAFISPQAGGYDNAPGVWSSEQMTEWKSIFKKVHENGSYIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R +Y + L RDGLR+D+ SDG YM  E + +A    N QHGLTK EIKQYIK+Y+ AA N
Sbjct: 121 RAAYPEVLKRDGLRFDSASDGIYMDTEMESKAKNCKNLQHGLTKVEIKQYIKDYIHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            + +GADG+E+H+ANGYL+NQF+DP +N R DEYGGS+ENRARF              + 
Sbjct: 181 CMSSGADGIELHAANGYLINQFIDPISNKRKDEYGGSIENRARFILEIVDDLVQEVGSEH 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTFGTM+GG+NP I+AQY YI+G+L+ RA +G++LAYIHLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFGTMSGGENPTIMAQYCYIIGKLEERAQKGKRLAYIHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+GAY+ G+NDF+YSIW G IIRAGN ALHP++  E++KD RTLI YGR++I+NPDLV R
Sbjct: 301 GQGAYSEGSNDFIYSIWKGNIIRAGNFALHPEIVEELVKDERTLIAYGRYFISNPDLVTR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWD 398
           +  GLPLN+Y+RD FY MS+EGY DYPTY EAL LGW 
Sbjct: 361 VAKGLPLNRYERDKFYVMSEEGYTDYPTYTEALSLGWS 398

>TBLA0G03670 Chr7 complement(974043..975245) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/399 (66%), Positives = 322/399 (80%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF+KDFKP+AL DTNL +PI+VG+ +L+HRA++PPLTRMRA  P +VP+K+W E+YY+Q
Sbjct: 1   MPFIKDFKPIALSDTNLFKPIKVGNNELKHRAILPPLTRMRAQTPDHVPHKEWTEKYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+L+ITEG FIS QAGGYDNAPG+WS+EQ+ +W KIF  IH N+SFV+ QLWALG
Sbjct: 61  RSKREGTLLITEGVFISRQAGGYDNAPGVWSEEQMTEWKKIFAVIHKNNSFVWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             + A ++ RDGLRYD  +DG Y +++  + A + +   HGLTK +IKQYIK+YV AA N
Sbjct: 121 WAADAKSMARDGLRYDGATDGVYSNDQYGKIAKENDIKIHGLTKDDIKQYIKDYVTAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I AGADGVEIHSANGYLLNQFLD  +N RTDEYGGS+ENRARF              +K
Sbjct: 181 CIAAGADGVEIHSANGYLLNQFLDINSNKRTDEYGGSIENRARFPLEVVDALIEAIGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTF  MAGG NPL VAQ+AYI GEL++RA  G +LA+IHLVEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFNDMAGGSNPLGVAQFAYITGELEKRAKAGNRLAFIHLVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G Y  GTNDFVYSIW G IIRAGNLALHP+VA E +KD+RTL+GYGR WI+NPDLV R
Sbjct: 301 GQGEYTDGTNDFVYSIWKGVIIRAGNLALHPEVAREFMKDDRTLLGYGRLWISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKY+RD FY M+ EGYLDYPTY+EA+KLGWDK
Sbjct: 361 LEKGLPLNKYNRDLFYAMTSEGYLDYPTYDEAIKLGWDK 399

>KAFR0B07070 Chr2 complement(1474959..1476161) [1203 bp, 400 aa]
           {ON} 
          Length = 400

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 311/396 (78%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKPVAL DTNL +PI++G +++ HR VM PLTRMRA HPGNVPNKDW+ EYY+Q
Sbjct: 1   MPFVKDFKPVALRDTNLFKPIKIGSIEVSHRVVMAPLTRMRAHHPGNVPNKDWSLEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+LIITE TFISPQAGGYDNAPGIW+ EQ+ QW KIF +IHDN +FV+VQLW LG
Sbjct: 61  RSRRPGTLIITEATFISPQAGGYDNAPGIWAPEQIEQWKKIFTKIHDNKAFVFVQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
            Q+    + RDGLRYD  SDG YM E ++  A KA    HG+TK EIKQYI++YV+AA N
Sbjct: 121 WQADPAVMARDGLRYDTASDGVYMDETKRAEAEKAGIKPHGITKEEIKQYIQDYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVEIH+A GYLLNQFLD  +N RTDEYGGSVENRARF              +K
Sbjct: 181 AIDAGADGVEIHNAGGYLLNQFLDSVSNKRTDEYGGSVENRARFALQVVDALIEAVGPEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           V IRF+P+GT+G M G  +P  ++ +AYI+ EL++RA  G++LAY+HLVEPRV +PFL E
Sbjct: 241 VSIRFTPFGTYGGMGGAADPFNLSNHAYILAELEKRAMNGKRLAYVHLVEPRVLNPFLNE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGA N  +N+F YSIW GPIIRAGNLALHP+VA +M+ D RTLI YGRF+IANPDLV R
Sbjct: 301 GEGADNDSSNEFAYSIWKGPIIRAGNLALHPEVAEKMISDARTLIAYGRFFIANPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLG 396
           L+ GLP NKYDR TFY M  EGYLDYPT+ EALKLG
Sbjct: 361 LEKGLPFNKYDRSTFYSMKSEGYLDYPTHSEALKLG 396

>TBLA0I03570 Chr9 complement(855914..857116) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/400 (65%), Positives = 316/400 (79%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF+K+F PVAL DTNL +PI+VG+ +L+HRA++PPLTRMRA  P +VP+K+W E+YY+Q
Sbjct: 1   MPFIKEFNPVALNDTNLFKPIKVGNNELKHRAILPPLTRMRAQTPDHVPHKEWTEKYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+L+ITEG FIS QAGGYDNAPG+WS+EQ+ +W KIF  IH N SF++ QLWALG
Sbjct: 61  RSKREGTLLITEGVFISRQAGGYDNAPGVWSEEQMTEWKKIFAAIHKNKSFIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             + A  + RDGLRYD  +D  Y +++  + A + +   HGLTK +IKQYIK+YV AA N
Sbjct: 121 WAADAKCMARDGLRYDGATDNVYSNDQYGKIAKENDIKIHGLTKDDIKQYIKDYVAAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I AGADGVEIHSANGY+LNQFLD  +N RTDEYGGS+ENRARF              +K
Sbjct: 181 VIAAGADGVEIHSANGYMLNQFLDTNSNKRTDEYGGSIENRARFPLEVVDALVEAIGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYGTF  M GG NPL VAQYAYI GEL++RA  G +LAYIH+VEPRVT+PFLTE
Sbjct: 241 VGIRFSPYGTFNDMIGGANPLTVAQYAYITGELEKRAQAGNRLAYIHIVEPRVTNPFLTE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G Y  GTNDF YSIW G IIR+GNLALHP+VA E +KD+RTL+GYGR WIANPDLV R
Sbjct: 301 GQGEYVDGTNDFFYSIWKGIIIRSGNLALHPEVAREFMKDDRTLLGYGRLWIANPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKY+RD FY M+ EGYLDYPTY+EA+ +GWDKQ
Sbjct: 361 LEKGLPLNKYNRDLFYAMTSEGYLDYPTYDEAINMGWDKQ 400

>KLLA0A09075g Chr1 complement(792171..793367) [1197 bp, 398 aa] {ON}
           uniprot|P40952 Kluyveromyces lactis KLLA0A09075g KYE1
           NADPH dehydrogenase 1
          Length = 398

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/399 (64%), Positives = 318/399 (79%), Gaps = 1/399 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F+ +F+P  L DT++ +PI++G+ +L+HR VMP LTRMRA HPGNVPN DWA EYY Q
Sbjct: 1   MSFM-NFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHPGNVPNPDWAVEYYRQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQYPG++IITEG F S Q+GGYDNAPG+WS+EQ+AQW KIFK IHDN SFV+VQLW LG
Sbjct: 60  RSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAIHDNKSFVWVQLWVLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++AD L RDGLRYD+ SD  YM E++KERA+++NNPQHG+TK EIKQYI++YV+AA  
Sbjct: 120 RQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITKDEIKQYIRDYVDAAKK 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 180 CIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAVGAER 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
             IRFSPYG FGTM+GG +P++VAQ+AY++ EL++RA  G++LAY+ LVEPRVT PF  E
Sbjct: 240 TSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKRLAYVDLVEPRVTSPFQPE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
            EG Y  GTN+FVYS+W G ++R GN AL PD AI   K+  TLIGYGR +IANPDLV R
Sbjct: 300 FEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVER 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLN+YDR +FY+MS EGY+DYPTYEEA+  G+ K
Sbjct: 360 LEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGYKK 398

>KAFR0F03540 Chr6 (703965..705167) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/400 (65%), Positives = 317/400 (79%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF KDFKPVAL DT+L +P++VG+MQLQHRA +PPLTR RA HPGNVPN D   EYY+Q
Sbjct: 1   MPFKKDFKPVALKDTDLFKPLKVGNMQLQHRAALPPLTRYRALHPGNVPNTDLVPEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PGSL+ITE  FISPQAGGYD APG+WSDEQVA W  +FKRIHDN+S+V+VQLW LG
Sbjct: 61  RSKRPGSLLITEAAFISPQAGGYDFAPGMWSDEQVAAWKHVFKRIHDNNSYVFVQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    + RDGLRYD+ +D  YMSEE K++A KA   QHG+TK EIKQYIK+YV AA N
Sbjct: 121 RQTSPANMVRDGLRYDSATDDLYMSEEAKQQAEKAGIKQHGITKDEIKQYIKDYVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVEIHSANGYLLNQF+DP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 AIAAGADGVEIHSANGYLLNQFIDPISNNRTDEYGGSIENRARFSLEVVDALIEAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           V IR SPYG FG M+G  NP+I+AQY+YI+GEL++RA  G+++AY+H +EPRVTD  L E
Sbjct: 241 VAIRLSPYGRFGGMSGSTNPIIIAQYSYILGELEKRAKAGRRIAYVHTIEPRVTDSSLPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
            EG  N G+N F YSIW GP++RAGN ALHPD+A E +  ++T+I YGR+WIANPD+V R
Sbjct: 301 EEGVDNEGSNAFFYSIWKGPLVRAGNFALHPDLAKEAVSSDKTIIAYGRYWIANPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLN YDR+TFY    EGYLDYPTY+EA+KLGWDKQ
Sbjct: 361 LEKGLPLNAYDRNTFYTTKSEGYLDYPTYDEAIKLGWDKQ 400

>TBLA0C01370 Chr3 (311585..312856) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/400 (62%), Positives = 320/400 (80%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF KDFKPVALGDTNL +PI VG+ +L++R V+ PLTRMRA HPGNVPNK WA EYY+Q
Sbjct: 23  MPFNKDFKPVALGDTNLFKPITVGNCKLKNRVVLAPLTRMRAEHPGNVPNKKWAVEYYDQ 82

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+L+ITE  FIS QAGGYDNAPGIWS+EQ+A+W KIF +IH+N SFV+ QLW LG
Sbjct: 83  RSKTPGTLLITEAVFISAQAGGYDNAPGIWSEEQMAEWKKIFAKIHENGSFVWPQLWNLG 142

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ + + RDGLRYD+ SD  +M +E KE+A  A   QHG+T+ EIKQYIK+YV+AA N
Sbjct: 143 RQAFPECMKRDGLRYDSASDNIWMDDEVKEKAKNAGIEQHGITEDEIKQYIKDYVQAAKN 202

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I+ GADG++IHSAN YLLNQFLDP +N RTD+YGGS+ENRARF              ++
Sbjct: 203 CIECGADGIQIHSANSYLLNQFLDPVSNKRTDKYGGSIENRARFTLEVVDAIVDAIGAER 262

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
             IR SPY TFG M+GG +P ++AQYAY++GEL++RA  G++LA++ + EPRV++PF+ E
Sbjct: 263 TAIRLSPYNTFGGMSGGYDPTLLAQYAYVIGELEKRAINGKRLAFLDIFEPRVSNPFVDE 322

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G GAY+ GT +FV+SIW G ++R GNLALHP+VA E LK+  TL+GYGR++I+NPDLV R
Sbjct: 323 GVGAYDQGTTEFVFSIWKGIVVRTGNLALHPEVAKEYLKNKNTLLGYGRYYISNPDLVER 382

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPL+ YDR +FY MSD+GY DYPTYEEA+KLGWDK+
Sbjct: 383 LRKGLPLSSYDRPSFYAMSDKGYTDYPTYEEAVKLGWDKE 422

>ZYRO0C11902g Chr3 (931466..932668) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/395 (65%), Positives = 314/395 (79%), Gaps = 2/395 (0%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
           F    KP ALGDTNL +PI+VGD++L HR VMPPLTRMRA    NVP+K WA +YY QR+
Sbjct: 6   FDSRVKPQALGDTNLFKPIKVGDVELAHRVVMPPLTRMRATK--NVPSKQWAPDYYAQRA 63

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQ 122
           Q PG+LIITE +F +P+ GGYD+APG+WS EQ+  W +IF RIH+  SFVYVQLW LGRQ
Sbjct: 64  QRPGTLIITEASFPAPRFGGYDDAPGLWSKEQLDIWKEIFNRIHEKKSFVYVQLWNLGRQ 123

Query: 123 SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSI 182
           +    L RDGL Y + SDG YMS+EQ+E A+KANNPQHGLTK EIK+Y+KE+V+AA NS+
Sbjct: 124 ADPAPLARDGLPYVSASDGVYMSKEQEENAIKANNPQHGLTKDEIKEYVKEFVQAAKNSL 183

Query: 183 KAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVG 242
           +AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF               KVG
Sbjct: 184 EAGADGVEIHSANGYLLNQFLDPMSNKRTDEYGGSIENRARFTLEVVDAIVEAVGASKVG 243

Query: 243 IRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGE 302
           IR SPYG FGTM+GG+ P IVAQYAY+VGEL+RRA EG++L++IHLVEPRVT+PF  EGE
Sbjct: 244 IRLSPYGVFGTMSGGQEPEIVAQYAYVVGELERRAKEGKRLSFIHLVEPRVTNPFNPEGE 303

Query: 303 GAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLK 362
           G Y  G+NDFVYSIW G ++RAG+LALHP++  +M+KDNRTLI YGRF+I+NPD+V R++
Sbjct: 304 GVYTEGSNDFVYSIWKGAVVRAGDLALHPEIVKDMVKDNRTLIAYGRFFISNPDIVDRVE 363

Query: 363 DGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
            GLPL  YDR+TFY  + EGYLDYP Y+E +K G+
Sbjct: 364 KGLPLTAYDRNTFYAPTSEGYLDYPNYDECVKQGY 398

>TDEL0E00270 Chr5 (60549..61757) [1209 bp, 402 aa] {ON} 
          Length = 402

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/390 (66%), Positives = 310/390 (79%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
            V +F+  AL +TNL + ++VG  +LQHRAV+ PLTRMRA +PGNVPN   A EYY QRS
Sbjct: 9   LVSNFEADALNETNLFKSLKVGKSELQHRAVLAPLTRMRALYPGNVPNGKLAGEYYEQRS 68

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQ 122
           + PG+LIITEGTF S Q+GGYDNAPGIWS EQ+ +W  IF +IH N SFVY+QLW LGRQ
Sbjct: 69  RRPGTLIITEGTFTSAQSGGYDNAPGIWSQEQITEWKGIFSKIHKNKSFVYLQLWVLGRQ 128

Query: 123 SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSI 182
           +YAD+L RDGLRYD+ SDG YM EE KE+ALK+NNPQHGLT  EIKQY+++YV+AA N+I
Sbjct: 129 AYADSLARDGLRYDSASDGVYMDEELKEKALKSNNPQHGLTNDEIKQYVEDYVQAARNAI 188

Query: 183 KAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVG 242
           +AGADGVEIHSANGYLLNQFLDP +N R DEYGGS+ENRARF               KV 
Sbjct: 189 EAGADGVEIHSANGYLLNQFLDPISNKRADEYGGSIENRARFTLEVVDALIEAVGHDKVA 248

Query: 243 IRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGE 302
           IRFSPYGTFG M+GG++  +VAQYAY++GEL+RRAN+G++LAYIHLVEPRVT P  TEG+
Sbjct: 249 IRFSPYGTFGGMSGGRDLGLVAQYAYVIGELERRANQGRRLAYIHLVEPRVTSPEFTEGQ 308

Query: 303 GAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLK 362
            AY  GTNDF  SIW GPIIRAGNLALHP+V  EM++D+RTLI YGR +IANPDL  R+ 
Sbjct: 309 NAYLDGTNDFALSIWKGPIIRAGNLALHPEVVREMIEDDRTLIAYGRLFIANPDLPDRIA 368

Query: 363 DGLPLNKYDRDTFYRMSDEGYLDYPTYEEA 392
            GLPLN YDR+TFY    EGY+DYP Y+++
Sbjct: 369 KGLPLNPYDRNTFYFPGSEGYIDYPFYKDS 398

>Suva_16.139 Chr16 complement(235387..236562) [1176 bp, 391 aa] {ON}
           YPL171C (REAL)
          Length = 391

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 307/399 (76%), Gaps = 9/399 (2%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDF+PV+L +TNL +PI++G+ +L HR V     RMRA+HPGNVPNK+WA EYY Q
Sbjct: 1   MPFVKDFEPVSLENTNLFKPIKLGNTELPHRVV-----RMRASHPGNVPNKEWAAEYYAQ 55

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R+Q PG++IITEG FISPQAGGYDNAPGIWSDEQVAQW KI + IH+  SF +VQLWALG
Sbjct: 56  RAQRPGTMIITEGAFISPQAGGYDNAPGIWSDEQVAQWRKILQAIHEKKSFAWVQLWALG 115

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             S+ D + RDGLRYD+ SD  YM    K     A  P H LTK +I+QY+KEYV A  N
Sbjct: 116 WASFPDAMARDGLRYDSASDAVYMEGTAK----AAKVPGHSLTKDDIEQYVKEYVHAGKN 171

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           ++ AGADGVEIHSANGYLLNQFLDP +N R DEYGGS+ENRARF               +
Sbjct: 172 AVLAGADGVEIHSANGYLLNQFLDPRSNTRNDEYGGSIENRARFTLQVVDAVADAIGHDR 231

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYGTF  M+GG  P IVAQYAY++GEL++RA  G++LAY+HLVEPRVT+P L E
Sbjct: 232 VGLRLSPYGTFNDMSGGAEPDIVAQYAYVLGELEKRAKAGKRLAYVHLVEPRVTNPLLDE 291

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y+ G+NDF YSIW GPII+AGN ALHP+   E +K +RTLI YGRF+I+NPDLV R
Sbjct: 292 GEGEYDKGSNDFAYSIWKGPIIKAGNFALHPNSVKEEVKCDRTLIAYGRFFISNPDLVDR 351

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
           L+ GLPLNKYDR TFY MS +GY DYPTY+E++ LGWDK
Sbjct: 352 LEKGLPLNKYDRATFYTMSAQGYTDYPTYDESVDLGWDK 390

>CAGL0L09537g Chr12 (1029031..1030233) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/400 (63%), Positives = 309/400 (77%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF  DF PVAL DTNL +P++VG+ ++  R  M PL+R RA   GNVPNK+W EEYY Q
Sbjct: 1   MPFKHDFTPVALKDTNLFKPLKVGNTEVLQRVAMAPLSRFRADPQGNVPNKNWTEEYYRQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++IITE TFIS QAGGYD APGIW++EQ+ QW KIFK IHDN SFV+VQ+WALG
Sbjct: 61  RSQRPGTMIITEATFISAQAGGYDAAPGIWTEEQMEQWKKIFKAIHDNKSFVWVQMWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ + + RDGLR DAPS   YMS++QKE A + N  QH LTK +IKQYIK+YV+AA N
Sbjct: 121 RQAFPNNMARDGLRLDAPSADLYMSDKQKEVAKENNIAQHELTKEDIKQYIKDYVKAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           S+++GADGVEIHSANGYLLNQF+DP++N RTDEYGGS+ENR RF              ++
Sbjct: 181 SVESGADGVEIHSANGYLLNQFIDPKSNRRTDEYGGSIENRCRFALEVVDAVVDAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
            GIR SPYG FG M+GG  P IVA YAY++GEL++R   G++LAYIHLVEP VTD  L E
Sbjct: 241 TGIRLSPYGLFGNMSGGFEPSIVAHYAYLIGELEKRGIAGKRLAYIHLVEPSVTDLMLVE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
            +G Y  GTNDF YSIW GPIIRAGN ALHP++  E +KD RTLI YGR++I+NPD++ R
Sbjct: 301 DQGEYKEGTNDFAYSIWKGPIIRAGNYALHPELVKEQVKDPRTLIAYGRYFISNPDIIDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L++GLPLN+ DR TFY  + EGY+DYP Y +AL+LGWDKQ
Sbjct: 361 LENGLPLNEQDRPTFYTPTAEGYIDYPNYNDALQLGWDKQ 400

>KLTH0G01584g Chr7 complement(114328..115530) [1203 bp, 400 aa] {ON}
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 400

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/396 (64%), Positives = 311/396 (78%), Gaps = 1/396 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV+ FKP+AL DTNL +PI+VG   L++RAV+ PLTR+RA+ P +VPN + A +YY Q
Sbjct: 1   MTFVEGFKPIALKDTNLFKPIKVGKTVLRNRAVLCPLTRLRASQPRHVPNSELATKYYGQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS  PG++IITEGTF S Q+ G DNAPGIWS EQV +W KIF +IH+N SFV+VQLW LG
Sbjct: 61  RSSVPGTMIITEGTFPSAQSSGTDNAPGIWSQEQVTEWKKIFSKIHENKSFVWVQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+   +L RDGLRYDAPSD  YMSEE K+ A+++ NPQHGLT  EIKQYI++YV+AA N
Sbjct: 121 RQASPKSLKRDGLRYDAPSDEPYMSEETKKEAIESGNPQHGLTHEEIKQYIQDYVQAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           S++AGADGVEIHSANGYLLNQFLDP++N RTDEYGGS+E RARF              + 
Sbjct: 181 SLEAGADGVEIHSANGYLLNQFLDPKSNKRTDEYGGSIEKRARFLLEVVDAVVDAVGHEH 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SPYGTFG M+G  +PL +AQYAY+VG+L+ RA  G+ +AYIHLVEPRVT P L E
Sbjct: 241 VGVRLSPYGTFGNMSGASDPLFLAQYAYVVGQLEARAKSGKGIAYIHLVEPRVTSPRLVE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLK-DNRTLIGYGRFWIANPDLVR 359
           GEG +  G+N+FV SIW GPII+AGN AL P  A E ++ D+RTLIGYGR +IANPDLV 
Sbjct: 301 GEGWFKDGSNEFVGSIWKGPIIKAGNYALDPKAAKEDVQFDDRTLIGYGRLFIANPDLVL 360

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKL 395
           RLKDGLPLN+YDRDTFY  + +GY+DYPT+EEA KL
Sbjct: 361 RLKDGLPLNQYDRDTFYTQTAKGYVDYPTFEEAQKL 396

>CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/400 (61%), Positives = 309/400 (77%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F  DF+PV+L  TNL +P++VG+  + HRA  PPLTRMRA  PGN+PN++W+ EYY Q
Sbjct: 1   MSFTTDFEPVSLKGTNLFKPLKVGNNTVLHRAAFPPLTRMRAESPGNIPNREWSVEYYRQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+L+ITEGTF S QAGGYDNAPGIWS+EQ+ +W KI   IH N SF +VQLWALG
Sbjct: 61  RSQRPGTLVITEGTFPSAQAGGYDNAPGIWSEEQLVEWRKIIDAIHSNKSFAWVQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R +  + L RDGLR+D+ +D  Y S EQ+E A K+NN QHGL++ +IKQY+ +YV+A+ N
Sbjct: 121 RLAMPNLLARDGLRFDSATDNYYASPEQEELAKKSNNLQHGLSREDIKQYVNDYVQASKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVEIHS+ G+LLN+F+DP +N R+DEYGGS+ENRARF              +K
Sbjct: 181 AISAGADGVEIHSSTGFLLNEFIDPISNHRSDEYGGSIENRARFVLEVVDAVVDAIGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
             IRFSPYG +G M+GG +P I+AQYAYI+GEL++RA  G++LAYIH +EPRV DPFL E
Sbjct: 241 TAIRFSPYGNYGGMSGGTDPTIIAQYAYIIGELEKRAKGGKRLAYIHFMEPRVLDPFLPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GE  YN GT DF YSIW G IIR GN A+HP+V  +++ D+RT+IGYGR++I+NPDLV R
Sbjct: 301 GESVYNEGTIDFAYSIWKGVIIRTGNYAIHPEVVKDVVNDDRTIIGYGRYFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLNKYDR  FY M+ EGY+DYPTY EA+K GWDK+
Sbjct: 361 LEKGLPLNKYDRSYFYTMTAEGYIDYPTYAEAIKKGWDKK 400

>NCAS0B00730 Chr2 (110836..112023) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/394 (62%), Positives = 308/394 (78%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MP VKDFKPVAL +TNL +PI+VG+ Q++HR VM PLTRMRA HPGN+PN+DWA EYY+Q
Sbjct: 1   MPLVKDFKPVALKNTNLFKPIKVGNTQVEHRVVMAPLTRMRAHHPGNIPNRDWAAEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++I+TEG F S Q+GGYDNAPGIWS EQ+ QW+KIF RIH N SFV+ QLW LG
Sbjct: 61  RSKRKGTMIVTEGVFPSAQSGGYDNAPGIWSKEQIEQWSKIFDRIHANGSFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ D+L RDGLRYD+ SD  Y+  E ++RA +A NPQHG+TK EIKQY+K+Y++ A N
Sbjct: 121 RQAFPDSLARDGLRYDSASDDVYIDAETEQRAKEAKNPQHGITKDEIKQYVKDYIQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           S+ AGADGVEIHSAN YLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 SVNAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALIDAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+G  G M+GG +P ++AQ+AY+VGEL++RA EG+++AYIHLVEPR+T+  +  
Sbjct: 241 VGIRLSPWGRIGGMSGGSDPTLLAQFAYLVGELEKRAKEGKRIAYIHLVEPRITEWDVDY 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
             G+   GTNDF+YSIW GPIIRAGN  L+P+   + +  +RTLIGYGRF+I+NPDL  R
Sbjct: 301 DAGSNENGTNDFIYSIWKGPIIRAGNFTLNPEETTKAVSMDRTLIGYGRFFISNPDLPDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           L++G PLN YDR +FY  + EGY DYPT EEALK
Sbjct: 361 LENGSPLNAYDRSSFYSFTKEGYTDYPTLEEALK 394

>TBLA0E03220 Chr5 complement(808667..809869) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/400 (60%), Positives = 311/400 (77%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF  +FKPVAL DT+L +P++VG+  + +R V+PPLTRMRA +PGNVPN+DW  EYY+Q
Sbjct: 1   MPFNTEFKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+++ITEG F S QAGGYDNAPGIW+ EQ+ +W KIF +IH N SFV+ QLW LG
Sbjct: 61  RSKRPGTMLITEGVFPSAQAGGYDNAPGIWTKEQMVEWKKIFDKIHKNGSFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R++   +L RDGLRYD+ SD  + ++E +E A KA   QHG+TK EIKQYIK+YV+ A N
Sbjct: 121 READPLSLARDGLRYDSASDNVWRTKETEEEAKKAGIEQHGITKDEIKQYIKDYVQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SIK GADG+EIH+ANGYLLNQFLDP +N RTDEYGGS+ENRARF               K
Sbjct: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIENRARFTLEVVDALVDAIGEDK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR +PY T G M+G  +P + A YAY++GEL++RA  G++LA++H+ EPRV++P+  E
Sbjct: 241 VGIRLAPYNTNGGMSGSWDPCVFAHYAYVLGELEKRAQAGKRLAFVHIFEPRVSNPWDNE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+GAYN GT ++VYSIW G +IR GNLA+HP+VA E LK   TL+GYGR++I+NPDLV R
Sbjct: 301 GDGAYNGGTTEYVYSIWKGVVIRTGNLAIHPEVAKEFLKYPNTLLGYGRYFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLN YDR  FY M+D+GY+DYPTY+EA+K+GW K+
Sbjct: 361 LEKGLPLNLYDRPRFYAMTDKGYIDYPTYDEAIKMGWGKE 400

>NCAS0B01090 Chr2 (180367..181554) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/394 (60%), Positives = 300/394 (76%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M  VKDFKPVAL +TNL +PI++G+ Q++HR VM  LTRMRA HPGN+PN+DWA EYY+Q
Sbjct: 1   MTLVKDFKPVALKNTNLFKPIKIGNTQVEHRVVMARLTRMRAHHPGNIPNRDWAAEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++I+TEG F S Q+GGYDNAPGIWS EQ+ QW+KIF RIH N SFV+ QLW LG
Sbjct: 61  RSKRKGTMIVTEGVFPSAQSGGYDNAPGIWSKEQIEQWSKIFDRIHANGSFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ D      LRYD+ SD  Y+  E ++RA +A NPQHG+TK EIKQY+K+Y++ A N
Sbjct: 121 RQAFPDHWQETCLRYDSASDDLYIDAETEQRAKEAKNPQHGITKDEIKQYVKDYIQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           S+ AGADGVEIHSAN YLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 SVNAGADGVEIHSANSYLLNQFLDPISNKRTDEYGGSIENRARFALEVVDALIDAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+G +G M+GG +P ++AQ+AY+VGEL++RA EG+++AYIHLVEPRVT   +  
Sbjct: 241 VGIRLSPWGRYGGMSGGSDPTLLAQFAYLVGELEKRAKEGKRIAYIHLVEPRVTPWNVDA 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
             G+   GTNDF+YSIW GPIIRAGN  L+P+   + +  +RTLIGYGR++I+NPDL  R
Sbjct: 301 DAGSNENGTNDFIYSIWKGPIIRAGNFTLNPEETTKAVSMDRTLIGYGRYFISNPDLADR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           L+ G PLN YDRDTFY  S EGY DYPT EEA K
Sbjct: 361 LEKGAPLNAYDRDTFYTFSKEGYTDYPTLEEATK 394

>KAFR0F03550 Chr6 (706557..707759) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/400 (62%), Positives = 310/400 (77%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF+KD+ PV L D+ L +P++VG++++QHRAVMPPLTR RA  PG VPN +    YY+Q
Sbjct: 1   MPFIKDYTPVDLKDSLLFKPMKVGNVEVQHRAVMPPLTRFRAQEPGAVPNAELMSVYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+LIITEG FIS QAGGYD APG+WS EQV +W KIF +IH+N SFV+ QLW LG
Sbjct: 61  RSQRPGTLIITEGVFISRQAGGYDYAPGLWSQEQVNEWKKIFAKIHNNKSFVFAQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+  + + RDGLR+D+ +D  Y+++E KE+A KA   QHG+T  EIKQYIKEYV AA N
Sbjct: 121 RQAAPEWMARDGLRFDSATDDLYINDEIKEKAEKAGIKQHGITAEEIKQYIKEYVIAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVE+H ANGYLLNQF+DP +N RTD YGGS+ENRARF              +K
Sbjct: 181 AIAAGADGVEVHCANGYLLNQFIDPLSNNRTDAYGGSIENRARFPLEVIDAVIEAVGAEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+RFSP+GT+GTM+G +NP+I+AQYAY++GEL++RA  G+++AYIHLVEP V+D  L E
Sbjct: 241 VGVRFSPFGTYGTMSGSENPVILAQYAYLIGELEKRAKAGKRMAYIHLVEPAVSDFLLDE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G  N  +NDF YSIW GPIIRAG+ AL P  A E +  +RTL+GYGRF+IANPDLV R
Sbjct: 301 GQGQDNGSSNDFAYSIWKGPIIRAGDFALRPAAAKEAVSADRTLVGYGRFFIANPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GL LN+YD+ TFY  + EGY DYPTY EA+KLGWDKQ
Sbjct: 361 LEKGLQLNQYDKSTFYIQTAEGYTDYPTYAEAVKLGWDKQ 400

>Kpol_370.3 s370 (3999..5201) [1203 bp, 400 aa] {ON} (3999..5201)
           [1203 nt, 401 aa]
          Length = 400

 Score =  508 bits (1307), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 304/401 (75%), Gaps = 2/401 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFVKDFKPVALGDTNL +PI+VG+M+L+HR VMPPLTRMRA++PGNVP  D   EYY+Q
Sbjct: 1   MPFVKDFKPVALGDTNLFKPIKVGNMELKHRIVMPPLTRMRASYPGNVPT-DLMVEYYDQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G+ I+ EG F S Q+GGYDNAPG WS EQ+ QW KIF  +H N SF++ Q+W LG
Sbjct: 60  RSRREGTFIVAEGVFPSAQSGGYDNAPGAWSKEQLDQWKKIFDVVHKNKSFMFPQVWVLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R  + D+L RDGLRYD+ SD  Y+ EE + +A  + N QHG+TK EI+QYIK+YV+ + N
Sbjct: 120 RLGFPDSLARDGLRYDSASDDVYLDEEYETKAKSSGNRQHGITKSEIQQYIKDYVQGSKN 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            ++AGADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 180 LVEAGADGVEIHSANGYLLNQFLDPVSNKRTDEYGGSIENRARFTLEVVDALIEAVGPER 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SPYG +GTM+G ++P ++A YAY+ GE+++RA  G+++AYIHL+EPRV +    E
Sbjct: 240 VGIRLSPYGKYGTMSGDRDPTLLATYAYVAGEIEKRAKNGKRIAYIHLMEPRVANGSFDE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEML-KDNRTLIGYGRFWIANPDLVR 359
               +   TN+F+YSIW GP+IR+G L + P  A  +   +NRTL+ +GR++IANPDLV 
Sbjct: 300 SLEEFTDNTNEFIYSIWKGPVIRSGTLVMSPLHAKAIANSNNRTLLAHGRYFIANPDLVT 359

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           R++ GLP+NKYDR TFY  S EGY DYPTYEEALKLGWDK+
Sbjct: 360 RIEKGLPINKYDRSTFYAPSSEGYTDYPTYEEALKLGWDKE 400

>NDAI0E00850 Chr5 complement(170233..171432) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  507 bits (1305), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 232/395 (58%), Positives = 302/395 (76%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MP VKD+ PV L +T+L +P++VG+  ++HR VM PLTRMRA  PG++PN+DWA EYY+Q
Sbjct: 1   MPLVKDYTPVPLANTDLFKPLKVGNTTVEHRVVMAPLTRMRAHAPGHIPNRDWAVEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  GS+IITEG F S Q+ GYDNAPGIW+ EQ+ QWTKIFK+IH+N SFV+ QLW LG
Sbjct: 61  RSKRKGSMIITEGVFPSAQSSGYDNAPGIWTPEQIEQWTKIFKKIHENGSFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ D + RDGLRYD+ SD  YM +E KE+A+K+NNPQHG+TK EIKQY+K+YV+ A N
Sbjct: 121 RQAFPDAMARDGLRYDSASDDLYMDDEMKEKAIKSNNPQHGITKDEIKQYVKDYVQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +++AGADGVEIHSAN YLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 AVEAGADGVEIHSANSYLLNQFLDPISNHRTDEYGGSIENRARFTLEVVDALIEAVGPER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+G +G M+G  +P +++Q+ Y+VGEL++RA  G+++A+IHLVEPRVTD F   
Sbjct: 241 VGIRLSPWGRYGGMSGSADPTLLSQFCYVVGELEKRAKAGKRIAFIHLVEPRVTDLFSDS 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
                + GTNDF+YSIW G +IRAG     P+     + +++T+IG GR++I+ PDLV R
Sbjct: 301 TAVPEDDGTNDFIYSIWKGVVIRAGMFPARPESIKAAVANDQTMIGAGRYFISTPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKL 395
           L+ G PLNKYDR TFY  + EGY DYPTYEEA+KL
Sbjct: 361 LEKGQPLNKYDRSTFYSFTKEGYTDYPTYEEAVKL 395

>TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON} 
          Length = 418

 Score =  506 bits (1303), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/394 (61%), Positives = 294/394 (74%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV++FKPVALGD NL +PI+VG+ +L+HRAV PPLTR RA HP  V +K+W  +YY+Q
Sbjct: 1   MPFVEEFKPVALGDANLFKPIKVGNNELKHRAVFPPLTRRRAQHPDYVSHKEWTAKYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G L+ITE  FIS QAGG DN P IWS EQ+A+W K+F  +H N SF++ QLWALG
Sbjct: 61  RSRREGILLITEAAFISRQAGGDDNVPVIWSKEQIAEWEKVFAAVHKNKSFIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
             + A  + RDGLRYD  +D  Y ++   E A +     HGLTK ++KQYIK+YV AA N
Sbjct: 121 WAADAKLMARDGLRYDGATDDVYGNDIHGEIAKENKVKIHGLTKDDMKQYIKDYVAAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I AGADGVEIHSANGYLLNQFLD  +N RTDEYGGS+ENRARF               K
Sbjct: 181 CIAAGADGVEIHSANGYLLNQFLDINSNKRTDEYGGSIENRARFTLEVVDALIEAFGADK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           + IR SPYG F  ++GG NPL VAQYAY+VGEL++RA  G +LA+I LVEPRVT P L E
Sbjct: 241 LSIRLSPYGVFNDISGGSNPLTVAQYAYVVGELEKRAQAGNRLAFIDLVEPRVTSPVLPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEG Y  GTN+F+YSIW G IIRAGNLA HP+VA E LKD+RTL+ YGR WI+NPD+V R
Sbjct: 301 GEGEYTEGTNEFIYSIWKGVIIRAGNLAYHPEVAKEFLKDDRTLLAYGRIWISNPDIVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           L+ GLP NKY+RDTFY MS+EGYLDYPT +EA+K
Sbjct: 361 LEKGLPSNKYNRDTFYTMSEEGYLDYPTCDEAVK 394

>TBLA0G00610 Chr7 complement(133711..134910) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  505 bits (1300), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/403 (59%), Positives = 306/403 (75%), Gaps = 7/403 (1%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F+K+FKP+AL DT L +PI+V D  L HR V+PPLTRMRA+ PGNVPN++WA EYY+Q
Sbjct: 1   MSFIKEFKPIALEDTKLFKPIKVSDTNLSHRVVLPPLTRMRASFPGNVPNEEWAPEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PGS+IITEGTFISPQA  YDNA G+WSD+Q+A W KIFKR+ +N S+++ QLWALG
Sbjct: 61  RSKRPGSMIITEGTFISPQAAVYDNAQGVWSDKQIAVWKKIFKRVRNNKSYIWPQLWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSD---GNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEA 177
           RQ+ A  L RDGLR+D+PS    G    E  K+  L     QH LTK EIKQY++E+  A
Sbjct: 121 RQADAVALKRDGLRFDSPSGIDFGGKYGELYKKYGLS----QHILTKEEIKQYVEEFSTA 176

Query: 178 AVNSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXX 237
           A   I AGADG+EIH+ANG+LLN FLDP +N RT+EYGGS+ENR+RF             
Sbjct: 177 AKKIIDAGADGIEIHAANGFLLNPFLDPISNKRTNEYGGSIENRSRFTLEVVDAVIAAVG 236

Query: 238 XKKVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPF 297
             KVGIRFS +GT GTM+GG  PLI+AQY++++GEL++RA EG  + YIHL+EPRVT+PF
Sbjct: 237 HTKVGIRFSAFGTHGTMSGGSEPLIIAQYSHVIGELEKRAKEGNGVVYIHLMEPRVTNPF 296

Query: 298 LTEGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDL 357
           L EGEG Y   TNDF YSIWTG IIRAGNLALHP+++ E+ KD RTL+ + R +I+NPDL
Sbjct: 297 LLEGEGEYLDDTNDFAYSIWTGIIIRAGNLALHPEISRELSKDERTLLAFVRLYISNPDL 356

Query: 358 VRRLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
             RL+ GLPLNKY+R+TFY M  EGY++Y  Y +A+K+G++K+
Sbjct: 357 PDRLEKGLPLNKYNRETFYHMGAEGYIEYLRYNQAIKIGYNKE 399

>NDAI0A00330 Chr1 (47534..48727) [1194 bp, 397 aa] {ON} 
          Length = 397

 Score =  500 bits (1287), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 303/395 (76%), Gaps = 2/395 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M    D+ P+ L DT L +P++VG+  ++HR VM PLTRMRA  PG+VPNKDWA EYY+Q
Sbjct: 1   MVLNTDYTPIPLHDTKLFKPLKVGNTTVEHRVVMAPLTRMRAHFPGHVPNKDWAAEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++IITEG   S Q+GGYDNAPGIWS EQ+ QW+KIF RIH N SFV+ QLW LG
Sbjct: 61  RSKRKGTMIITEGVNPSEQSGGYDNAPGIWSPEQIEQWSKIFDRIHKNGSFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ D+L RDGLRYD+ SD  YM +E KERA+K+NNPQHG+TK EIKQY+K+YV+ A N
Sbjct: 121 RQAFPDSLARDGLRYDSASDNLYMDDEMKERAIKSNNPQHGITKSEIKQYVKDYVQGAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +++AGADGVEIHSAN YLLNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 AVEAGADGVEIHSANSYLLNQFLDPISNHRTDEYGGSIENRARFALEVVDALIEAVGHER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+G +G M+GG +P ++AQY Y+VGEL++RA  G+++AYIHLVEPRVTD +  E
Sbjct: 241 VGIRLSPWGRYGGMSGGSDPTLLAQYCYVVGELEKRAKLGKRIAYIHLVEPRVTD-WSDE 299

Query: 301 GEGA-YNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVR 359
           G+    + GTNDF+YSIW GP+IRAG    + D   +++ +++TLIG GR++I+ PDLV 
Sbjct: 300 GKKVPEDDGTNDFIYSIWKGPVIRAGMFPANADAITKVVANDQTLIGAGRYFISTPDLVD 359

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           RL  GLPLN+YDR +FY  + EGY+D PTY+EA+K
Sbjct: 360 RLDKGLPLNRYDRSSFYSFTAEGYIDLPTYDEAIK 394

>ZYRO0F13618g Chr6 (1122697..1123905) [1209 bp, 402 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179W OYE2
           Widely conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN) homologous to Oye3p with slight
           differences in ligand binding and catalytic properties
           may be involved in sterol metabolism
          Length = 402

 Score =  499 bits (1284), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/397 (59%), Positives = 294/397 (74%), Gaps = 2/397 (0%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
           F     P+ LG TNL +PIEVGDM+L HR VM PLTR+RA      PN + A EYY QR+
Sbjct: 6   FTNRVHPIPLGHTNLFEPIEVGDMKLAHRVVMAPLTRLRATK--YAPNGELAPEYYAQRA 63

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQ 122
           Q PG+LIITE ++ +PQ GGY NAPG+W+ E    W ++FKR+H+  SF+YVQLW +GRQ
Sbjct: 64  QRPGTLIITEASYPAPQFGGYVNAPGLWAKEHWDVWREVFKRVHEKKSFIYVQLWNMGRQ 123

Query: 123 SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSI 182
           +    L  DGLRYD+ SDG YM +  +E A+K+NNPQHGLTK EIKQY+K++V A+  S+
Sbjct: 124 APPAVLKADGLRYDSASDGVYMDKNSEEEAIKSNNPQHGLTKDEIKQYVKDFVRASKESV 183

Query: 183 KAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVG 242
           + GADGVEIHSANGYLLNQFLDP +N RTDEYGGS+ENRARF              +K  
Sbjct: 184 ENGADGVEIHSANGYLLNQFLDPGSNKRTDEYGGSIENRARFTLEVVDAVVDAIGPEKTA 243

Query: 243 IRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGE 302
           +RFSPYG FG+M+GG  P IVAQYAY+ GEL+RRA +G++L+YIHLVEPRVT P L EG+
Sbjct: 244 VRFSPYGKFGSMSGGSAPEIVAQYAYVFGELERRAKQGKRLSYIHLVEPRVTHPGLLEGQ 303

Query: 303 GAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLK 362
           G Y+ G+NDF+YSIW G ++RAGNLALHP+V  E +K  RTLI YGRF+I+NPDLV RL+
Sbjct: 304 GEYDEGSNDFIYSIWKGVVLRAGNLALHPEVVKEWVKFPRTLICYGRFFISNPDLVDRLE 363

Query: 363 DGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDK 399
            GLPL +YDRD FY    EGY DYP Y E +K G+ K
Sbjct: 364 KGLPLTEYDRDNFYTHGAEGYTDYPNYSECVKEGYQK 400

>KNAG0L00690 Chr12 complement(110526..111722) [1197 bp, 398 aa] {ON}
           
          Length = 398

 Score =  496 bits (1278), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 293/397 (73%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F  +F PVAL D NL +PI+VG M+L HR VM PLTRMRA HP ++PN++    YY+Q
Sbjct: 1   MSFQTNFTPVALKDANLFKPIKVGAMELDHRVVMAPLTRMRALHPNHIPNEELTPLYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+LIITE TFIS QAGGYDNAPGIWS+EQVA W KIF +IH N+SFV+VQLW LG
Sbjct: 61  RSKAPGTLIITEATFISAQAGGYDNAPGIWSEEQVAVWKKIFAKIHGNNSFVFVQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    + RDGLRYD+ SD  Y+ EE K+ A  A   QHG+TK EIKQYI EYV AA N
Sbjct: 121 RQAIPSAMARDGLRYDSASDDLYIDEETKKAAFDAGIKQHGITKSEIKQYIAEYVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI+AGADGVEIHSAN Y+LNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 SIEAGADGVEIHSANSYILNQFLDPISNHRTDEYGGSIENRARFSLEVVDALINAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSP+G +G M+G  +P +   Y+Y++ +L+ RA  G +LAY+HL+EPRVT+  L E
Sbjct: 241 VGIRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVTNASLEE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G     +NDF Y  W GPIIR+G  A++PD+   ++ D+RTLI YGR++I+ PDL  R
Sbjct: 301 GQGEDLEHSNDFAYEHWKGPIIRSGTFAINPDITKRVV-DDRTLIAYGRYFISTPDLPHR 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           L +GLPLNKYDR TFY  S  GY DYPTYEEALKLGW
Sbjct: 360 LAEGLPLNKYDRPTFYAPSAVGYTDYPTYEEALKLGW 396

>TBLA0D03290 Chr4 complement(821240..822442) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  496 bits (1278), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/400 (58%), Positives = 311/400 (77%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF  + KPVAL DT+L +P++VG+  + +R V+PPLTRMRA +PGNVPN+DW  EYY+Q
Sbjct: 1   MPFNTESKPVALKDTDLFKPLKVGNTTVLNRVVLPPLTRMRAHYPGNVPNRDWTLEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+++ITEG F S +AGGYDNAPGIW++EQ+ +W KIF +IH+N+SFV+ QLW LG
Sbjct: 61  RSKRPGTMLITEGVFPSAKAGGYDNAPGIWTEEQMVEWKKIFDKIHENESFVWPQLWVLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R++   +L RDGLRYD+ SD  + ++E +E A KA   QHG+TK EIKQYIK+YV+ A N
Sbjct: 121 READPLSLARDGLRYDSASDNVWRTKEAEEEAKKAGIEQHGITKDEIKQYIKDYVQGARN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SIK GADG+EIH+ANGYLLNQFLDP +N RTDEYGGS++NRA F               K
Sbjct: 181 SIKCGADGIEIHAANGYLLNQFLDPVSNKRTDEYGGSIKNRACFTLEVVDALVDAIGEDK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR +PY T G M+G  +P + A YAY++G+L++RA  G++LA++H+ EPRV++P+  E
Sbjct: 241 VGIRLAPYNTNGDMSGSWDPTVFAHYAYVLGKLEKRAQAGKRLAFVHIFEPRVSNPWDNE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+GAYN GT D+VYSIW G +IR GNLA+HP++A E LK   TL+GYGR++I+NPDLV R
Sbjct: 301 GDGAYNGGTTDYVYSIWKGVVIRTGNLAIHPEIAKEFLKQPNTLLGYGRYFISNPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           L+ GLPLN YDR  FY M D+GY+DYPTY+EA+K+GW ++
Sbjct: 361 LEKGLPLNLYDRPRFYAMPDKGYIDYPTYDEAIKMGWGEK 400

>KNAG0B05410 Chr2 complement(1046164..1047360) [1197 bp, 398 aa]
           {ON} 
          Length = 398

 Score =  495 bits (1274), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 293/397 (73%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F  +F PVAL D NL +PI+VG M+L HR VM PLTRMRA HP ++PN++    YY+Q
Sbjct: 1   MSFQTNFTPVALKDANLFKPIKVGAMELDHRVVMAPLTRMRALHPNHIPNEELTPLYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+LIITE TFIS QAGGYDNAPGIWS+EQVA W KIF +IH N+SFV+VQLW LG
Sbjct: 61  RSKAPGTLIITEATFISAQAGGYDNAPGIWSEEQVAVWKKIFAKIHGNNSFVFVQLWNLG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    + RDGLRYD+ SD  Y+ EE K+ A  A   QHG+TK EIKQYI EYV AA N
Sbjct: 121 RQAIPSAMARDGLRYDSASDDLYIDEETKKAAFDAGIKQHGITKSEIKQYIAEYVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI+AGADGVEIHSAN Y+LNQFLDP +N RTDEYGGS+ENRARF              ++
Sbjct: 181 SIEAGADGVEIHSANSYILNQFLDPISNHRTDEYGGSIENRARFSLEVVDALINAIGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSP+G +G M+G  +P +   Y+Y++ +L+ RA  G +LAY+HL+EPRVT+  L E
Sbjct: 241 VGIRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVTNASLEE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G     +NDF Y  W G IIR+GN A++PD+   ++ D+RTLI YGR++I+ PDL  R
Sbjct: 301 GQGEDLEHSNDFAYEHWKGLIIRSGNFAINPDITKRVV-DDRTLIAYGRYFISTPDLPHR 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           L +GLPLNKYDR TFY  S  GY DYPTYEEALKLGW
Sbjct: 360 LAEGLPLNKYDRPTFYAPSAVGYTDYPTYEEALKLGW 396

>KAFR0E00120 Chr5 (19340..20542) [1203 bp, 400 aa] {ON} 
          Length = 400

 Score =  492 bits (1267), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 296/400 (74%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF +    V L  TNL +PI++G+  L HRAVM PLTR+RA+ PG VPN   A EYY+Q
Sbjct: 1   MPFAEQKNAVPLEGTNLFKPIKIGNTTLSHRAVMAPLTRLRASWPGQVPNTKLATEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++I++E   ISPQ GG ++APGIW+DEQVA+W KI K++HDN S+ +VQ WALG
Sbjct: 61  RSKRKGTMILSEAAVISPQTGGINHAPGIWNDEQVAEWKKIIKKVHDNGSYFWVQFWALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R ++   L  DGLRY + SD  Y+   ++E A+ ANN QHGLTK EIK ++ ++  AA N
Sbjct: 121 RHAHPGNLAGDGLRYVSASDDVYIDPVREEIAMYANNQQHGLTKEEIKSFVADFANAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SIKAGADGVE+HSA G++LNQFLDP++N RTD YGGS+ENR+RF              ++
Sbjct: 181 SIKAGADGVEVHSAFGFILNQFLDPKSNKRTDGYGGSIENRSRFTLEVIDACIDAVGAER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+R SP+  +G+M+GG++P ++A YAYI+GEL++R   G ++A+I L+EPR+TDPF  E
Sbjct: 241 VGVRLSPWAVYGSMSGGEDPTLLATYAYILGELEKRGKAGNRIAFIDLIEPRITDPFSPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+  Y  G NDF YS+W GPIIR+GNL LHP    EM++D RTL+ YGRFWI+NPDL+ R
Sbjct: 301 GQNEYKKGNNDFAYSVWKGPIIRSGNLTLHPKAVKEMVEDERTLVAYGRFWISNPDLIDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           ++ GLPLNKYDR TF+  ++ G  DYPTYEEALKLGWDK+
Sbjct: 361 VEKGLPLNKYDRKTFFGRTEVGLTDYPTYEEALKLGWDKK 400

>TBLA0B02130 Chr2 (488878..490074) [1197 bp, 398 aa] {ON} 
          Length = 398

 Score =  489 bits (1259), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/397 (58%), Positives = 296/397 (74%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPFV+ FKPV L +TN  +PI++G  QL+HR VMPPLTRMR+  PGNVP  +   EYY+Q
Sbjct: 1   MPFVQHFKPVPLKNTNCFKPIQIGTTQLKHRIVMPPLTRMRSTSPGNVPT-EMMIEYYDQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+YPG++IITEG FIS QAGGYDNAPGIWS +Q+  W KIF +IH N SFV+ QLW LG
Sbjct: 60  RSKYPGTMIITEGVFISAQAGGYDNAPGIWSSDQLKIWGKIFAQIHKNGSFVWPQLWVLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    + RDGLRYD+ SD    +++  + A   +   H +T+ EI+QYIKEYV+AA  
Sbjct: 120 RQAIPTNMKRDGLRYDSSSDLLNDNDQFGQLAKAHDIKLHSITEEEIQQYIKEYVDAAKK 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SI  GADGVEIHSANGYLLNQFLDP  N R D+YGG++ENR RF              ++
Sbjct: 180 SISVGADGVEIHSANGYLLNQFLDPICNKRNDKYGGNIENRCRFALEVVDALTEAIGHER 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+G +G M+G  +  ++A +AY++GEL++RA +G+++AYIHL+EPRVTD  L E
Sbjct: 240 VGIRLSPFGVYGGMSGANDSTLLATFAYLIGELEKRAKDGKRIAYIHLMEPRVTDASLEE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+GA    +N+FVYSIW G +IR+GN+AL P+VA EM+ D+RTL+ +GRF+IANPDLV R
Sbjct: 300 GKGANEDVSNEFVYSIWKGKVIRSGNIALFPEVATEMVNDDRTLVAHGRFFIANPDLVER 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           L++GLPL KYDR TFY    EGY DYPTY+EA+ LGW
Sbjct: 360 LENGLPLTKYDRSTFYTQGKEGYTDYPTYKEAMGLGW 396

>ZYRO0F12144g Chr6 complement(986860..988053) [1194 bp, 397 aa] {ON}
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 397

 Score =  487 bits (1254), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 296/397 (74%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F K F+PV+LGDTNL +PI+VGD+QL HR V+ PLTR R  +   V N++ A EYY+Q
Sbjct: 1   MSFTKRFQPVSLGDTNLFKPIKVGDVQLNHRVVLAPLTRCRCLNDDGVLNQELAPEYYSQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG+LIITE  F S Q+ G+  +PG+ + +Q + W+K+F  IH N S V+VQ+W+ G
Sbjct: 61  RSQEPGTLIITEAAFPSLQSAGFVGSPGLITGDQFSAWSKVFNTIHKNKSSVFVQIWSAG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R +  + L ++ LRYD+ +D  YM+ E +E+A K    QHG+T+ EI +YI+++V AA N
Sbjct: 121 RSADLEVLAKNDLRYDSATDNLYMNREMEEKAAKLQLAQHGITQQEINEYIRDWVHAAKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           SIKAGADGVEIH+ANGYLLNQFLDP +N RTD+YGGS+ENR+RF               K
Sbjct: 181 SIKAGADGVEIHAANGYLLNQFLDPISNHRTDKYGGSIENRSRFPLEIVDAIIDAIGASK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           +GIRFSPYG +G M+ G NPLI+AQYA+I+GEL+RRA +G ++AYIHLVEPRVT P L E
Sbjct: 241 IGIRFSPYGFYGDMSSGDNPLILAQYAHIIGELERRAQQGNRIAYIHLVEPRVTIPQLPE 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           GEGAY  GTNDFVYSIW G +IR G+LALHP++  +  +DNRTL+ YGRF+I+NPDL  R
Sbjct: 301 GEGAYTGGTNDFVYSIWKGIVIRCGDLALHPELEEKFTEDNRTLLAYGRFFISNPDLAHR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           L++GLPLN+YDR TFY  +  GY DYP Y+  LKLG+
Sbjct: 361 LREGLPLNEYDRSTFYTSNSVGYTDYPNYQNCLKLGY 397

>NDAI0E01890 Chr5 complement(384211..385410) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score =  481 bits (1238), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 220/395 (55%), Positives = 290/395 (73%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MP VKD+ PV L +T+L + ++VG+  ++HR VM PLTRMRA  PG++PNKDW   YY+Q
Sbjct: 1   MPLVKDYTPVPLANTDLFKALKVGNTTVEHRVVMAPLTRMRAHAPGHIPNKDWEVVYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++IITE    S Q+ G DNAPGIW+ EQ+ QWTKIF +IH+N SFV+VQL A G
Sbjct: 61  RSKRKGTMIITEAVSPSAQSSGIDNAPGIWTPEQIEQWTKIFNKIHENGSFVWVQLCATG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ++ D + RDGLRYD+ SD  YM +E KERA+K+NNPQHG+TK EIKQYIK++V+   N
Sbjct: 121 RQAFPDAMARDGLRYDSASDNLYMDDELKERAIKSNNPQHGITKDEIKQYIKDFVQGTKN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +++AGADGVEIHS NG LLNQFLDP +N RTDEYGGS+ENR+RF              ++
Sbjct: 181 AVEAGADGVEIHSCNGCLLNQFLDPTSNHRTDEYGGSIENRSRFTLEVIDALIEAVGPER 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+  +  M+G  +P +++QY Y+VGEL++RA  G+++A+IHL+EPRVTD F   
Sbjct: 241 VGIRLSPWNRYAGMSGSADPTLLSQYCYVVGELEKRAKAGKRIAFIHLIEPRVTDIFFDC 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
                + GTNDF+YSIW G +IRAG     PD     + +++T+I  GR++I+ PDLV R
Sbjct: 301 TAVPEDDGTNDFIYSIWKGVVIRAGMFPSRPDSIKAAVANDQTMIAAGRYFISTPDLVDR 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKL 395
           L+ G PLNKYDR TFY  + EG+ DYPTYEEA+KL
Sbjct: 361 LEKGQPLNKYDRSTFYSFTKEGFTDYPTYEEAVKL 395

>KNAG0D03170 Chr4 complement(567087..568328) [1242 bp, 413 aa] {ON} 
          Length = 413

 Score =  481 bits (1237), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/395 (58%), Positives = 283/395 (71%), Gaps = 1/395 (0%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
           F   F PVA  DTNL +PI+VG M+L HR VM PLTR RA HP +VPN+     YY+QRS
Sbjct: 18  FQTSFAPVAFRDTNLFKPIKVGSMELAHRVVMAPLTRWRALHPSHVPNEKLVPLYYDQRS 77

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQ 122
           + PG+LIITE  F S QAGGYD APGIWS+EQVA WTKIF +IH N SFV+VQL  LGRQ
Sbjct: 78  KAPGTLIITESAFTSLQAGGYDYAPGIWSEEQVAVWTKIFAKIHGNKSFVFVQLRNLGRQ 137

Query: 123 SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSI 182
           +   ++ RDGLRYD+ SD  Y+ E  KE  LKA   QHG+TK EIKQYI EYV  A NSI
Sbjct: 138 AVPTSMARDGLRYDSASDDLYIDEATKEAVLKAGLKQHGITKSEIKQYIAEYVHTAKNSI 197

Query: 183 KAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVG 242
           KAGADGVEIHSAN Y+LNQFLDP +N RTDEYGGS+ENR+RF              ++VG
Sbjct: 198 KAGADGVEIHSANSYMLNQFLDPRSNHRTDEYGGSIENRSRFTLEVVDALIDAVGAERVG 257

Query: 243 IRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGE 302
           IRFSP+G +G M+G  +P +   Y+Y++ +L+ RA  G +LAY+HL+EPRV +  L EG+
Sbjct: 258 IRFSPFGKYGGMSGSDDPQVYELYSYLLDQLESRAQFGNRLAYVHLMEPRVANISLEEGQ 317

Query: 303 GAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLK 362
           G     +NDF Y  W GPIIR+GN A  PD+  E + D+RTLI YGR++I+ PDL  RL 
Sbjct: 318 GEDLEHSNDFAYDHWKGPIIRSGNFAASPDIT-ESVLDDRTLIAYGRYFISTPDLPHRLA 376

Query: 363 DGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           +GLPLNKY+R TFY++   GY DYPTYEE LKLGW
Sbjct: 377 EGLPLNKYNRTTFYKLGAVGYTDYPTYEETLKLGW 411

>TPHA0H02440 Chr8 complement(575387..576580) [1194 bp, 397 aa] {ON} 
          Length = 397

 Score =  479 bits (1232), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/397 (57%), Positives = 303/397 (76%), Gaps = 1/397 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV  FKP ALG+TNL +P+++G+  ++HR VMPPL+RMRA +  +V +KDW  +YY+Q
Sbjct: 1   MNFVSGFKPEALGNTNLFKPMKIGNTTVKHRVVMPPLSRMRA-NEDHVLDKDWTIKYYDQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++II EG F S Q GGY  APGIWS EQ AQW KI +++HDN SF++VQLW LG
Sbjct: 60  RSKREGTMIIAEGAFPSAQCGGYAGAPGIWSAEQTAQWKKIIQKVHDNKSFMWVQLWVLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQ+    +   GLR+D+PSD  Y +E+Q+  A +A   QHG+TK EIKQY+ +YV AA N
Sbjct: 120 RQAPPANMASAGLRFDSPSDLPYQNEKQEAAAKEAGTVQHGITKDEIKQYVADYVNAANN 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGA+GVEIH ANGYLLNQFLDP++N RTDEYGGS+ENRARF              +K
Sbjct: 180 AIAAGAEGVEIHCANGYLLNQFLDPKSNKRTDEYGGSIENRARFPLEVVDAVIAAIGAEK 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIRFSPYG FG M+GG NP++++Q++YI+GEL+RR  EG+++AY+H+VEP  TD  LTE
Sbjct: 240 VGIRFSPYGIFGDMSGGDNPMLISQFSYIIGELERRGKEGKRIAYVHVVEPLATDFMLTE 299

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
           G+G     TNDFV+SIW GPIIRAGNL+L+P +  E +KD+RTLI YGR++++NPD+V R
Sbjct: 300 GDGILEGVTNDFVFSIWKGPIIRAGNLSLNPAIVREYVKDDRTLIAYGRYFVSNPDIVDR 359

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           ++ GLPLN YD+  FY M+ EGY+DYPTY+EA+K G+
Sbjct: 360 VEKGLPLNNYDQPHFYTMTAEGYIDYPTYDEAIKAGY 396

>TBLA0E00660 Chr5 complement(130778..131965) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  475 bits (1222), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/391 (57%), Positives = 293/391 (74%), Gaps = 2/391 (0%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
            V++++ V L DT + +P +VG   LQHR VMP LTRMRA+ P NV + +WA EYY+QRS
Sbjct: 4   LVENYEAVPLKDTAIFKPTKVGVTNLQHRIVMPALTRMRASAPFNVLDSEWAAEYYDQRS 63

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQ 122
           + PGS+IITEG FI PQAGGYDNAPGI+ DE V  W+KIFK+IH+N SFV++QLWALGRQ
Sbjct: 64  KTPGSMIITEGAFIFPQAGGYDNAPGIYCDEHVHAWSKIFKKIHNNKSFVWLQLWALGRQ 123

Query: 123 SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSI 182
           +    + RDGLR DAPS   Y++EE K+ A +    QH +T+ +I+QY+++Y+ AA  SI
Sbjct: 124 APPSCMARDGLRLDAPSGDLYLNEEFKKSAQEVGIKQHEMTEADIEQYVEDYITAAKLSI 183

Query: 183 KAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVG 242
           +AGADGVEIH ANGYLLNQFLDP +N RTD YGGS+ENRARF               +VG
Sbjct: 184 EAGADGVEIHCANGYLLNQFLDPSSNQRTDRYGGSIENRARFPLEVVDRVIEAIGAHRVG 243

Query: 243 IRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRAN-EGQQLAYIHLVEPRVTDPFLTEG 301
           IRFSPYGT+G+M+GG+NP I+AQYAYI+G+L++RA  +  ++AYIHLVEP  TD  L EG
Sbjct: 244 IRFSPYGTYGSMSGGENPNILAQYAYIIGQLEKRAELQNNRIAYIHLVEPSTTDFTLEEG 303

Query: 302 EGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEML-KDNRTLIGYGRFWIANPDLVRR 360
            G +  G+NDF YSIW GPIIR G+LAL+P +  E+  KD+RTL+ +GR++I+NPD+V+R
Sbjct: 304 LGEFKDGSNDFAYSIWKGPIIRTGSLALNPKLVKELCEKDDRTLVAFGRYFISNPDIVQR 363

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEE 391
           +  GLPL +YD  TFY    EGY+DYP YE+
Sbjct: 364 MAKGLPLTQYDISTFYTPGKEGYIDYPNYED 394

>NCAS0D04260 Chr4 complement(805403..806662) [1260 bp, 419 aa] {ON} 
          Length = 419

 Score =  471 bits (1213), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 286/389 (73%)

Query: 12  LGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIIT 71
           L  TNL +P+++G+M+L HRAVM PLTR+RA +PG +PN + + EYY+QRS+ PG+ +I+
Sbjct: 30  LKGTNLFKPMKLGNMELDHRAVMAPLTRLRAIYPGQIPNVELSSEYYDQRSKRPGTFLIS 89

Query: 72  EGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRD 131
           E   ISPQAGG D+ PGIW+D QV  W+K+ K++HDN S++++Q WALGR      L RD
Sbjct: 90  EAAVISPQAGGIDDVPGIWNDTQVEAWSKVIKKVHDNGSYIFIQFWALGRHGLPGNLKRD 149

Query: 132 GLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADGVEI 191
           GLRY + SD  Y+    KE A  +NN QHGLTK EIK  I+++  A+ NSIKAGADGVEI
Sbjct: 150 GLRYISASDDVYIDNAHKEAAFYSNNRQHGLTKDEIKGIIQDFANASKNSIKAGADGVEI 209

Query: 192 HSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPYGTF 251
           HSA G+ LNQFLDP +N RTDEYGGS+ENRAR               KK+GIR +P+G +
Sbjct: 210 HSAFGFFLNQFLDPISNKRTDEYGGSIENRARIVLEVVNACIDAVGAKKIGIRLTPWGRY 269

Query: 252 GTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTND 311
             M+GG +P ++A +AY++GEL++R   G++LAY+HL EPRVTDPFL EG G    GTND
Sbjct: 270 LGMSGGSDPTLLATFAYLLGELEKRGRAGKRLAYVHLGEPRVTDPFLPEGTGMDMNGTND 329

Query: 312 FVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLKDGLPLNKYD 371
           FV+SIW G IIR+GNL LHP++  +M++++RTLI YGRFWI+NPDL  RL+ GLPLNKY+
Sbjct: 330 FVFSIWKGAIIRSGNLTLHPEIVKKMVENDRTLIAYGRFWISNPDLPDRLEGGLPLNKYN 389

Query: 372 RDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           R TF+  + EG  DYPTY EA+ LG+  +
Sbjct: 390 RHTFFGRTAEGLTDYPTYSEAVALGYKHE 418

>NCAS0C04110 Chr3 (838638..839804) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score =  468 bits (1205), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/390 (57%), Positives = 296/390 (75%), Gaps = 2/390 (0%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV+ FKP AL DT+L +PI+VG+ +LQ+R VM PLTRMRA  P +VPN +   EYY+Q
Sbjct: 1   MTFVQGFKPEALADTDLFKPIKVGNTELQNRIVMAPLTRMRA--PNHVPNTELVSEYYDQ 58

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  G++IITEG F SPQAGGY +APGI++ EQ+A+W KIF +IH+N SFV+ Q+W LG
Sbjct: 59  RSKRAGTMIITEGIFTSPQAGGYPDAPGIYTKEQIAEWKKIFAKIHENKSFVWAQMWVLG 118

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           RQS ADTL ++GLRYD+ +D  Y+ +E+KERA+K+NNPQHG+TK EIKQYIK+YVEA+ N
Sbjct: 119 RQSLADTLAKEGLRYDSATDDLYLDDERKERAIKSNNPQHGITKDEIKQYIKDYVEASKN 178

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVEIHSAN YLLNQFLD ++N RTDEYGGS+ENRARF               K
Sbjct: 179 AIAAGADGVEIHSANSYLLNQFLDSKSNNRTDEYGGSIENRARFTLEVVDAVVAAVGADK 238

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VG+RFSP+G +G M+GG NPL +A+Y+Y++GEL++RA EG+++AYIHLVEP   + +  +
Sbjct: 239 VGVRFSPWGMYGGMSGGANPLTLAEYSYVIGELEKRATEGKRIAYIHLVEPCPPNVWDDK 298

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
            E     G+NDF+YSIW G +IR G L   P+ A ++  +  TL GYGR +I+NPDL  R
Sbjct: 299 PELRNTKGSNDFIYSIWEGIVIRTGELGDKPENARKIAANPNTLAGYGRMYISNPDLPDR 358

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYE 390
           L++G PLN ++RD FY    +GY+DYPTY+
Sbjct: 359 LENGWPLNDFERDLFYASGAKGYIDYPTYK 388

>KNAG0J00330 Chr10 complement(52717..53913) [1197 bp, 398 aa] {ON} 
          Length = 398

 Score =  466 bits (1198), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/397 (55%), Positives = 283/397 (71%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M F+K  +P+A  DT L +PI+VG++QL+HRAVM PL+RMRA +PG VPN+  A EYY+Q
Sbjct: 1   MAFLKGVEPLAWKDTKLFEPIKVGNVQLEHRAVMAPLSRMRAEYPGLVPNRQLALEYYDQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+ PG+LI TE      QAGG+D+APGIW+ EQ+ +WTKIFKRIHDN  FV++QL + G
Sbjct: 61  RSKTPGTLIFTESVIPCAQAGGHDHAPGIWTKEQIDEWTKIFKRIHDNKCFVWLQLISQG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R+     L RD LR+DAPS G Y  E  +  A +  NP HGLTK E+KQYI +YV+AA N
Sbjct: 121 RRGSPANLKRDNLRFDAPSPGVYFDENSERAAKECGNPLHGLTKDEMKQYIADYVQAARN 180

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
           +I AGADGVE+H A G+LLNQFLDP  N RTDEYGG++ENR RF              +K
Sbjct: 181 AIGAGADGVEVHCATGFLLNQFLDPVTNKRTDEYGGTIENRIRFPLEVIDGIAEAIGWEK 240

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           +G+R SPY  F  M+G  +P ++A Y  ++GELQ+RAN G+  AY+H+VEPRV+ P    
Sbjct: 241 MGVRISPYSKFNGMSGSSDPTLLATYVLLLGELQKRANNGKPAAYVHVVEPRVSAPLADY 300

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRR 360
            + A   GTND++YS+W G +IRAGN  L      + L++NR+LI YGRF+IANPDLV R
Sbjct: 301 DDIADVTGTNDYIYSVWKGVVIRAGNFTLQEAETKKALENNRSLIAYGRFYIANPDLVER 360

Query: 361 LKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           L++GLPLNKYDR TFY  + EGY DYPT+EEA+  GW
Sbjct: 361 LREGLPLNKYDRSTFYTHTKEGYTDYPTFEEAINWGW 397

>AGR329C Chr7 complement(1346011..1347210) [1200 bp, 399 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YHR179W
           (OYE2) and YPL171C (OYE3)
          Length = 399

 Score =  440 bits (1131), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/389 (54%), Positives = 277/389 (71%), Gaps = 1/389 (0%)

Query: 12  LGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIIT 71
           L +T L +P++VG+  +QHR  + PLTR+R  +P ++P  D   EYY+QRS+ PG+L+IT
Sbjct: 11  LRNTALFKPLKVGNTTIQHRIALAPLTRLRTTNPEHIPT-DIVREYYDQRSKRPGTLVIT 69

Query: 72  EGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRD 131
           EGTF S    G ++ PGIWS EQ ++W KIFK IHDN SF +VQLW LG Q+    + ++
Sbjct: 70  EGTFPSASTAGMNDVPGIWSAEQASEWAKIFKVIHDNKSFAWVQLWVLGSQNDPSVIAKN 129

Query: 132 GLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADGVEI 191
           GLR D+ SD  Y S+  ++ A + N P   +TK +IK+YI+ YV AA  +I+AGADGVE+
Sbjct: 130 GLRNDSASDDWYPSDGVRDLAKQLNVPSRAITKDQIKEYIQIYVSAAKRAIEAGADGVEV 189

Query: 192 HSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPYGTF 251
           HSANGYLLNQFLD  +N RTDEYGGS+ENRARF              +KVG+RFSPYGTF
Sbjct: 190 HSANGYLLNQFLDSVSNKRTDEYGGSIENRARFTLEVLDALAEAVGPEKVGVRFSPYGTF 249

Query: 252 GTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTND 311
           G MAG  +P  VAQYAYI G+L++RA EG++LAYIH+VEPRVTDP + EG+  YN GTND
Sbjct: 250 GNMAGTVDPNTVAQYAYIAGQLEKRAAEGKRLAYIHVVEPRVTDPSVEEGQSVYNGGTND 309

Query: 312 FVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLKDGLPLNKYD 371
           F YS+W G I+RAG+ A H D A+   +  RT+I YGR++I+NPDL  RL+ GLPLN Y 
Sbjct: 310 FFYSVWKGIILRAGSYAHHLDAAVRDAELGRTVIVYGRYFISNPDLPDRLEKGLPLNNYR 369

Query: 372 RDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           R+ FY    EGY+DYP YEEA+  G+ +Q
Sbjct: 370 RELFYTNEAEGYIDYPVYEEAVAKGYKQQ 398

>TBLA0C07300 Chr3 complement(1778734..1779654) [921 bp, 306 aa] {ON}
           
          Length = 306

 Score =  413 bits (1062), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/306 (65%), Positives = 237/306 (77%)

Query: 95  VAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALK 154
           + +W KIF  IH N+SFV+ QLWALG  + A ++ RDGLRYD  +DG Y +++  + A +
Sbjct: 1   MTEWKKIFAAIHKNNSFVWPQLWALGWAADAKSMARDGLRYDGATDGVYSNDQYGKIAKE 60

Query: 155 ANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEY 214
            +   HGLTK +IKQYIK+YV AA   I AGADGVEIHSANGYLLNQFLD  +N RTDEY
Sbjct: 61  NDIKIHGLTKDDIKQYIKDYVTAAKKCIAAGADGVEIHSANGYLLNQFLDINSNKRTDEY 120

Query: 215 GGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQ 274
           GGS+ENRARF              +KVGIRFSPYGTF  MAGG NPL VAQ+AYI GEL+
Sbjct: 121 GGSIENRARFPLEVVDALIEAIGAEKVGIRFSPYGTFNDMAGGSNPLGVAQFAYITGELE 180

Query: 275 RRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVA 334
           +RA  G +LA+IHLVEPRVT+PFLTEG+G Y  GTNDFVYSIW G IIRAGNLALHP+VA
Sbjct: 181 KRAKAGNRLAFIHLVEPRVTNPFLTEGQGEYTDGTNDFVYSIWKGVIIRAGNLALHPEVA 240

Query: 335 IEMLKDNRTLIGYGRFWIANPDLVRRLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
            E +KD+ TL+GYGR WIANPDLV RL+ GLPLNKY+RD FY M+ EGY DYPTY+EA+K
Sbjct: 241 REFMKDDGTLLGYGRLWIANPDLVDRLEKGLPLNKYNRDLFYAMTSEGYFDYPTYDEAIK 300

Query: 395 LGWDKQ 400
           +GWDKQ
Sbjct: 301 MGWDKQ 306

>ZYRO0C11924g Chr3 (932751..933917) [1167 bp, 388 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179W OYE2
           Widely conserved NADPH oxidoreductase containing flavin
           mononucleotide (FMN) homologous to Oye3p with slight
           differences in ligand binding and catalytic properties
           may be involved in sterol metabolism
          Length = 388

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 264/389 (67%), Gaps = 16/389 (4%)

Query: 2   PFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQR 61
           P + D  PVAL  T L +PI+VG + L HR VM PLTR+RA  P  +P++DW   YY+QR
Sbjct: 10  PMLVD-NPVALRGTKLFKPIKVGGLVLNHRLVMAPLTRLRA--PNGIPHEDWMTTYYDQR 66

Query: 62  SQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGR 121
           S+  GSLIITEG+   PQ GG DNAPG+WS EQ   WTK+ +RIH N S+V++QLW++G 
Sbjct: 67  SKRTGSLIITEGSVPQPQFGGLDNAPGLWSPEQRRAWTKVIRRIHGNGSYVFIQLWSMGS 126

Query: 122 QSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNS 181
           Q+    L +DGL Y + +D  Y+SEE KE+ALKA NPQHGLT+ EI++Y+  +VEA+   
Sbjct: 127 QADPLILAKDGLPYVSATDETYVSEELKEKALKAGNPQHGLTQREIQEYVSGFVEASQRC 186

Query: 182 IKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKV 241
           I+ GADGVEIH+ANGYLLNQFLDP +N R D YGGS+ENR+RF               KV
Sbjct: 187 IEMGADGVEIHAANGYLLNQFLDPSSNKRVDTYGGSIENRSRFLLQVVDAVVDRVGSSKV 246

Query: 242 GIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEG 301
           GIR SP+  FG+M+    P + +QY +++G+L+ RA  G++LAY+H+V+P          
Sbjct: 247 GIRISPFCNFGSMSELDIPTLSSQYTHLLGQLEERARSGRRLAYVHIVDP---------- 296

Query: 302 EGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRL 361
              +    NDFVY++W G +IRAG LA  P V +++++++RT++ YGR++ +NPDLV R+
Sbjct: 297 ---HQRNLNDFVYTVWKGIVIRAGGLATRPQVGVKLVENDRTILSYGRYFTSNPDLVDRI 353

Query: 362 KDGLPLNKYDRDTFYRMSDEGYLDYPTYE 390
           ++G P   YD DTF      GY+DYP +E
Sbjct: 354 ENGWPFTPYDPDTFTSGGSGGYIDYPPWE 382

>TPHA0P01030 Chr16 (207281..208462) [1182 bp, 393 aa] {ON} 
          Length = 393

 Score =  398 bits (1022), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 200/399 (50%), Positives = 268/399 (67%), Gaps = 12/399 (3%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FVK+     L ++NL +PI VGD+ L  R  M PLTRMRA    +VP K+    YY Q
Sbjct: 1   MSFVKNNSNAFLKESNLFKPITVGDITLGQRISMSPLTRMRADPSNHVP-KEIVTTYYKQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           R++  G+LII+E TFIS  A GYD+APGI+S EQ+  W KI K +HD  SF + QLW+LG
Sbjct: 60  RAERKGTLIISEATFISEAATGYDHAPGIYSKEQIEAWKKIIKAVHDEGSFFFSQLWSLG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN-PQHGLTKGEIKQYIKEYVEAAV 179
            Q+  +++ + GL+Y APS+  +M E Q E+A K NN  QH +TK EIK  + +YV+AA 
Sbjct: 120 WQASPESIAKHGLQYLAPSESPFMDETQ-EKACKDNNVKQHAMTKEEIKSMVADYVQAAK 178

Query: 180 NSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXK 239
           N+I+AGADGVEIH+ANGYL NQFLDP +N RTDEYGGS+ENR RF               
Sbjct: 179 NAIEAGADGVEIHAANGYLPNQFLDPLSNRRTDEYGGSIENRCRFVLEIVDGVIEAVGAS 238

Query: 240 KVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLT 299
           KVGIR SPYGT+G+M G  +P ++A YA++VGEL++RA  G+++AYIH +EP  +D    
Sbjct: 239 KVGIRLSPYGTYGSMTGSADPTLLATYAFVVGELEKRAKSGKRMAYIHAIEPEKSDI--- 295

Query: 300 EGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDN-RTLIGYGRFWIANPDLV 358
             E   +L   +F++SIW G +IRA N+  + +   E + +N RT+I YG F+IANPDL+
Sbjct: 296 --EAGKSL---NFIFSIWEGVVIRAANMIQNFEKTKEFVDNNDRTIISYGSFFIANPDLI 350

Query: 359 RRLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
            RL+ GLP NK D   F+    EGY+DYP Y +A+KLG+
Sbjct: 351 DRLEKGLPFNKPDVSLFFTREKEGYIDYPVYADAVKLGY 389

>Kpol_370.4 s370 (5694..6863) [1170 bp, 389 aa] {ON} (5694..6863)
           [1170 nt, 390 aa]
          Length = 389

 Score =  383 bits (983), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/395 (47%), Positives = 258/395 (65%), Gaps = 10/395 (2%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           M FV+ + PV+   T++  PI+VG+MQL H  VM PLTRMR    GNVP KD   EYY+Q
Sbjct: 1   MGFVEGYIPVSYDGTSMFNPIKVGNMQLSHHVVMAPLTRMRVTRQGNVP-KDIMIEYYDQ 59

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RS+  GSLII E   IS +AGGYDN PG+WS EQ++QW KI   +H N SF++ QLWALG
Sbjct: 60  RSRREGSLIIGEAAIISAEAGGYDNIPGVWSGEQLSQWCKIIGVVHRNKSFIWPQLWALG 119

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVN 180
           R S+ + L R+G R+ +PS+  Y+  EQK  A++ +N  HGL+K E++QY  +Y+  A  
Sbjct: 120 RISFPEVLAREGYRFVSPSEEVYIDAEQKNEAIRCDNRLHGLSKLEMQQYKTDYINCAKK 179

Query: 181 SIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKK 240
            I  GADG+E+H A G LLNQFLDP +N R DEYGGS+ENR +F              ++
Sbjct: 180 LINIGADGIELHLAYGCLLNQFLDPISNKRLDEYGGSIENRCKFILEIIDGLIIEIGCRR 239

Query: 241 VGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTE 300
           VGIR SP+   G M+G  +P +++ Y Y++G L+ +   G+++AYIHLVEP         
Sbjct: 240 VGIRLSPFDESGGMSGDNDPTLLSTYMYLIGRLEEQGKMGERIAYIHLVEPSRNKKL--- 296

Query: 301 GEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNR-TLIGYGRFWIANPDLVR 359
            +G     +NDF+YSIW G +IR GNL  + + A   L+ ++ TLI YG+++I+NPDLV 
Sbjct: 297 -KGI----SNDFIYSIWKGIVIRCGNLIYNSNEAKMYLEKHKNTLIAYGKYFISNPDLVT 351

Query: 360 RLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALK 394
           RL+  L LNK+D  TFY  + +GY DY TYEE +K
Sbjct: 352 RLEKKLLLNKFDESTFYTSNSKGYTDYLTYEEEMK 386

>TBLA0D03340 Chr4 (832010..832879) [870 bp, 289 aa] {ON} 
          Length = 289

 Score =  314 bits (805), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 208/289 (71%)

Query: 112 VYVQLWALGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYI 171
           ++VQ++A+GR++   ++ RDGLRY+  S G ++ E  K+   K    QH LTK +I QYI
Sbjct: 1   MWVQIYAMGRRAPLASIKRDGLRYNVVSSGTWIDEGNKKELEKIGLVQHQLTKDDINQYI 60

Query: 172 KEYVEAAVNSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXX 231
           +++V  A N+I+ GADGVEIH+ANG+LLNQFLDP +N RTDEYGGS+ENRAR        
Sbjct: 61  QDFVNGAKNAIECGADGVEIHAANGFLLNQFLDPISNKRTDEYGGSIENRARIILEVVDA 120

Query: 232 XXXXXXXKKVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEP 291
                   KVGIRFSPY   G M+G  +P + A YAY+  +L++RA EG++LA+IH+ EP
Sbjct: 121 LVDAISEDKVGIRFSPYTDSGGMSGSWDPTVFAHYAYVFAQLEKRAQEGKRLAFIHIYEP 180

Query: 292 RVTDPFLTEGEGAYNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFW 351
            VT  ++ +G G Y  GT DF+YSI  G +IR GNL +HP+VA E LK   TL+GYGR++
Sbjct: 181 GVTANWVDDGTGTYVGGTTDFIYSIGKGTVIRTGNLTIHPEVAKEFLKQPNTLLGYGRYF 240

Query: 352 IANPDLVRRLKDGLPLNKYDRDTFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           I+NPDLV RL++GLPLN YDR TFY  +D+GY DYPTY+EA+KLGWDKQ
Sbjct: 241 ISNPDLVDRLENGLPLNSYDRSTFYTDADKGYTDYPTYKEAIKLGWDKQ 289

>TBLA0A04730 Chr1 complement(1173457..1174266) [810 bp, 269 aa] {ON}
           
          Length = 269

 Score =  284 bits (726), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 191/272 (70%), Gaps = 5/272 (1%)

Query: 128 LGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGAD 187
           + RDGLRYDAPS   ++ E+ + +  K    +H LT  +I+QYI +YV+AA NSI+ GAD
Sbjct: 1   MKRDGLRYDAPSFDLFIDEDTRVKLAKLGIERHTLTADDIRQYINDYVQAAKNSIECGAD 60

Query: 188 GVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSP 247
           G+EIH+AN YLLNQF+DP +N RTD+YGG++ENR+RF              +KV IRFSP
Sbjct: 61  GIEIHAANSYLLNQFIDPNSNNRTDKYGGTIENRSRFILEVVDAIVAAIGAEKVDIRFSP 120

Query: 248 YGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNL 307
           + +FG M+   +PLI++QY  ++G+L++RA + ++LAYIH+ EPR     +  GE +  +
Sbjct: 121 FHSFGGMSPEDDPLIISQYTCLIGQLEKRAQDVKRLAYIHIYEPRDN---IDVGELSEEV 177

Query: 308 GT--NDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLKDGL 365
            T   DFVYS+W G IIR  NL L P+V   +LK NRTL+GY R++++NPDLV RL++GL
Sbjct: 178 ETFPIDFVYSVWKGIIIRTSNLPLLPNVTKTVLKANRTLLGYRRYFLSNPDLVDRLENGL 237

Query: 366 PLNKYDRDTFYRMSDEGYLDYPTYEEALKLGW 397
           PLN YDR T +  +  GY+DYPTY+EALK+ W
Sbjct: 238 PLNNYDRATMFTQTKAGYIDYPTYDEALKMNW 269

>ZYRO0F16852g Chr6 complement(1402055..1403068) [1014 bp, 337 aa]
           {ON} similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 337

 Score =  259 bits (663), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 209/353 (59%), Gaps = 38/353 (10%)

Query: 12  LGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNK-DWAEEYYNQRSQYPGSLII 70
           L D N+  PI+VG ++  HRAVMPPL+RM      ++P + +   EYY  +SQ PG+L+I
Sbjct: 6   LRDPNIFNPIQVGHVRPLHRAVMPPLSRMSTID--SMPLQLESLPEYYGIKSQTPGTLVI 63

Query: 71  TEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGR 130
            E T +SP   G       W+ +++  W +IF++IH N+S+V+VQL   G          
Sbjct: 64  VESTLLSPPNNG--EVVKAWTPQEMEFWRQIFEQIHMNNSYVFVQLANWG---------- 111

Query: 131 DGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGE------IKQYIKEYVEAAVNSIKA 184
                 +P+D N ++E     +L AN    GL   +      + Q++++YV+AA N I A
Sbjct: 112 ------SPADANDLAESFGRVSLNANGTDSGLQGTDPSNQEFVDQFVRDYVQAAQNCILA 165

Query: 185 GADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIR 244
           GADGVEIH  NG LLNQFLDP++N R D+YGGS+ NRAR               ++VGI 
Sbjct: 166 GADGVEIHHVNGSLLNQFLDPQSNTRADDYGGSIGNRARLTLRVVEALANTIGVERVGIS 225

Query: 245 FSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGA 304
           FSPY      A   + L VAQYAYI+GEL+R + +G +LAY+HL EP V+     EG+  
Sbjct: 226 FSPY------ASSSHFLSVAQYAYILGELERSSQDGNRLAYVHLEEP-VSGSLPPEGQIG 278

Query: 305 YNLGTNDFVYSIWTGPIIRAGNLA----LHPDVAIEMLKDNRTLIGYGRFWIA 353
            N G    +YSIW GP+IRAGNL+    LHP+V  +M K++RTL+  GRF+++
Sbjct: 279 PNQGAGSLIYSIWRGPVIRAGNLSSYPTLHPEVLEDMAKNDRTLVSDGRFFLS 331

>KAFR0I00110 Chr9 (21926..22549) [624 bp, 207 aa] {ON} 
          Length = 207

 Score =  248 bits (634), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 113/207 (54%), Positives = 151/207 (72%)

Query: 144 MSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADGVEIHSANGYLLNQFL 203
           M   ++E A  ANN QHGLTK EIK ++ ++  AA NS+KAGADGVE+HS  G++LNQFL
Sbjct: 1   MDPARQEIAFYANNQQHGLTKEEIKSFVADFANAAKNSVKAGADGVEVHSTFGFILNQFL 60

Query: 204 DPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPYGTFGTMAGGKNPLIV 263
           DP +N RTDEYGGS+ENR+RF              ++VG+R SP+ T+G M+GG++P ++
Sbjct: 61  DPASNKRTDEYGGSIENRSRFTLEVIDACIEAVGAERVGVRLSPWATYGAMSGGEDPTLL 120

Query: 264 AQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTNDFVYSIWTGPIIR 323
           A YA I+GEL++R   G  LAY+HL++PR+TDPF  EG+G Y  G NDF +SIW GPII+
Sbjct: 121 ATYANILGELEKRGKAGMCLAYVHLIKPRITDPFSPEGQGVYKNGNNDFAHSIWKGPIIK 180

Query: 324 AGNLALHPDVAIEMLKDNRTLIGYGRF 350
           +GNLAL+ +V  +M+KD RTLI YG F
Sbjct: 181 SGNLALNSEVVKDMVKDARTLISYGTF 207

>NDAI0A07930 Chr1 complement(1823416..1823859) [444 bp, 147 aa] {ON}
           
          Length = 147

 Score =  238 bits (607), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 131/147 (89%)

Query: 254 MAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTNDFV 313
           M+GG +P ++AQYAY++GEL++RA  G++LA++HLVEPRVT+PF+TEGEG YN GTNDF 
Sbjct: 1   MSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFMTEGEGEYNDGTNDFA 60

Query: 314 YSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLKDGLPLNKYDRD 373
           YSIW G IIRAGNLALHP+VA E++ ++RTL+GYGRF+IANPDLV RL  GLPLNKY+RD
Sbjct: 61  YSIWKGVIIRAGNLALHPEVARELVANDRTLLGYGRFFIANPDLVERLAKGLPLNKYNRD 120

Query: 374 TFYRMSDEGYLDYPTYEEALKLGWDKQ 400
           TFY M+ EGYLDYPTYEEALKLGWDKQ
Sbjct: 121 TFYAMTQEGYLDYPTYEEALKLGWDKQ 147

>ZYRO0G15444g Chr7 (1256468..1257487) [1020 bp, 339 aa] {ON} weakly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179W OYE2 Widely conserved NADPH oxidoreductase
           containing flavin mononucleotide (FMN) homologous to
           Oye3p with slight differences in ligand binding and
           catalytic properties may be involved in sterol
           metabolism
          Length = 339

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 168/345 (48%), Gaps = 65/345 (18%)

Query: 19  QPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFISP 78
           +PI V  ++L HR V  P    +  HP     K   E         PGSL+I  G F  P
Sbjct: 13  RPIAVDGLKLDHRLVRVP--GFQGKHP-FCEKKSMKE---------PGSLVIAGGIF--P 58

Query: 79  Q-----------AGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWA---LGRQSY 124
           Q               +     +S  Q+  W +  ++IH + SFV+VQL++   LG Q +
Sbjct: 59  QWDDRDDDDDIANIDDNQKYSGYSKLQMQVWKESCRKIHASGSFVFVQLFSIDKLGGQEF 118

Query: 125 ADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKA 184
           ++T   +GL                      +N  + LT+ EI+ YI  YV AA  S+  
Sbjct: 119 SETRNGEGL---------------------VDNFVNSLTREEIQLYIDAYVRAAKTSLMF 157

Query: 185 GADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIR 244
           GADGVE+H A GYLL+ FL+ + N R DEYGGS+ NRA+F               ++ I 
Sbjct: 158 GADGVELHGAAGYLLDGFLNAKTNRRADEYGGSIANRAKFILEVVDAIVKAIGSSRISIC 217

Query: 245 FSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGA 304
            SP          K+  +V QY+Y++G+L++RA  GQ+LAYIHL E  V    L E +  
Sbjct: 218 LSP--------SEKHISLVTQYSYLLGQLEKRAVWGQRLAYIHLEESPVD---LEEDQIR 266

Query: 305 YNLGTNDFVYSIWTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGR 349
              G++ FVYSIW G +IR      H ++  E+ K ++TLI Y R
Sbjct: 267 PFGGSHSFVYSIWRGIVIRG-----HSELTDELKKCDQTLIAYER 306

>TBLA0D03350 Chr4 (835570..836055) [486 bp, 161 aa] {ON}  OYE
           family; probable pseudogene; frameshifts relative to
           other OYE gene family members
          Length = 161

 Score =  145 bits (365), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 102/153 (66%), Gaps = 2/153 (1%)

Query: 1   MPFVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQ 60
           MPF  +FKPV+L  T L +P++VG   + HRA++PPL +MRA    ++ N++ + EY+ Q
Sbjct: 1   MPFNTEFKPVSLKHTTLFKPMKVGKTMVLHRAIIPPLNKMRADPETHILNEELSIEYHGQ 60

Query: 61  RSQYPGSLIITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALG 120
           RSQ PG++IITE   ISP+AGGY  +P I+S  Q+  W K F +IH+N SF +VQL+ALG
Sbjct: 61  RSQSPGTMIITEPGNISPEAGGYAGSPVIYSKVQMEVWQKFFSKIHENKSFAWVQLYALG 120

Query: 121 RQSYADTLGRDGLRYDAPSDGNYMSE--EQKER 151
            Q+    L  +G +Y + S G Y+ E  E+K R
Sbjct: 121 SQASPKFLKANGYKYVSASAGAYIDEIFEKKLR 153

>Smik_6.368 Chr6
           (596883..597008,597012..597242,597246..597401,
           597415..597468,597472..597489,597493..597612,
           597616..597696,597695..597847,597849..597893) [984 bp,
           328 aa] {OFF} YPL171C (PSEUDO)
          Length = 328

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 167/366 (45%), Gaps = 39/366 (10%)

Query: 30  HRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFISPQAGGYDNAPGI 89
           H AV  PLT M+  H GN PNK  A  Y+ Q               +  +   Y  +   
Sbjct: 1   HCAVRAPLTEMKGIHLGNAPNKKCAAVYHGQ---------------VMIEVISYPLSRLR 45

Query: 90  WSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRYDAPSDGNYMSEEQK 149
           W +E+++        IH   SF +V+    G   + +    +             S  + 
Sbjct: 46  WLNEKIS-----LLAIHFIRSFAWVEFLFYGWSIFPEYTSYETGCAKIVRLTECTSMLRS 100

Query: 150 ERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADGVEIHSANGYLLNQFLDPEANM 209
            R  +  +P+H L K ++  Y++ Y   ++N I  GAD VEI S N YLLN+FLD  ++ 
Sbjct: 101 TRGHEGQHPEHSLIKDDM-NYLENYTHVSMNFIAVGADTVEIDSVNEYLLNRFLDLNSSK 159

Query: 210 RTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPYGTFGTMAGGKNPLIVAQYAYI 269
           +TDEYG + ENR                  ++G++ SPY  F  +          +   I
Sbjct: 160 KTDEYGETTENRETIGLV------------RMGLKSSPYSGFQYVCWWIT-YFRPKNVSI 206

Query: 270 VGELQRRANEGQQLAYIHLVEPRVTDPFLTEGEGAYNLGTNDFVYSIWTGPIIRAGN-LA 328
           +G L++R N    LA++HLV+     P  ++ E      TN   +SIW G IIR  N  A
Sbjct: 207 LGGLEKRPNSIWLLAFVHLVD-LCHGPTASQSEDIPESTTN-LAHSIWKGLIIRTCNFFA 264

Query: 329 LHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRLKDGLPLNKYDRDTFYRMSDEGYLDYPT 388
           LH +VA E  KD   L  Y   +I+N DL  RL++ LPLNK      Y +S E   DY  
Sbjct: 265 LHLEVAGEQPKDPSRLTSYNILFISNFDLTNRLEESLPLNK--AGLHYTVSAEDCTDYSN 322

Query: 389 YEEALK 394
           Y+EA++
Sbjct: 323 YDEAIE 328

>NDAI0C04500 Chr3 complement(1020217..1020462) [246 bp, 81 aa] {ON} 
          Length = 81

 Score =  111 bits (278), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/70 (68%), Positives = 62/70 (88%)

Query: 240 KVGIRFSPYGTFGTMAGGKNPLIVAQYAYIVGELQRRANEGQQLAYIHLVEPRVTDPFLT 299
           K GIR SPYGTFGTM+GG +P ++AQYAY++GEL++RA  G++LA++HLVEPRVT+PF+T
Sbjct: 11  KFGIRLSPYGTFGTMSGGADPTLLAQYAYVLGELEKRAKAGKRLAFVHLVEPRVTNPFMT 70

Query: 300 EGEGAYNLGT 309
           EGEG YN GT
Sbjct: 71  EGEGEYNDGT 80

>KAFR0B04485 Chr2 (930962..931780) [819 bp, 272 aa] {ON}
          Length = 272

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 149/342 (43%), Gaps = 84/342 (24%)

Query: 9   PVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSL 68
           P  L DTNL + + +G  ++ HR ++P   R+   H             ++ +S  PG+L
Sbjct: 9   PEQLRDTNLTESLCIGPYEILHR-IVPSTKRVNYNHLCQ----------FDLKSNRPGTL 57

Query: 69  IITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTL 128
           II       P +   +N   I    QV            N SF+++ +            
Sbjct: 58  IINP----IPPSCTLENLKNIVEQVQV------------NGSFIWISV------------ 89

Query: 129 GRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADG 188
                     +D N M+ +Q   +++                ++E V   +  +K   +G
Sbjct: 90  ---EFSISGVADFNGMTRDQIYTSIRK---------------VQEQVSVIMEHVKP--NG 129

Query: 189 VEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARFXXXXXXXXXXXXXXKKVGIRFSPY 248
           +EI  A   +++Q L    N RTDE+GGS++NR+                + + ++ +P+
Sbjct: 130 IEI-DATCDVISQSLHSMKNSRTDEFGGSIQNRSCLLMTIIKELLKVVPSQVLSVKVNPF 188

Query: 249 GTFGTMAGGKNPLIVAQYAYIVGELQ--RRANEGQQLAYIHLVEPRVTDPFLTEGEGAYN 306
               T     +P+ +A+YAYI GEL+  RR N G  +++IHL EP             +N
Sbjct: 189 QDLET-----DPICLAEYAYIFGELESWRRTN-GITISFIHLEEP------------LHN 230

Query: 307 LG-TNDFVYSIWTGPIIRAGNLA-LHPDVAIEMLKDNRTLIG 346
              +N+FV+++W G ++R GN   +H     +++K+++TLI 
Sbjct: 231 FDVSNNFVHAVWKGVVVREGNFRDIH--TIKDLMKNDKTLIA 270

>SAKL0C01738g Chr3 complement(147860..149149) [1290 bp, 429 aa] {ON}
           conserved hypothetical protein
          Length = 429

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 103/222 (46%), Gaps = 23/222 (10%)

Query: 17  LLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFI 76
           L  P+ V  +   +R  + P+    + +   +P    A  Y    ++ PG +II E T I
Sbjct: 44  LFSPLTVRSLTFPNRIGVSPMCTYSSDN--YIPTLYHAIHYGAMAARGPG-MIIVEATAI 100

Query: 77  SPQAGGYDNAPGIWSDEQV-AQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRY 135
                   N  GIW+++Q  A + +I +  H  +  + +QL   GR++    L +   R 
Sbjct: 101 DQPGAVSPNDLGIWTEKQAHAHYKQIVEFAHSQNCAIGLQLSHGGRKAGGAALYKHLERT 160

Query: 136 DAPSDGNYMSEEQKERALKANNP------------QHGLTKGEIKQYIKEYVEAAVNSIK 183
               +G +         L A +P             H LT+ EI   ++++  AA  + +
Sbjct: 161 LTKEEGGWPGN------LVAPSPGAFRPGYAYSGRPHELTRCEIHDLVRKWGHAAKLAAE 214

Query: 184 -AGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARF 224
            A  D VEIH+A+GYL+++F    +N R DEYGGS ENR RF
Sbjct: 215 IARYDFVEIHAAHGYLISEFYSATSNKRKDEYGGSFENRTRF 256

>KAFR0D04090 Chr4 (808332..809477) [1146 bp, 381 aa] {ON} Anc_1.53
          Length = 381

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 96/210 (45%), Gaps = 30/210 (14%)

Query: 17  LLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFI 76
           L +P+++  + + +R  + P+    A    N    D+ + +Y   +     LII E   +
Sbjct: 41  LFKPLKIRSLVIPNRIAVAPMCLYSA---DNFKPTDFHQVHYGSLASRGPGLIIVECAAV 97

Query: 77  SPQAGGYDNAPGIWSDEQ-VAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRY 135
                   N  G+W+++Q +    KI    H  +S + +QL            G+  + Y
Sbjct: 98  EKNGRITMNDLGLWTEDQAIKHREKIVNFAHSQNSIIGIQL------------GQYNVSY 145

Query: 136 DAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIK-AGADGVEIHSA 194
           +        SE  +E         H L+  EIKQ IK++ +A+  +IK AG D +EI + 
Sbjct: 146 ETGQ-----SEVIRE--------PHNLSSAEIKQMIKQWGDASELAIKTAGYDFIEIQAT 192

Query: 195 NGYLLNQFLDPEANMRTDEYGGSVENRARF 224
           +G++ + F     N R DEYGGS ENR RF
Sbjct: 193 HGHMPDTFCSSLLNKRNDEYGGSFENRTRF 222

>CAGL0K05687g Chr11 (555370..556536) [1167 bp, 388 aa] {ON} similar
           to uniprot|Q03558 Saccharomyces cerevisiae YHR179w OYE2
           or uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3
          Length = 388

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (44%), Gaps = 22/210 (10%)

Query: 17  LLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFI 76
           L +P+++  +++ +R  + P+         N    D+   +Y   +     +II E + +
Sbjct: 42  LFKPLKIRALEIPNRIGVSPMCTYST---NNYMPTDFHLMHYGSLATRGPGIIIVECSAV 98

Query: 77  SPQAGGYDNAPGIWSDEQVAQ-WTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRY 135
           S       N  GIW+ EQ ++ ++KI K  H  +  V  QL    R+   +         
Sbjct: 99  SEGTAVTVNDMGIWNKEQASEHFSKIVKFAHSQNVIVGCQLGQFMRKVVQN--------- 149

Query: 136 DAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIK-AGADGVEIHSA 194
                   + E+ K   ++     H L+  EIK  ++++  AA  +++ A  D +EI + 
Sbjct: 150 --------VDEDNKAHNVEVGKEAHDLSTEEIKTIVEQWGTAAKLAVEVAKYDFIEIQAG 201

Query: 195 NGYLLNQFLDPEANMRTDEYGGSVENRARF 224
            G++ N+F     N R DEYGGS ENR R 
Sbjct: 202 KGHITNEFFSRLTNKRKDEYGGSFENRIRI 231

>KLLA0C01672g Chr3 complement(131543..132772) [1230 bp, 409 aa] {ON}
           weakly similar to uniprot|P41816 Saccharomyces
           cerevisiae YPL171C OYE3 Widely conserved NADPH
           oxidoreductase containing flavin mononucleotide (FMN)
          Length = 409

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 104/228 (45%), Gaps = 9/228 (3%)

Query: 3   FVKDFKPVALGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
           F++ F  +      L QP+ +  M + +R    P+    + +     NK     Y +  S
Sbjct: 26  FLRYFDGIERDAPLLFQPLTIRGMTISNRVGTSPMCTYSSEN--FEANKYHLVHYGSISS 83

Query: 63  QYPGSLIITEGTFISPQAGGYDNAPGIWSDEQ-VAQWTKIFKRIHDNDSFVYVQLWALGR 121
             PG L+I E + I        N  G+++DEQ +     I    H ++  + VQL   GR
Sbjct: 84  SGPG-LVIVESSAIDQIGASSPNDLGLFTDEQAITHKENIVDWAHVHNIKIGVQLGHAGR 142

Query: 122 Q-SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNP---QHGLTKGEIKQYIKEY-VE 176
           + S A  L  +   Y    +G ++ +      +  ++     + LT  +I++ IK+Y + 
Sbjct: 143 KASLASPLNGELGVYVPNEEGGWLDKLVAPSTVPFDDSGVIPNELTLAQIEKTIKQYGIS 202

Query: 177 AAVNSIKAGADGVEIHSANGYLLNQFLDPEANMRTDEYGGSVENRARF 224
           A +   KAG D VEIH+  GYL  QF    AN R D YGG  ENR +F
Sbjct: 203 AKLAVEKAGYDFVEIHAGYGYLPCQFYTATANKRNDRYGGPFENRIKF 250

>Kpol_2000.91 s2000 (205107..206255) [1149 bp, 382 aa] {ON}
           (205107..206255) [1149 nt, 383 aa]
          Length = 382

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 99/201 (49%), Gaps = 24/201 (11%)

Query: 17  LLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFI 76
           L + +++  +   +R  + P+    + +  N P  D+ + +Y   +     +I+ E T +
Sbjct: 39  LFESLKIRGLTFPNRIGVSPMCTYSSDN--NEPT-DFHQVHYGAWATRGCGMIVVECTGV 95

Query: 77  SPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGRDGLRYD 136
            P      N  G+WS  Q    TK F++I +   F + Q   +G Q     LG  GL+ D
Sbjct: 96  DPDGLTSPNDLGLWSKHQA---TKHFQKIVE---FAHSQNTNIGIQ-----LGHYGLKKD 144

Query: 137 APSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIK-AGADGVEIHSAN 195
             +    M++E  E++L      H  TK  I+  +K++  AA  ++  A  D +EI + +
Sbjct: 145 ITA----MADE--EQSLYR---PHEYTKKMIQDIVKKWGHAAKLAVNNAHYDFIEIQAGH 195

Query: 196 GYLLNQFLDPEANMRTDEYGG 216
           G+L+++F+  E NMR DEYGG
Sbjct: 196 GHLISEFMSCEKNMRDDEYGG 216

>Kwal_47.17519 s47 (437989..438186) [198 bp, 65 aa] {ON} YHR179W
           (OYE2) - NAPDH dehydrogenase (old yellow enzyme),
           isoform 2 [contig 207] FULL
          Length = 65

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 37/55 (67%)

Query: 106 HDNDSFVYVQLWALGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANNPQH 160
           H+N+S+  VQLW L R+++ D L R+ LRY+  S+  YM +  K+ A++ +N QH
Sbjct: 8   HENESYTGVQLWVLDREAFPDFLERNDLRYNFASEEVYMDDFIKKTAMECDNRQH 62

>TPHA0B04740 Chr2 (1116411..1117592) [1182 bp, 393 aa] {ON} Anc_1.53
          Length = 393

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 87/216 (40%), Gaps = 27/216 (12%)

Query: 12  LGDTNLLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIIT 71
           L    L  P+ + D    +R  + P+    +    N    ++ + +Y   +     +II 
Sbjct: 37  LAPPKLFHPLAIRDTVFPNRIGVSPMCTYSS---NNHEPTEFHQVHYGAWASRGCGMIIV 93

Query: 72  EGTFISPQAGGYDNAPGIWSDEQV-AQWTKIFKRIHDNDSFVYVQLWALGRQSYADTLGR 130
           E T +        N  GIW+       + KI +  H  +  + VQL            G 
Sbjct: 94  ECTGVDEAGMISSNDLGIWNKYLADKHYEKIVEFAHSQNCKIGVQL------------GH 141

Query: 131 DGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIK-AGADGV 189
            G + +  + GN +    K   L          K  IK+ ++ +  AA  ++  A  D +
Sbjct: 142 CGCKKEMTATGNEIDSLYKPAELD---------KKSIKEIVRRWGHAANLAVNVAHYDFI 192

Query: 190 EIHSANGYLLNQFLDPEANMRTDEYGG-SVENRARF 224
           EI   +G L+++FL+   N RTDEYGG S  NR R 
Sbjct: 193 EIQGGHGNLISEFLNKNTNHRTDEYGGSSFANRCRL 228

>Skud_16.110 Chr16 complement(198564..198761,198765..198776) [210
           bp, 70 aa] {ON} YHR179W (REAL)
          Length = 70

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 25/35 (71%)

Query: 190 EIHSANGYLLNQFLDPEANMRTDEYGGSVENRARF 224
           +I  ANGYLLN+  DP +N R  EYGG +EN ARF
Sbjct: 31  KISGANGYLLNKLSDPYSNGRIVEYGGFIENGARF 65

>NDAI0F04370 Chr6 (1070446..1071753) [1308 bp, 435 aa] {ON} Anc_1.53
          Length = 435

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 17  LLQPIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRSQYPGSLIITEGTFI 76
           L QP ++ ++ + +R  + P+     +   N    ++ + +Y   S     LII E T +
Sbjct: 70  LFQPFKIKNLTVPNRIAVSPMCLYSTSKIENYKPTNFHQIHYGALSLKGPGLIIVECTAV 129

Query: 77  SPQAGGYDNAPGIWSDEQ-VAQWTKIFKRIHDNDSFVYVQLWAL-------GRQSYADTL 128
           SP+     N  G+WS EQ +    KI    HD +S + +QL  L       GR++  D+ 
Sbjct: 130 SPRGLITPNDLGLWSYEQAIEHRNKIVNFAHDCNSLIGIQLGYLDNLHVGEGRETKQDST 189

Query: 129 GRDGL 133
             D L
Sbjct: 190 SFDDL 194

>Skud_16.109 Chr16 complement(198429..198530) [102 bp, 34 aa] {ON}
           YHR179W (REAL)
          Length = 34

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 345 IGYGRFWIANPDLVRRLKDGLPLNKYDRDTF 375
           IGYG  +I+N  LV RL+ GL LNK+DR T 
Sbjct: 1   IGYGMLFISNAGLVDRLRKGLLLNKHDRSTL 31

>Skud_16.111 Chr16 complement(198785..198808,198812..198886) [99 bp,
           33 aa] {ON} YPL171C (REAL)
          Length = 33

 Score = 38.5 bits (88), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 90  WSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQS 123
           WSDEQ+A W  IF   HD+ SF  V LW+L + S
Sbjct: 1   WSDEQLAGWKIIFLATHDSKSFARV-LWSLDQAS 33

>NDAI0C01760 Chr3 (384545..386515) [1971 bp, 656 aa] {ON} Anc_5.393
           YDR341C
          Length = 656

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 102 FKRIHDNDSFVYVQLWA----LGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN 157
           FKR+ D D    +++W     L  + Y DT  R  ++YD  S  + +S+E  E+AL+   
Sbjct: 301 FKRMEDGDE-AALKIWKRFRELSIEKYIDTYARLNIQYDVYSGESQVSKESMEKALQIFK 359

Query: 158 PQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            + GLT   KG +   + ++ +     I   +DG  ++
Sbjct: 360 -EKGLTHEDKGAVLIDLTKFQKKLGKVIVQKSDGTTLY 396

>KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3.9
           YNL329C
          Length = 1025

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 7/86 (8%)

Query: 317 WTGPIIRAGNLALHPDVAIEMLKDNRTLIGYGRFWIANPDLVRRL-------KDGLPLNK 369
           W   +I A NL       ++   D  + I     ++ +P    +L       +  LPLNK
Sbjct: 368 WHNELIEADNLVWFKVEEVDFNNDENSTINKDAIFLVDPTEQTKLVTVNVVNERPLPLNK 427

Query: 370 YDRDTFYRMSDEGYLDYPTYEEALKL 395
            D  +FYR+      DY  +  A KL
Sbjct: 428 CDFLSFYRLDSVFQFDYDIFPYAKKL 453

>KLTH0E03564g Chr5 (320984..323116) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q05468 Saccharomyces cerevisiae YDR333C
           Hypothetical ORF
          Length = 710

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 7   FKPVALGDTNLLQ----PIEVGDMQLQHRAVMPPLTRMRAAHPGNVPNKDWAEEYYNQRS 62
           FK VALGD NLL     P    +++L+ +A    L RM+A   G V  K   +E  N  S
Sbjct: 532 FKEVALGDANLLNGLDFPEPCSEIELESKAY---LIRMKAIW-GGVEIKFLHDEILNILS 587

Query: 63  QYPGSLIITEGT 74
           +Y    I  E T
Sbjct: 588 EYKAGKIQLECT 599

>AFL206C Chr6 complement(46599..48545) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR341C and
           YHR091C (MSR1)
          Length = 648

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 102 FKRIHDNDSFVYVQLW----ALGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN 157
           FK++ D D    +++W     L  Q Y DT  R  ++YD  S  + + +E  E ALK   
Sbjct: 293 FKKMEDGDPEA-LKIWQKFRELSIQKYIDTYARLNIQYDVYSGESQVKKESMENALKLFQ 351

Query: 158 PQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            + GLT   KG I   + ++ +    +I   +DG  ++
Sbjct: 352 -EKGLTHEDKGAILIDLTKFNKKLGKTIVQKSDGTTLY 388

>Kpol_1059.40 s1059 (90774..92723) [1950 bp, 649 aa] {ON}
           (90774..92723) [1950 nt, 650 aa]
          Length = 649

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 9/98 (9%)

Query: 102 FKRIHDNDSFVYVQLWA----LGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN 157
           FKR+ D D    +++W     L  + Y DT  R  ++YD  S  + +S++   +A++  N
Sbjct: 294 FKRMEDGDEEA-LKIWKRFRELSIEKYIDTYARLNIKYDVYSGESQVSKDSMNKAIEIFN 352

Query: 158 PQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            + GLT   KG +   + ++ +    +I   +DG  ++
Sbjct: 353 -EKGLTHEDKGAVLIDLTKFNKKLGKTIVQKSDGTTLY 389

>ZYRO0A06710g Chr1 (548548..550488) [1941 bp, 646 aa] {ON} highly
           similar to uniprot|Q05506 Saccharomyces cerevisiae
           YDR341C Cytoplasmic arginyl-tRNA synthetase
          Length = 646

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 102 FKRIHDNDSFVYVQLWA----LGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALK 154
           FKR+ D D    ++LW     L  + Y  T  R  + YD  S  + +S+E  E+ALK
Sbjct: 291 FKRMEDGDP-AAIKLWQKFRELSIEKYIGTYARLNIHYDVYSGESQVSKESMEKALK 346

>Suva_2.511 Chr2 complement(909401..911224) [1824 bp, 607 aa] {ON}
           YDR341C (REAL)
          Length = 607

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 100 KIFKRIHDNDSFVYVQLWALGRQ----SYADTLGRDGLRYDAPSDGNYMSEEQKERALKA 155
           + FKR+ D D    +++W   R+     Y DT  R  ++YD  S  + +S+E   +A+  
Sbjct: 250 EFFKRMEDGDEEA-LKIWKRFREFSIDKYIDTYARLNIKYDVYSGESQVSKESMLKAIDL 308

Query: 156 NNPQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            N ++GLT   KG +   + ++ +    +I   +DG  ++
Sbjct: 309 FN-KNGLTHEDKGAVLIDLTKFNKKLGKAIVQKSDGTTLY 347

>KAFR0B02920 Chr2 complement(600352..615153) [14802 bp, 4933 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4933

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 50/128 (39%), Gaps = 3/128 (2%)

Query: 69   IITEGTFISPQAGGYDNAPGIWSDEQVAQWTKIFKRIHDNDSFVYVQLWALGRQSYADTL 128
            I++   +   + GG D   GI S   +  W +     +D  S  Y  L       + DTL
Sbjct: 1587 IVSFSEWFGKKFGGGDATNGIISLRDILAWVEFVNSTYDGTSNEYTLLVHGASMVFVDTL 1646

Query: 129  GRDGLRYDAPSDGNYMSEEQKERALKANNPQHGLTKGEIKQYIKEYVEAAVNSIKAGADG 188
            G +   Y A  + N    +++     +      LT     ++  E VE   NSI+ G   
Sbjct: 1647 GTNNTAYLAEDEENLNKLKRECIKQLSKFACQDLTPSIQSEFALEVVE---NSIQIGPFK 1703

Query: 189  VEIHSANG 196
            +  ++ NG
Sbjct: 1704 LSRYNKNG 1711

>NCAS0H01870 Chr8 complement(359166..361211) [2046 bp, 681 aa] {ON}
           Anc_5.393 YDR341C
          Length = 681

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 102 FKRIHDNDSFVYVQLWA----LGRQSYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN 157
           FKR+ D D    +++W     L  + Y DT  R  ++YD  S  + +S+E   +AL+   
Sbjct: 326 FKRMEDGDEEA-LKIWKRFRELSIEKYIDTYARLNIKYDVYSGESQVSKESMNKALEIFK 384

Query: 158 PQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            + GLT   KG +   + ++ +     I   +DG  ++
Sbjct: 385 -EKGLTHEDKGAVLIDLTKFQKKLGKVIVQKSDGTTLY 421

>Skud_4.610 Chr4 complement(1087702..1089525) [1824 bp, 607 aa] {ON}
           YDR341C (REAL)
          Length = 607

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 102 FKRIHDNDSFVYVQLWALGRQ----SYADTLGRDGLRYDAPSDGNYMSEEQKERALKANN 157
           FKR+ D D    +++W   R+     Y DT  R  ++YD  S  + +S+E   +A+   N
Sbjct: 252 FKRMEDGDEEA-LKIWKRFREFSIDKYIDTYARLNIKYDVYSGESQVSKESMLKAIDLFN 310

Query: 158 PQHGLT---KGEIKQYIKEYVEAAVNSIKAGADGVEIH 192
            + GLT   KG +   + ++ +    +I   +DG  ++
Sbjct: 311 -EKGLTHEDKGAVLIDLTKFNKKLGKAIVQKSDGTTLY 347

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,370,924
Number of extensions: 1993190
Number of successful extensions: 4334
Number of sequences better than 10.0: 108
Number of HSP's gapped: 4355
Number of HSP's successfully gapped: 108
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)