Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G03450singletonON1651657961e-110
KNAG0C05530singletonON2291411641e-13
YAR031W (PRM9)na 1ON2981521633e-13
ZYRO0C00242gsingletonON3561441609e-13
YAR033W (MST28)na 2ON2341511552e-12
Skud_13.255singletonON2481671518e-12
Suva_13.219singletonON1691611461e-11
Skud_3.71na 3ON2351611464e-11
Skud_1.79na 4ON2011461445e-11
Suva_1.100singletonON3231591475e-11
Skud_3.88singletonON2341481447e-11
Skud_1.87na 1ON2231561421e-10
NDAI0F04550singletonON2641461412e-10
Smik_1.90na 5ON2381541403e-10
Skud_1.82na 6ON2361681393e-10
KAFR0B03990singletonON2261491385e-10
YGL053W (PRM8)singletonON2371551361e-09
Suva_1.79na 7ON2481571361e-09
Kwal_26.7243singletonON366811371e-09
YGL051W (MST27)singletonON2341511351e-09
Skud_69.1singletonON2361591351e-09
Suva_3.29singletonOFF169831322e-09
TBLA0E04350singletonON230991333e-09
Smik_13.228singletonON2391661333e-09
Skud_41.1singletonON2321411324e-09
Smik_3.91na 3ON2391441315e-09
Skud_19.5singletonON2361431299e-09
KAFR0H03780singletonON2391691291e-08
NDAI0F04400singletonON215621281e-08
Skud_13.8na 8ON2331511281e-08
ZYRO0D00242gsingletonON3511451301e-08
Skud_1.86na 9ON1751351252e-08
ZYRO0E00330gsingletonON3571391282e-08
YAR028Wna 6ON2341531263e-08
KLTH0B10252gsingletonON2231571228e-08
NDAI0G02270singletonON2401491229e-08
YCR007Cna 3ON2391421221e-07
ZYRO0A13816gsingletonON2241391211e-07
NCAS0A10610singletonON3001501212e-07
SAKL0D15312gsingletonON1991351192e-07
Suva_8.398singletonON2981441202e-07
SAKL0H20614gsingletonON2361401192e-07
Kwal_27.10096singletonON340521193e-07
KAFR0C00130singletonON211601173e-07
YAR023Cna 4ON179561164e-07
ZYRO0D00154gsingletonON3561451184e-07
NCAS0I00840singletonON235511165e-07
Smik_1.105na 2ON200911157e-07
YAR027W (UIP3)na 5ON235561157e-07
ZYRO0A13948gsingletonON328901168e-07
ZYRO0B00154gsingletonON3601471159e-07
NDAI0G02310singletonON294591151e-06
YKL219W (COS9)singletonON4071431151e-06
ZYRO0E00132gsingletonON289531141e-06
SAKL0H20636gsingletonON2251441131e-06
Kwal_26.7673singletonON367471132e-06
Suva_2.722singletonOFF1431301074e-06
SAKL0C10978gsingletonON2581501104e-06
Smik_18.2singletonON2311441095e-06
KLTH0D00374gsingletonON373471105e-06
ZYRO0A00220gsingletonON3561501088e-06
NDAI0G01470singletonON239791078e-06
YBR302C (COS2)singletonON3791411088e-06
YML132W (COS3)na 8ON3791411088e-06
YNR075W (COS10)singletonON3741351061e-05
YNL336W (COS1)singletonON3811411052e-05
YGR295C (COS6)singletonON3811421053e-05
TBLA0E04360singletonON202731024e-05
YJR161C (COS5)singletonON3831411034e-05
YFL062W (COS4)singletonON3791451034e-05
Suva_1.97singletonOFF4845945e-05
SAKL0D01254gsingletonON195601006e-05
KLTH0D00242gsingletonON2261431016e-05
YDL248W (COS7)singletonON3831411017e-05
KLTH0B10230gsingletonON204621007e-05
TDEL0F02400singletonON375521018e-05
YHL044WsingletonON2351441008e-05
SAKL0C10956gsingletonON171140989e-05
Suva_12.273singletonON3791511001e-04
Skud_1.88na 2ON20457981e-04
NCAS0H00970singletonON25759981e-04
YHL043W (ECM34)singletonON17034972e-04
Skud_64.1singletonON327131982e-04
ZYRO0D00352gsingletonON356130982e-04
NCAS0I00280na 10ON22555962e-04
Smik_9.252singletonON391156973e-04
SAKL0C10868gsingletonON257161954e-04
Smik_3.4singletonON41551954e-04
YGL263W (COS12)singletonON38050954e-04
Skud_55.1singletonON28948954e-04
Kwal_49.19404singletonON20056936e-04
Kwal_56.22593singletonON20056936e-04
Smik_18.5singletonON416132947e-04
Skud_53.1singletonON292139938e-04
TDEL0B03200singletonON36149920.001
KLTH0G19580gsingletonON38147920.001
SAKL0D15290gsingletonON20471910.001
Smik_1.91na 6ON200152910.001
KLTH0C00264gsingletonON13882890.001
Smik_1.93singletonOFF139127890.001
Smik_16.6singletonON20447910.001
TBLA0B05730singletonON21153910.001
TDEL0A06960singletonON381164920.001
KLTH0B10296gsingletonON9252860.002
YHL048W (COS8)singletonON381146910.002
TBLA0E01640singletonON22955890.002
Suva_14.7singletonON14047870.002
Suva_1.98singletonOFF10529850.003
NCAS0C03030singletonON25288880.003
Smik_16.462singletonON383148890.003
Skud_1.80na 5ON243130880.003
TDEL0D00660singletonON36435890.003
KLLA0C19063gsingletonON20943870.003
Smik_9.248singletonON13247840.005
Smik_4.183singletonOFF10536830.006
KLLA0A11957gsingletonON20896850.007
Suva_16.529singletonOFF169144820.015
Kwal_26.9047singletonON11980800.017
Suva_1.95singletonOFF4024750.018
Suva_1.78singletonOFF5639760.021
TDEL0D00130singletonON153131800.024
TDEL0A01190singletonON36945820.024
Smik_9.244singletonON15163800.025
Skud_107.1singletonOFF19639810.026
Skud_8.1na 11ON38448820.026
Smik_1.89na 4ON19157790.041
KLTH0B10274gsingletonON16043760.074
TDEL0A01180singletonON22342760.10
Suva_11.1782.597ON64362770.11
KLTH0A00264gsingletonON8929720.15
Suva_1.93singletonOFF2727670.19
ZYRO0C18590gsingletonON34288730.31
Smik_17.8singletonOFF122127710.32
Skud_1.85singletonOFF3920660.35
ZYRO0F18700gsingletonON34252730.37
Smik_1.101na 9ON10428670.86
Skud_11.1singletonON29839690.98
KLTH0B06710gsingletonON39047691.0
Smik_1.98singletonOFF19489681.2
ZYRO0E00440gsingletonON35147681.4
YIR043CsingletonOFF23027681.4
YAR029Wna 9ON7431622.2
YKL048C (ELM1)2.597ON64062653.8
Smik_11.1singletonOFF16535625.8
TPHA0A040303.273ON105429646.3
KNAG0A05740na 12ON84947638.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03450
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03450 Chr7 complement(740617..741114) [498 bp, 165 aa] {ON}     311   e-110
KNAG0C05530 Chr3 complement(1073752..1074441) [690 bp, 229 aa] {...    68   1e-13
YAR031W Chr1 (186836..187732) [897 bp, 298 aa] {ON}  PRM9Pheromo...    67   3e-13
ZYRO0C00242g Chr3 (8037..9107) [1071 bp, 356 aa] {ON} weakly sim...    66   9e-13
YAR033W Chr1 (188107..188811) [705 bp, 234 aa] {ON}  MST28Putati...    64   2e-12
Skud_13.255 Chr13 complement(436932..437678) [747 bp, 248 aa] {O...    63   8e-12
Suva_13.219 Chr13 (356145..356654) [510 bp, 169 aa] {ON} YCR007C...    61   1e-11
Skud_3.71 Chr3 complement(107662..108369) [708 bp, 235 aa] {ON} ...    61   4e-11
Skud_1.79 Chr1 (152136..152741) [606 bp, 201 aa] {ON} YAR028W (R...    60   5e-11
Suva_1.100 Chr1 (165459..166430) [972 bp, 323 aa] {ON} YCR007C (...    61   5e-11
Skud_3.88 Chr3 (133816..134520) [705 bp, 234 aa] {ON} YCR007C (R...    60   7e-11
Skud_1.87 Chr1 (157764..158435) [672 bp, 223 aa] {ON}  YGL051W (...    59   1e-10
NDAI0F04550 Chr6 complement(1105670..1106464) [795 bp, 264 aa] {...    59   2e-10
Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W (R...    59   3e-10
Skud_1.82 Chr1 (154805..155515) [711 bp, 236 aa] {ON} YAR027W (R...    58   3e-10
KAFR0B03990 Chr2 complement(833771..834451) [681 bp, 226 aa] {ON}      58   5e-10
YGL053W Chr7 (402589..403302) [714 bp, 237 aa] {ON}  PRM8Pheromo...    57   1e-09
Suva_1.79 Chr1 complement(139959..140705) [747 bp, 248 aa] {ON} ...    57   1e-09
Kwal_26.7243 s26 (278708..279808) [1101 bp, 366 aa] {ON} YNL336W...    57   1e-09
YGL051W Chr7 (403687..404391) [705 bp, 234 aa] {ON}  MST27Putati...    57   1e-09
Skud_69.1 Chr69 (40..750) [711 bp, 236 aa] {ON} YHL044W (REAL)         57   1e-09
Suva_3.29 Chr3 complement(39749..40108,40112..40258) [507 bp, 16...    55   2e-09
TBLA0E04350 Chr5 (1106371..1107063) [693 bp, 230 aa] {ON}              56   3e-09
Smik_13.228 Chr13 complement(361792..362511) [720 bp, 239 aa] {O...    56   3e-09
Skud_41.1 Chr41 (3..701) [699 bp, 232 aa] {ON} YCR007C (REAL)          55   4e-09
Smik_3.91 Chr3 (124341..125060) [720 bp, 239 aa] {ON} YCR007C (R...    55   5e-09
Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)      54   9e-09
KAFR0H03780 Chr8 (718980..719699) [720 bp, 239 aa] {ON}                54   1e-08
NDAI0F04400 Chr6 (1077197..1077844) [648 bp, 215 aa] {ON}              54   1e-08
Skud_13.8 Chr13 (8824..9525) [702 bp, 233 aa] {ON} YHL044W (REAL)      54   1e-08
ZYRO0D00242g Chr4 (12246..13301) [1056 bp, 351 aa] {ON} weakly s...    55   1e-08
Skud_1.86 Chr1 (156935..157462) [528 bp, 175 aa] {ON} YAR028W (R...    53   2e-08
ZYRO0E00330g Chr5 (16701..17774) [1074 bp, 357 aa] {ON} weakly s...    54   2e-08
YAR028W Chr1 (184892..185596) [705 bp, 234 aa] {ON} Putative int...    53   3e-08
KLTH0B10252g Chr2 (863070..863741) [672 bp, 223 aa] {ON} some si...    52   8e-08
NDAI0G02270 Chr7 complement(508794..509516) [723 bp, 240 aa] {ON}      52   9e-08
YCR007C Chr3 complement(126011..126730) [720 bp, 239 aa] {ON} Pu...    52   1e-07
ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa] ...    51   1e-07
NCAS0A10610 Chr1 (2114082..2114984) [903 bp, 300 aa] {ON}              51   2e-07
SAKL0D15312g Chr4 (1275517..1276116) [600 bp, 199 aa] {ON} some ...    50   2e-07
Suva_8.398 Chr8 (714632..715528) [897 bp, 298 aa] {ON} YAR031W (...    51   2e-07
SAKL0H20614g Chr8 (1809584..1810294) [711 bp, 236 aa] {ON} some ...    50   2e-07
Kwal_27.10096 s27 (192352..193374) [1023 bp, 340 aa] {ON} YNL336...    50   3e-07
KAFR0C00130 Chr3 complement(15602..16237) [636 bp, 211 aa] {ON}        50   3e-07
YAR023C Chr1 complement(179281..179820) [540 bp, 179 aa] {ON} Pu...    49   4e-07
ZYRO0D00154g Chr4 (5577..6647) [1071 bp, 356 aa] {ON} weakly sim...    50   4e-07
NCAS0I00840 Chr9 complement(154605..155312) [708 bp, 235 aa] {ON}      49   5e-07
Smik_1.105 Chr1 (168370..168972) [603 bp, 200 aa] {ON}  YGL053W ...    49   7e-07
YAR027W Chr1 (183770..184477) [708 bp, 235 aa] {ON}  UIP3Putativ...    49   7e-07
ZYRO0A13948g Chr1 complement(1108143..1109129) [987 bp, 328 aa] ...    49   8e-07
ZYRO0B00154g Chr2 (3082..4164) [1083 bp, 360 aa] {ON} weakly sim...    49   9e-07
NDAI0G02310 Chr7 complement(517385..518269) [885 bp, 294 aa] {ON}      49   1e-06
YKL219W Chr11 (14485..15708) [1224 bp, 407 aa] {ON}  COS9Protein...    49   1e-06
ZYRO0E00132g Chr5 (2603..3472) [870 bp, 289 aa] {ON} weakly simi...    49   1e-06
SAKL0H20636g Chr8 (1810817..1811494) [678 bp, 225 aa] {ON} weakl...    48   1e-06
Kwal_26.7673 s26 complement(466671..467774) [1104 bp, 367 aa] {O...    48   2e-06
Suva_2.722 Chr2 complement(1264397..1264660,1264664..1264828) [4...    46   4e-06
SAKL0C10978g Chr3 complement(991612..992388) [777 bp, 258 aa] {O...    47   4e-06
Smik_18.2 Chr18 (1570..2265) [696 bp, 231 aa] {ON} YHL044W (REAL)      47   5e-06
KLTH0D00374g Chr4 complement(33818..34939) [1122 bp, 373 aa] {ON...    47   5e-06
ZYRO0A00220g Chr1 (9173..10243) [1071 bp, 356 aa] {ON} weakly si...    46   8e-06
NDAI0G01470 Chr7 (324888..325607) [720 bp, 239 aa] {ON}                46   8e-06
YBR302C Chr2 complement(810340..811479) [1140 bp, 379 aa] {ON}  ...    46   8e-06
YML132W Chr13 (7244..8383) [1140 bp, 379 aa] {ON}  COS3Protein i...    46   8e-06
YNR075W Chr14 (779916..781040) [1125 bp, 374 aa] {ON}  COS10Prot...    45   1e-05
YNL336W Chr14 (8330..9475) [1146 bp, 381 aa] {ON}  COS1Protein o...    45   2e-05
YGR295C Chr7 complement(1081584..1082729) [1146 bp, 381 aa] {ON}...    45   3e-05
TBLA0E04360 Chr5 (1107926..1108534) [609 bp, 202 aa] {ON}              44   4e-05
YJR161C Chr10 complement(742848..743999) [1152 bp, 383 aa] {ON} ...    44   4e-05
YFL062W Chr6 (6426..7565) [1140 bp, 379 aa] {ON}  COS4Protein of...    44   4e-05
Suva_1.97 Chr1 complement(160666..160809) [144 bp, 48 aa] {OFF} ...    41   5e-05
SAKL0D01254g Chr4 (95413..96000) [588 bp, 195 aa] {ON} some simi...    43   6e-05
KLTH0D00242g Chr4 complement(20418..21098) [681 bp, 226 aa] {ON}...    44   6e-05
YDL248W Chr4 (1802..2953) [1152 bp, 383 aa] {ON}  COS7Protein of...    44   7e-05
KLTH0B10230g Chr2 (861584..862198) [615 bp, 204 aa] {ON} some si...    43   7e-05
TDEL0F02400 Chr6 complement(444921..446048) [1128 bp, 375 aa] {O...    44   8e-05
YHL044W Chr8 (13565..14272) [708 bp, 235 aa] {ON} Putative integ...    43   8e-05
SAKL0C10956g Chr3 (990412..990927) [516 bp, 171 aa] {ON} some si...    42   9e-05
Suva_12.273 Chr12 complement(443438..444577) [1140 bp, 379 aa] {...    43   1e-04
Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W (R...    42   1e-04
NCAS0H00970 Chr8 complement(180888..181661) [774 bp, 257 aa] {ON}      42   1e-04
YHL043W Chr8 (14901..15413) [513 bp, 170 aa] {ON}  ECM34Putative...    42   2e-04
Skud_64.1 Chr64 (3..983) [981 bp, 327 aa] {ON}  YBR302C (REAL)         42   2e-04
ZYRO0D00352g Chr4 (26055..27125) [1071 bp, 356 aa] {ON} weakly s...    42   2e-04
NCAS0I00280 Chr9 (37829..38506) [678 bp, 225 aa] {ON}                  42   2e-04
Smik_9.252 Chr9 complement(407060..408235) [1176 bp, 391 aa] {ON...    42   3e-04
SAKL0C10868g Chr3 (986125..986898) [774 bp, 257 aa] {ON} weakly ...    41   4e-04
Smik_3.4 Chr3 (3476..4723) [1248 bp, 415 aa] {ON} YGL263W (REAL)       41   4e-04
YGL263W Chr7 (2790..3932) [1143 bp, 380 aa] {ON}  COS12Protein o...    41   4e-04
Skud_55.1 Chr55 complement(256..1125) [870 bp, 289 aa] {ON} YGR2...    41   4e-04
Kwal_49.19404 s49 (2490..3092) [603 bp, 200 aa] {ON} [contig 369...    40   6e-04
Kwal_56.22593 s56 complement(194937..195539) [603 bp, 200 aa] {O...    40   6e-04
Smik_18.5 Chr18 (7625..8875) [1251 bp, 416 aa] {ON}  YDL248W (REAL)    41   7e-04
Skud_53.1 Chr53 complement(1..876) [876 bp, 292 aa] {ON}  YGR295...    40   8e-04
TDEL0B03200 Chr2 (564384..565469) [1086 bp, 361 aa] {ON}               40   0.001
KLTH0G19580g Chr7 (1693206..1694351) [1146 bp, 381 aa] {ON} weak...    40   0.001
SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some ...    40   0.001
Smik_1.91 Chr1 (161600..162202) [603 bp, 200 aa] {ON} YAR028W (R...    40   0.001
KLTH0C00264g Chr3 (12563..12979) [417 bp, 138 aa] {ON} some simi...    39   0.001
Smik_1.93 Chr1 (162740..162757,162761..162979,162983..163018,163...    39   0.001
Smik_16.6 Chr16 (5125..5739) [615 bp, 204 aa] {ON} YGL263W (REAL)      40   0.001
TBLA0B05730 Chr2 (1355413..1356048) [636 bp, 211 aa] {ON}              40   0.001
TDEL0A06960 Chr1 (1219819..1220964) [1146 bp, 381 aa] {ON}             40   0.001
KLTH0B10296g Chr2 (867082..867360) [279 bp, 92 aa] {ON} conserve...    38   0.002
YHL048W Chr8 (6401..7546) [1146 bp, 381 aa] {ON}  COS8Nuclear me...    40   0.002
TBLA0E01640 Chr5 (395468..396157) [690 bp, 229 aa] {ON}                39   0.002
Suva_14.7 Chr14 (7591..8013) [423 bp, 140 aa] {ON} YJR161C (REAL)      38   0.002
Suva_1.98 Chr1 complement(160845..161072,161076..161162) [315 bp...    37   0.003
NCAS0C03030 Chr3 (596013..596771) [759 bp, 252 aa] {ON}                39   0.003
Smik_16.462 Chr16 complement(798062..799213) [1152 bp, 383 aa] {...    39   0.003
Skud_1.80 Chr1 (152939..152944,152948..153196,153443..153919) [7...    39   0.003
TDEL0D00660 Chr4 complement(115547..116641) [1095 bp, 364 aa] {O...    39   0.003
KLLA0C19063g Chr3 complement(1692492..1693121) [630 bp, 209 aa] ...    38   0.003
Smik_9.248 Chr9 complement(405227..405625) [399 bp, 132 aa] {ON}...    37   0.005
Smik_4.183 Chr4 (337090..337404) [315 bp, 105 aa] {OFF} YAR023C ...    37   0.006
KLLA0A11957g Chr1 (1041208..1041834) [627 bp, 208 aa] {ON} conse...    37   0.007
Suva_16.529 Chr16 complement(913015..913104,913108..913224,91322...    36   0.015
Kwal_26.9047 s26 (1053474..1053833) [360 bp, 119 aa] {ON} YHL048...    35   0.017
Suva_1.95 Chr1 complement(158136..158255) [120 bp, 40 aa] {OFF} ...    33   0.018
Suva_1.78 Chr1 complement(138943..139005,139009..139113) [168 bp...    34   0.021
TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON}                  35   0.024
TDEL0A01190 Chr1 complement(200994..202103) [1110 bp, 369 aa] {O...    36   0.024
Smik_9.244 Chr9 complement(403860..404315) [456 bp, 151 aa] {ON}...    35   0.025
Skud_107.1 Chr107 (3..590) [588 bp, 196 aa] {OFF} YKL219W (HSP)        36   0.026
Skud_8.1 Chr8 (1116..2270) [1155 bp, 384 aa] {ON} YHL048W (REAL)       36   0.026
Smik_1.89 Chr1 (159430..160005) [576 bp, 191 aa] {ON} YAR027W (R...    35   0.041
KLTH0B10274g Chr2 (865279..865761) [483 bp, 160 aa] {ON} conserv...    34   0.074
TDEL0A01180 Chr1 complement(200029..200700) [672 bp, 223 aa] {ON}      34   0.10 
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    34   0.11 
KLTH0A00264g Chr1 complement(21453..21722) [270 bp, 89 aa] {ON} ...    32   0.15 
Suva_1.93 Chr1 complement(157916..157996) [81 bp, 27 aa] {OFF}  ...    30   0.19 
ZYRO0C18590g Chr3 complement(1460662..1461690) [1029 bp, 342 aa]...    33   0.31 
Smik_17.8 Chr17 complement(5956..6321) [366 bp, 122 aa] {OFF} YJ...    32   0.32 
Skud_1.85 Chr1 (156117..156233) [117 bp, 39 aa] {OFF} YGL053W (HSP)    30   0.35 
ZYRO0F18700g Chr6 complement(1550815..1551843) [1029 bp, 342 aa]...    33   0.37 
Smik_1.101 Chr1 (166879..167193) [315 bp, 104 aa] {ON} YAR027W (...    30   0.86 
Skud_11.1 Chr11 (2..898) [897 bp, 298 aa] {ON}  YKL219W (REAL)         31   0.98 
KLTH0B06710g Chr2 (538970..540142) [1173 bp, 390 aa] {ON} weakly...    31   1.0  
Smik_1.98 Chr1 (165490..165567,165571..165675,165679..165780,165...    31   1.2  
ZYRO0E00440g Chr5 (28214..29269) [1056 bp, 351 aa] {ON} weakly s...    31   1.4  
YIR043C Chr9 complement(437043..437735) [693 bp, 230 aa] {OFF} P...    31   1.4  
YAR029W Chr1 (186321..186545) [225 bp, 74 aa] {ON} Member of DUP...    28   2.2  
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    30   3.8  
Smik_11.1 Chr11 (1..498) [498 bp, 165 aa] {OFF} YBR302C (HSP)          28   5.8  
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    29   6.3  
KNAG0A05740 Chr1 (857368..859917) [2550 bp, 849 aa] {ON}               29   8.2  

>KNAG0G03450 Chr7 complement(740617..741114) [498 bp, 165 aa] {ON} 
          Length = 165

 Score =  311 bits (796), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 150/165 (90%), Positives = 150/165 (90%)

Query: 1   MSVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYV 60
           MSVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHH               YV
Sbjct: 1   MSVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHRRVIVSIFINISIFIYV 60

Query: 61  FMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD 120
           FMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD
Sbjct: 61  FMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD 120

Query: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSHI 165
           QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSHI
Sbjct: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSHI 165

>KNAG0C05530 Chr3 complement(1073752..1074441) [690 bp, 229 aa] {ON}
           
          Length = 229

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 67/141 (47%), Gaps = 1/141 (0%)

Query: 22  IILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGE-LFGTICGGYCL 80
           I+LPRD+++SK  H+ +E +H                   +   +T E +        C 
Sbjct: 16  IVLPRDIYKSKTRHYIHELLHISYFKIGVLIYVLFLTSTVLMVQDTREYVLSAFMIIICA 75

Query: 81  VWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGL 140
           V  + ++++    ++L   F    ++  +  V++ RPS D ++W+A+A  +N+  Y    
Sbjct: 76  VGAVAIVVFIFRYHYLIRVFNSNTKILFLGEVVKHRPSLDPESWNAIADRMNQQFYSTEE 135

Query: 141 WNTPYCLYSGKQAYGMFKSWL 161
           W+TPY  Y G+     F+S++
Sbjct: 136 WSTPYYFYDGQSCLEFFRSFV 156

>YAR031W Chr1 (186836..187732) [897 bp, 298 aa] {ON}
           PRM9Pheromone-regulated protein with 3 predicted
           transmembrane segments and an FF sequence, a motif
           involved in COPII binding; member of DUP240 gene family
          Length = 298

 Score = 67.4 bits (163), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 9/152 (5%)

Query: 14  DDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXY-VFMTNSETGE 69
           D+PS   +++ + LP+D+F S  ++W YE   H                 VF  N+E   
Sbjct: 78  DEPSAYLIEKNVALPKDIFGSYLSYWIYEVTRHKAAVILLVLIVTSILLLVFFYNTEFCV 137

Query: 70  LFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAY 129
            F  +   +C   T  V+I  S     R       ++ L++ +I  +P+   K W  + Y
Sbjct: 138 AFEILLFSFCFPGTCMVVIAFSEPIGDREF-----KVKLLMEIITRKPAVKGKEWRTITY 192

Query: 130 SLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
            +N+ L++ GLW+TPY  Y  +  +  F S +
Sbjct: 193 KMNQYLFDHGLWDTPYYFYRDEDCHRYFLSLI 224

>ZYRO0C00242g Chr3 (8037..9107) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 66.2 bits (160), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 62/144 (43%), Gaps = 13/144 (9%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+ +LP+D+FR+  T  FYE   H                   TN     +   I G   
Sbjct: 8   QKPVLPKDLFRNGLTWMFYEMSKHRFPWVISCLCLVAGWVAAQTNFICENMLAMITGA-- 65

Query: 80  LVWTLGVLIYTS----SKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
            +W L +L+  S    SK H +N  EL  Q      V+ + P  D + WD +A  LN   
Sbjct: 66  -LWMLALLLPFSWLHNSKLHPKNMTELVQQ------VLESNPGLDIEKWDEIANRLNSSF 118

Query: 136 YERGLWNTPYCLYSGKQAYGMFKS 159
           Y+   WNTPY  Y G+    +FK+
Sbjct: 119 YQEHFWNTPYFFYDGQGLQLVFKA 142

>YAR033W Chr1 (188107..188811) [705 bp, 234 aa] {ON}  MST28Putative
           integral membrane protein, involved in vesicle
           formation; forms complex with Mst27p; member of DUP240
           gene family; binds COPI and COPII vesicles
          Length = 234

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 8/151 (5%)

Query: 11  GSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSET 67
            + ++PS   +++ + LP+D+FRS  ++W YE   +                +   N   
Sbjct: 13  DTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNE 72

Query: 68  GELFGTICGGYC-LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDA 126
             +F +    +  LV  L +L   + K   R  F    +  L+V VI  +P+ + K W  
Sbjct: 73  ACVFNSAIFAFTSLVGLLIILSDGNPKLVSRRNF----RTELLVDVITRKPAVEGKEWRI 128

Query: 127 VAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           + Y++N+ L+  G W+TPY  YS +  Y  F
Sbjct: 129 ITYNMNQYLFNHGQWHTPYYFYSDEDCYRYF 159

>Skud_13.255 Chr13 complement(436932..437678) [747 bp, 248 aa] {ON}
           YCR007C (REAL)
          Length = 248

 Score = 62.8 bits (151), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 13/167 (7%)

Query: 3   VKEDRYSGGSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXY 59
           VK D  + G  D+ S   +   I LP+D F S   +  YE  H                 
Sbjct: 14  VKLDTLNEGLHDEASPSLLSGNITLPKDCFSSYVAYLIYEMAHFKLTAFVIVLSAIILSL 73

Query: 60  VFMT--NSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTG---QLALMVGVIR 114
           + +   + E   L   +   + +  T G++        ++    +TG   Q  L++ VI 
Sbjct: 74  ILLLWDSIERKPLNIVLIANFIVFDTFGIIAAV-----IKFAMPMTGDNFQTKLLLEVIA 128

Query: 115 TRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
            +PS +   W  +AY++N+ L+ +GLWNTPY  YS    YG FK ++
Sbjct: 129 RKPSVEGVEWRTIAYNVNEYLFNKGLWNTPYYFYSEDSCYGTFKRFM 175

>Suva_13.219 Chr13 (356145..356654) [510 bp, 169 aa] {ON} YCR007C
           (REAL)
          Length = 169

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 70/161 (43%), Gaps = 10/161 (6%)

Query: 2   SVKEDRYSGGSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXX 58
           +VK +  + G  D+P+   V   I LP D+F+S F +  YE  H                
Sbjct: 13  NVKLNTLNAGVSDEPNASFVSGNITLPEDMFKSDFYYTLYEYYHGTGAMFFVILLVISIF 72

Query: 59  YVFMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTG--QLALMVGVIRTR 116
            V   N   G +F  +      +++  +L    S +      E +   Q+ L++ VI  +
Sbjct: 73  SVLTFNIHGGYIFIIV-----FLFSFAILGLIGSLFEFYKPVEESENFQIKLLLEVITRK 127

Query: 117 PSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           P  +   W  + Y++N+ L ++G W+TPY  Y   + Y +F
Sbjct: 128 PPVEGIEWKTITYNMNQYLCDKGYWSTPYYFYCEHRCYNVF 168

>Skud_3.71 Chr3 complement(107662..108369) [708 bp, 235 aa] {ON}
           YCR007C (REAL)
          Length = 235

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 71/161 (44%), Gaps = 11/161 (6%)

Query: 3   VKEDRYSGGSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXY 59
           ++ D     +  +P+   + + I LP+D F S   +  YE  H+                
Sbjct: 5   LRNDDVKLDTLSEPNASLIGENITLPKDSFNSYLCYLLYEMAHYKLTMIPFLVIVISTLM 64

Query: 60  V--FMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRP 117
           +  F        +FG +   +  V ++G LI  +  +      +   ++ L++ VI  +P
Sbjct: 65  IVFFHNIVLCNVVFGLLIFAFFFV-SMGALIAFNESFS-----DEEFKIKLLLEVITRKP 118

Query: 118 SADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           +   K W  + Y++N+ L++ GLWNTPY  Y  +  YG F+
Sbjct: 119 AVKGKEWRIITYNMNQYLFDNGLWNTPYYFYCDQSCYGFFR 159

>Skud_1.79 Chr1 (152136..152741) [606 bp, 201 aa] {ON} YAR028W
           (REAL)
          Length = 201

 Score = 60.1 bits (144), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 13/146 (8%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           +++ + LP D+F S +++  YE  H+                +  +++    L   +   
Sbjct: 23  IEENVALPEDIFNSYWSYLLYEVFHYKRLTFLFLAIGILVFLIIFSHNLACVLVSVLLLI 82

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQ----LALMVGVIRTRPSADQKTWDAVAYSLNK 133
            C +  +G+ I TS  +     FE        L L+V VI  +P+   K W  +AY++N+
Sbjct: 83  ACFI--IGLQIATSGGF-----FEPISHQDFILELLVEVIARKPAG--KGWRTIAYNMNQ 133

Query: 134 VLYERGLWNTPYCLYSGKQAYGMFKS 159
            L+   LWNTPY  YSG+  +  F++
Sbjct: 134 YLFNERLWNTPYYFYSGRVCHDFFRT 159

>Suva_1.100 Chr1 (165459..166430) [972 bp, 323 aa] {ON} YCR007C
           (REAL)
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 71/159 (44%), Gaps = 7/159 (4%)

Query: 3   VKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFM 62
           VK D  S  S   P + + + LP+D+F+ + ++  YE  H+                  +
Sbjct: 87  VKLDTLSEPSA--PLITENVALPKDIFKFRLSYLLYEIAHYTLTMISLMIPVVSVLLALI 144

Query: 63  TNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQK 122
            + +   +  ++     L +++  LIY +     R       +  L++ VI  +P+   +
Sbjct: 145 FHYDAVYVVASVLCFLDLFFSIFALIYFNESISDRGF-----KTKLLLEVIARKPALKGE 199

Query: 123 TWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
            W  + Y+ N+ L+E  LWNTPY  YS K+ +  F+  +
Sbjct: 200 EWRTITYNTNQYLFENDLWNTPYYFYSDKKCHSFFQDLV 238

>Skud_3.88 Chr3 (133816..134520) [705 bp, 234 aa] {ON} YCR007C
           (REAL)
          Length = 234

 Score = 60.1 bits (144), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 68/148 (45%), Gaps = 13/148 (8%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           + + I LP+D F S   + FYE  H+                + + ++        +C  
Sbjct: 23  IGENITLPKDTFNSYLYYVFYEMAHYRPTIVCFLALVISILTIVLFHN------IVLCN- 75

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTG----QLALMVGVIRTRPSADQKTWDAVAYSLNK 133
             +V+ L +L ++ S + L    +       ++ L++ VI  +P+   K W  + Y++N+
Sbjct: 76  --VVFGLLILFFSISMFVLGTFTDRVSDEEFEIKLLLEVITRKPAVKGKEWRIITYNMNQ 133

Query: 134 VLYERGLWNTPYCLYSGKQAYGMFKSWL 161
            L++  LWNTPY  YS K  YG F+  +
Sbjct: 134 YLFDNELWNTPYYFYSDKSCYGFFRRLI 161

>Skud_1.87 Chr1 (157764..158435) [672 bp, 223 aa] {ON}  YGL051W
           (REAL)
          Length = 223

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 25/156 (16%)

Query: 14  DDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGEL 70
           ++PS   +++ + LP D+F+S +++  YE + +                VF+    +  L
Sbjct: 18  NEPSAHLIEENVALPEDMFKSYWSYLLYEVVRYKPIM------------VFVLIKVSLIL 65

Query: 71  FGTI------CGGYC---LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQ 121
           FG I      C G+    L +TL + IY  + + LR   +   ++ L+V VI  +P+   
Sbjct: 66  FGVIFHDNEDCVGFSMLFLFFTLLISIYPVTLFWLR-VNDRDFEIELLVEVIARKPAVKG 124

Query: 122 KTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           K W  + Y +N+ L+  G WNTPY  Y  +  +  F
Sbjct: 125 KEWRTITYKMNRYLFNEGKWNTPYYFYCEESCHRYF 160

>NDAI0F04550 Chr6 complement(1105670..1106464) [795 bp, 264 aa] {ON}
           
          Length = 264

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 61/146 (41%), Gaps = 3/146 (2%)

Query: 23  ILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFM---TNSETGELFGTICGGYC 79
           ++PRD F    T+ FYE IH                  F        T  +FG +     
Sbjct: 44  VVPRDRFSFWITYLFYEYIHQLKGEGSAVLIMLLIVLTFTFACLRMFTIVVFGCLSIFII 103

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
           L  +L + ++ S             Q+ L++ VI  +P+    +WD +A  +N+ LY  G
Sbjct: 104 LFVSLFLFVFNSELNMKIEKLNSHNQIKLLLDVIECKPNGSSSSWDIIACHMNEYLYSEG 163

Query: 140 LWNTPYCLYSGKQAYGMFKSWLFSHI 165
             NTPY  Y G + Y  F+ ++F  +
Sbjct: 164 AHNTPYFFYDGSETYWWFRKYVFEPL 189

>Smik_1.90 Chr1 (160467..161183) [717 bp, 238 aa] {ON} YAR033W
           (REAL)
          Length = 238

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 66/154 (42%), Gaps = 14/154 (9%)

Query: 11  GSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXX-XXXXXXXXXXXXXYVFMTNSE 66
            + D+P+   ++  + LP D+F S   + FYE  H                  VF  +S 
Sbjct: 13  NTLDEPAAHLIEDNVALPEDMFSSYLGYLFYELAHFPPFILMLLVTTSLVSLLVFFHDSY 72

Query: 67  TGE---LFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKT 123
                 +F ++  G+ L  TL V    S + H  +         L+V VI  +P+   K 
Sbjct: 73  RSTFFYVFSSLVSGFLLQGTLIVFCDESVRDHEFDT-------KLLVEVITRKPAVKGKE 125

Query: 124 WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           W  + Y +N+ L++RG W TPY  Y  ++ Y  F
Sbjct: 126 WRTITYKMNQYLFDRGHWFTPYFFYCDEKCYRYF 159

>Skud_1.82 Chr1 (154805..155515) [711 bp, 236 aa] {ON} YAR027W
           (REAL)
          Length = 236

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 74/168 (44%), Gaps = 17/168 (10%)

Query: 3   VKEDRYSGGSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXY 59
            K DR      D+P+   +++ + LP+D+FRS   +  YE +H                 
Sbjct: 10  AKRDR-----LDEPNAHLIEENVTLPKDIFRSYPNYILYELVHCTPTMSMFLVNVILILL 64

Query: 60  VFMTNSETGELFGTICGGYCLVW---TLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTR 116
           +   +    ++  T+ G    V    T+ VL+     +     F     L L V VI  +
Sbjct: 65  IVFFSFHDNKICATVFGILLFVLSRSTVSVLVGMFGTHVSDRDF----ILKLSVEVITRK 120

Query: 117 PSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
           P+   K W AVAY++N+ L++ GLW TPY  Y G++    F++ +   
Sbjct: 121 PAG--KEWKAVAYNMNQYLFDEGLWYTPYYFYCGRKCRYFFRNIIIKE 166

>KAFR0B03990 Chr2 complement(833771..834451) [681 bp, 226 aa] {ON} 
          Length = 226

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 61/149 (40%), Gaps = 19/149 (12%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGT------ 73
           + + LP +VFR +  ++  E  H                  F   +  G LF        
Sbjct: 16  ERVTLPEEVFRGRMPYYVNEYAHKKIFL------------TFFIGTLVGILFAILLSEQI 63

Query: 74  -ICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLN 132
            IC  +     L  ++         N F    ++  +  +I  +P+A+ +TW  +   +N
Sbjct: 64  LICFIFSCFAVLSFVVSIVFAAIPTNEFTSHAKMKFLSEIIENKPNANIQTWTVITSHIN 123

Query: 133 KVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           + LY+ GLW TPY  Y+ +  Y  F+S++
Sbjct: 124 EYLYDNGLWKTPYRFYNNEDCYAFFRSFV 152

>YGL053W Chr7 (402589..403302) [714 bp, 237 aa] {ON}
           PRM8Pheromone-regulated protein with 2 predicted
           transmembrane segments and an FF sequence, a motif
           involved in COPII binding; forms a complex with Prp9p in
           the ER; member of DUP240 gene family
          Length = 237

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 6/155 (3%)

Query: 10  GGSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSE 66
             S D+P    +++ + LP+D+F S  ++W YE  H                 + + +  
Sbjct: 12  SDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTPVMLLSLVIGVLISIIILFHD- 70

Query: 67  TGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDA 126
             E    +  G+ L+++ G+L+            +   +  L++ +I  +P+   K W  
Sbjct: 71  -NENCVGVSVGFLLIFS-GILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRT 128

Query: 127 VAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           + Y +N+ L++  LWNTPY  Y  +  +  F S +
Sbjct: 129 ITYKMNQYLFDNDLWNTPYYFYRDEDCHRYFLSLI 163

>Suva_1.79 Chr1 complement(139959..140705) [747 bp, 248 aa] {ON}
           YCR007C (REAL)
          Length = 248

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 15/157 (9%)

Query: 11  GSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXX-XXXXXXXXXXXYVFMTNSE 66
           G+ D+P+   +   I LP ++F S+FTH FYE +H                  V+  N+ 
Sbjct: 28  GTSDEPNASLIADYITLPDNIFGSEFTHLFYEMVHFRPFVWLFLVLAVVILSVVYCHNNV 87

Query: 67  TGELFGTICGGY--CLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTW 124
              L   +   Y  CL   +      S +         + ++ L++ VI  +P+   + W
Sbjct: 88  FYNLIALVVIPYFMCLFAVIAFNQQISDE---------SFKIKLLMEVITYKPAVKGREW 138

Query: 125 DAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
             + Y++N+ L+  GLW TPY  YS  +    F++ +
Sbjct: 139 RTITYNMNQYLFCNGLWTTPYYFYSEMRCSDFFRTLI 175

>Kwal_26.7243 s26 (278708..279808) [1101 bp, 366 aa] {ON} YNL336W
           (COS1) - similar to subtelomerically-encoded proteins
           [contig 47] FULL
          Length = 366

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYE 137
           +CL   L +L+        R  F+      L   VI  +P AD + WD VA  +N+ LY+
Sbjct: 54  FCLGLLLDMLMKCVHSASKRAVFQHLD--VLCEEVIEVQPGADLRKWDVVAAHINERLYK 111

Query: 138 RGLWNTPYCLYSGKQAYGMFK 158
            G+W++PYC++ GK  Y +F+
Sbjct: 112 SGVWHSPYCVFDGKSCYSIFR 132

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/144 (19%), Positives = 51/144 (35%), Gaps = 7/144 (4%)

Query: 21  EIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICG---- 76
           E  LPRD++R+K   W ++  +                  ++           +C     
Sbjct: 181 EQKLPRDIYRAKIA-WLWKNTYESRFARVQLASLTLMYIPWVPPPWRPFSSVFLCDPPRA 239

Query: 77  -GYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKV 134
            G    W +  ++++   Y  R+       L +++ +I   +P  D   WD VA   N  
Sbjct: 240 VGAMTAWPMIYMMHSFGYYRTRSLDVHISHLPMILAIIVEVKPKPDTSGWDDVARHCNAY 299

Query: 135 LYERGLWNTPYCLYSGKQAYGMFK 158
           L +  +   P   Y GK  +  F 
Sbjct: 300 LRDEKVRAIPEFFYDGKDCFWYFN 323

>YGL051W Chr7 (403687..404391) [705 bp, 234 aa] {ON}  MST27Putative
           integral membrane protein, involved in vesicle
           formation; forms complex with Mst28p; member of DUP240
           gene family; binds COPI and COPII vesicles
          Length = 234

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 8/151 (5%)

Query: 11  GSWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSET 67
            + ++PS   +++ + LP+D+FRS  ++W YE   +                +   N   
Sbjct: 13  DTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNE 72

Query: 68  GELFGTICGGYCLVWTLGVLIYT-SSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDA 126
             +F +    Y  +  L +++   + K   R  F    +  L+V VI  +P+ + K W  
Sbjct: 73  ACVFNSAYYAYLSLVVLLIILGDGNPKLVSRRNF----RTELLVDVITRKPAVEGKEWRI 128

Query: 127 VAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           + Y++N+ L+  G W+TPY  YS +  Y  F
Sbjct: 129 ITYNMNQYLFNHGQWHTPYYFYSDEDCYRYF 159

>Skud_69.1 Chr69 (40..750) [711 bp, 236 aa] {ON} YHL044W (REAL)
          Length = 236

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 6/159 (3%)

Query: 5   EDRYSGG-SWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYV-FM 62
           +D  +G  + ++ S  + I+LPRD   +KF H+F + I                 YV F 
Sbjct: 8   DDSKAGAKTTEELSKVETIVLPRDK-TNKFVHFFKQNIRVFYLILLHIIVITIFGYVGFH 66

Query: 63  TNSETGELFGT---ICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSA 119
           T        G    I G   L + + +  Y S   H  +C   + ++ L+  VI  +P+ 
Sbjct: 67  TEGYLVSFLGIFLMILGFLLLFYYVPLFYYISLPEHRLSCLSHSCKMKLLAEVITHKPNV 126

Query: 120 DQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           +  TW  +AY++N+ ++++G+       Y GK  Y +F+
Sbjct: 127 NMLTWGPIAYNMNQYVFDQGICPNKSFFYDGKSCYQVFR 165

>Suva_3.29 Chr3 complement(39749..40108,40112..40258) [507 bp, 169
           aa] {OFF} YCR007C (HSP)
          Length = 169

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%)

Query: 76  GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
             Y     LGVL  T       +       + L+V VI  +P+ + + W  +AY+ N+ L
Sbjct: 18  AAYIAAPILGVLDLTFVLVSFNSLISDKAFMMLLVEVIARKPAVEGEEWRVIAYNTNQYL 77

Query: 136 YERGLWNTPYCLYSGKQAYGMFK 158
           +E  LWNTPY  Y+G   Y  F+
Sbjct: 78  FENELWNTPYYFYAGDNCYSYFQ 100

>TBLA0E04350 Chr5 (1106371..1107063) [693 bp, 230 aa] {ON} 
          Length = 230

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%)

Query: 60  VFMTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSA 119
           +F  +S   ++   IC     ++ + ++I  +S    +    L GQ+ LM+ VI T+P  
Sbjct: 84  IFSQDSLLWKVLMYICISIDAIYGISLVILFTSPLRKKKILGLQGQMKLMLEVIETKPIL 143

Query: 120 DQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           + K WD +A +LN  LY    W      Y GKQ   +F+
Sbjct: 144 EMKKWDLIASNLNSHLYIMNNWRNNDFFYDGKQCLNLFR 182

>Smik_13.228 Chr13 complement(361792..362511) [720 bp, 239 aa] {ON}
           YCR007C (REAL)
          Length = 239

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 60/166 (36%), Gaps = 19/166 (11%)

Query: 2   SVKEDRY---SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXX 58
            VK DR      G  D  S+     LP  VF S  T+  YE  H                
Sbjct: 8   DVKLDRLIDQCPGESDASSIPCNFTLPNGVFSSYVTYLIYEMAHFKLIAFFIPLFVILTP 67

Query: 59  YVFMTNSETGELFGTI------CGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGV 112
            V +       L   I        G  +V    V   T   +          Q+ L+  V
Sbjct: 68  LVLLFRKSDLYLLLNIYWFLFGFAGSTIVMVEFVCPITDDNF----------QIKLLSEV 117

Query: 113 IRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           I+ +P  +   W  +AY++N  L ++GLWNTPY  YS    Y  FK
Sbjct: 118 IKRKPPVEGVEWKIIAYNVNYYLLDKGLWNTPYYFYSKDNCYNAFK 163

>Skud_41.1 Chr41 (3..701) [699 bp, 232 aa] {ON} YCR007C (REAL)
          Length = 232

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           + + I LP+D F S   +  YE  H+                + M       L   I  G
Sbjct: 17  IGENITLPKDSFNSYLYYLLYEMAHYKPTIVCFLVTVIS---ILMIVVFHNILLCDIAFG 73

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYE 137
              +  L   +Y   +++  +  +   ++ L++ VI  +P+   K W  + Y++N+ L++
Sbjct: 74  ---LLNLSFFVYALIEFN-DSVSDEEFKIKLLLEVITRKPAVKGKEWRIITYNMNQHLFD 129

Query: 138 RGLWNTPYCLYSGKQAYGMFK 158
            GLWNTPY  Y  +  YG F+
Sbjct: 130 NGLWNTPYYFYCDQSCYGFFR 150

>Smik_3.91 Chr3 (124341..125060) [720 bp, 239 aa] {ON} YCR007C
           (REAL)
          Length = 239

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 65/144 (45%), Gaps = 4/144 (2%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           +   + LP+D F S   +  YE  H+                + + ++        +  G
Sbjct: 27  IADNVTLPKDFFSSYLNYLLYEMAHYKPISFSFVLILVSVLIIVLFHNVPA---CNVVFG 83

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYE 137
             +  T+ VLI   S + + +  E   ++ L++ VI  +P  + K W  + +++N+ L++
Sbjct: 84  LTIFITIMVLIIALSIFSM-DISEEGFKIKLLLEVITRKPEVEGKEWRIITHNMNQYLFD 142

Query: 138 RGLWNTPYCLYSGKQAYGMFKSWL 161
            GLWNT    Y  ++ Y +F+S +
Sbjct: 143 NGLWNTQSFFYCEEKCYKLFRSLV 166

>Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)
          Length = 236

 Score = 54.3 bits (129), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 5/143 (3%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYV-FMTNSETGELFG---TIC 75
           + I+LPRD   ++F ++F + I                 Y+ F T+ +    FG    I 
Sbjct: 24  ETIVLPRDK-TNRFVYFFKQNIASFYFSLFLIIVTVTSGYMGFRTDDDVVTFFGFFFMIL 82

Query: 76  GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
           G    +  L VL   +S     N      ++ L+V VI  +P+ D +TWD +A S+N+  
Sbjct: 83  GLASFLVFLIVLHGNTSAKCKLNALSDECKIKLLVEVITRKPNVDMETWDPIACSMNQYA 142

Query: 136 YERGLWNTPYCLYSGKQAYGMFK 158
           Y+RG +      Y G   Y +F+
Sbjct: 143 YDRGTYPDKSLFYDGNICYRVFR 165

>KAFR0H03780 Chr8 (718980..719699) [720 bp, 239 aa] {ON} 
          Length = 239

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MSVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYV 60
           M  K+     G+  +P+    + LP  VFR++FT+   E                   Y 
Sbjct: 1   MDSKDSDELLGARAEPAT---MPLPSTVFRNRFTYGLSEMFK---------TKRCQISYT 48

Query: 61  FMTNSETGEL-FGTICGG---YCLVWTLGVLIYTSSKYHLRNC----FELTGQLALMVGV 112
            +  S T  + F  + G      L++ L   I  ++ +         F    ++   + V
Sbjct: 49  LLLASITAAITFANVPGKSDTSALLFALSFFILVATAFVTATVFIKEFNTFAKVKFFLYV 108

Query: 113 IRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           +  +P+ D  +WD +A  +N  LY  G W +P C Y G+ AY  FKS +
Sbjct: 109 VEYKPNIDPHSWDIIASHMNVYLYNEGYWFSPRCFYDGQAAYHYFKSLI 157

>NDAI0F04400 Chr6 (1077197..1077844) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 104 GQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFS 163
            Q+ L++ VI  +P+A   +WD +A  +N+ LY  G  NTPY  Y G + Y  F+ ++F 
Sbjct: 128 NQIKLLLDVIECKPNASSSSWDIIACHMNEYLYSEGAHNTPYFFYDGSETYWWFRKYVFE 187

Query: 164 HI 165
            +
Sbjct: 188 PL 189

>Skud_13.8 Chr13 (8824..9525) [702 bp, 233 aa] {ON} YHL044W (REAL)
          Length = 233

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 70/151 (46%), Gaps = 15/151 (9%)

Query: 17  SVQQEIILPRDVFRSKFTH--------WFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           S  + IILP+DV    F +        +F+  IH                 +   ++ T 
Sbjct: 21  SQTENIILPKDVNPDHFLYSSKKHILVFFFLLIH-------IMVVIILGCLICTHHANTF 73

Query: 69  ELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVA 128
            +   I   + L  +L VL Y   + ++ +  +  G++ L+V VI  +P+AD++TWD +A
Sbjct: 74  IVILMIISFFTLPLSLVVLTYFLGEDYILDLLDDDGKMNLLVEVIHHKPNADKRTWDLIA 133

Query: 129 YSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           +++N+  Y+ G +      Y G   Y +F+S
Sbjct: 134 HNMNQFAYDHGKYCDKSLFYDGDCCYRVFRS 164

>ZYRO0D00242g Chr4 (12246..13301) [1056 bp, 351 aa] {ON} weakly
           similar to uniprot|P53822 Saccharomyces cerevisiae
           YNL336W COS1 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 351

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 57/145 (39%), Gaps = 14/145 (9%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXX-----XXXXXYVFMTNSETGELFGTI 74
           Q  +LP+D+FR+  T   YE   H                      F  N     + G +
Sbjct: 8   QRPVLPKDLFRNGLTWILYEIFKHYFPSVVSCTFCVITWVAFSMDAFYQNVPGLYMIGRV 67

Query: 75  CGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKV 134
                + + LG L Y+ S               L+  V+++ P  D + WD +A  LN  
Sbjct: 68  VFESAINFPLGWLYYSKSH---------PDTTLLVQQVLKSNPGLDIEKWDEIANRLNSS 118

Query: 135 LYERGLWNTPYCLYSGKQAYGMFKS 159
            Y+  +WNTPY  Y G+Q    F++
Sbjct: 119 FYQEHMWNTPYFFYDGQQGQLAFRN 143

>Skud_1.86 Chr1 (156935..157462) [528 bp, 175 aa] {ON} YAR028W
           (REAL)
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 6/135 (4%)

Query: 25  PRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYCLVWTL 84
           P DVF S +++  YE  H+                +   +     +  +I     L++ +
Sbjct: 5   PEDVFNSYWSYLLYEMAHYKPILSLLVVIVSLVLLILFFHDNEVCVVASIVS---LIFCI 61

Query: 85  GVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTP 144
            +L + S  +  +   +   ++ L   VI  RP+   K W   AY++N+ L++ GLWNTP
Sbjct: 62  FILPFISDAF-TQPISDKDFKIKLSAEVIALRPAG--KGWGTTAYNMNQYLFDEGLWNTP 118

Query: 145 YCLYSGKQAYGMFKS 159
           Y  Y G++ +  F++
Sbjct: 119 YYFYRGRECHDFFRT 133

>ZYRO0E00330g Chr5 (16701..17774) [1074 bp, 357 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 357

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 3/139 (2%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+ +LP+D+F++ FT  FYE   H                 F  N     L  +I     
Sbjct: 8   QKPVLPKDLFKNAFTWMFYEISKHRFPSVVSCVYLVIVLVGFWWNFADKNLPLSIV--LA 65

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
            V   G+L      +  +N  E      L+  V+ + P  D + WD +A  LN   Y   
Sbjct: 66  AVGLFGILFGLIPAW-FQNVKEHPNTKKLVQQVLESNPGVDTRKWDEIANILNLFFYREN 124

Query: 140 LWNTPYCLYSGKQAYGMFK 158
           +W TPY  ++G+    +FK
Sbjct: 125 IWRTPYFFFNGQHVQRVFK 143

>YAR028W Chr1 (184892..185596) [705 bp, 234 aa] {ON} Putative
           integral membrane protein, member of DUP240 gene family;
           GFP-fusion protein is induced in response to the
           DNA-damaging agent MMS
          Length = 234

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 8/153 (5%)

Query: 12  SWDDPS---VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           + D+PS   +++ + LP D F S  ++  YE  H                 + + +   G
Sbjct: 14  TLDEPSAHLIEENVALPEDTFSSHLSYVLYEIAHCKPIMFMIIIIVSLISLIVLFHDNDG 73

Query: 69  ELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVA 128
               T+     L+     L+  ++    +   E    + L+V VI  +P+   K W  VA
Sbjct: 74  ---CTVILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVIARKPAG--KEWGTVA 128

Query: 129 YSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           Y++N+ L+ + LW TPY  YSGK+ +  F + +
Sbjct: 129 YNMNQYLFMKRLWYTPYYFYSGKKCHEFFTTLI 161

>KLTH0B10252g Chr2 (863070..863741) [672 bp, 223 aa] {ON} some
           similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 223

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 60/157 (38%), Gaps = 5/157 (3%)

Query: 3   VKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFM 62
           V+E        DD    Q + LPRD++ +KF +                         FM
Sbjct: 7   VEEYSLHASQEDD----QSLTLPRDIYPNKFLYQISRHRAPLFATSLELVLCTLLIRYFM 62

Query: 63  TNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFEL-TGQLALMVGVIRTRPSADQ 121
             +++   F  +         LG+ +++   + + NC +    ++  M  +I   P  + 
Sbjct: 63  KKNDSSARFEAVSSVVSFGLPLGLSLFSGMVHLVHNCGKAPVNRVRFMEEIIAVEPGTET 122

Query: 122 KTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           + WD++A  LN + Y      TP+  Y G   Y  F+
Sbjct: 123 RKWDSIAARLNAIFYSNNSLATPHFFYDGNACYFYFR 159

>NDAI0G02270 Chr7 complement(508794..509516) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 65/149 (43%), Gaps = 9/149 (6%)

Query: 23  ILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFM-TNSETGELFGTICGGYCLV 81
           ++PRD F    +++F E IH                +  + T  ++G      C  Y LV
Sbjct: 24  VVPRDKFPFWLSYFFNEYIHQRFGQITGGVFIFICIFASISTYFKSGAAIFIACV-YFLV 82

Query: 82  WTLGVLIYTSSKYHLRNCFEL-----TGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLY 136
             + V+I     Y LR  F+L       Q+ L++ VI  +P+    TWD +A  +N+ LY
Sbjct: 83  LLMAVVI--GYVYELRPNFKLRELNSQSQMKLLLEVIECKPTPSSSTWDVIACHVNEYLY 140

Query: 137 ERGLWNTPYCLYSGKQAYGMFKSWLFSHI 165
                 TP   Y G +AY  F+  +F  +
Sbjct: 141 TERYHTTPNYFYDGNEAYCWFRESVFEPL 169

>YCR007C Chr3 complement(126011..126730) [720 bp, 239 aa] {ON}
           Putative integral membrane protein, member of DUP240
           gene family; YCR007C is not an essential gene
          Length = 239

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 17  SVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICG 76
           S  + I LP D F+S  T+  YE  H+                V + ++        +  
Sbjct: 26  SSAENITLPEDTFKSYMTYLLYEMAHYKPMIFSFLALSVSILIVVIFHNVKA---CDVVF 82

Query: 77  GYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLY 136
           G+ +  T  + + T   +++    E   ++ L++ VI  RP+   K W A+  ++N+ L 
Sbjct: 83  GFSIFVTSILFLSTLIPFNVYISDE-GFRIKLLLEVITHRPAVKGKEWRAITDNMNQYLL 141

Query: 137 ERGLWNTPYCLYSGKQAYGMFK 158
           + GLW+T Y  YS ++ Y  F+
Sbjct: 142 DNGLWSTRYYFYSSERCYKFFR 163

>ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa]
           {ON} some similarities with uniprot|P38363 Saccharomyces
           cerevisiae YML132W COS3 Protein involved in salt
           resistance interacts with sodium:hydrogen antiporter
           Nha1p member of a family of conserved often
           subtelomerically- encoded proteins
          Length = 224

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 54/139 (38%), Gaps = 4/139 (2%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+  LP+D+F++ FT  FYE   H                 F  N     L      G  
Sbjct: 8   QKPALPKDIFKNAFTWMFYEISKHRFPRVVSYVYLVIVLVEFCWNFADKNL----PLGIA 63

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
           L   L  L++       +   E      L+  V+ + P  D + W+ +A  LN   Y   
Sbjct: 64  LAVGLSGLLFGLIPAWFQYVKEHPNTKKLVQQVLESNPGVDTRKWNEIANILNPFFYREN 123

Query: 140 LWNTPYCLYSGKQAYGMFK 158
           +W TPY  ++G+    +FK
Sbjct: 124 IWRTPYFFFNGRHVQRVFK 142

>NCAS0A10610 Chr1 (2114082..2114984) [903 bp, 300 aa] {ON} 
          Length = 300

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 65/150 (43%), Gaps = 17/150 (11%)

Query: 17  SVQQEIILPRDVFRSKFTHWFYERIHHXXX----XXXXXXXXXXXXYVFMTNSETGELFG 72
           ++++ ++LPRD+F S+ T+  Y+  +                     +   N +   +F 
Sbjct: 68  NMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDAIAIFL 127

Query: 73  TIC-----GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAV 127
            +      G +  V    V+  +    H++        + L   V++ +P+ + K+W+ +
Sbjct: 128 LLAILFFIGSFSFVIVRIVIDQSLDDAHIK--------MKLYSEVLKYKPNINLKSWNII 179

Query: 128 AYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
            + +N+ LY+ G +  P+CLY   + Y  F
Sbjct: 180 TFHMNEYLYQNGYFRNPFCLYDSSKCYNWF 209

>SAKL0D15312g Chr4 (1275517..1276116) [600 bp, 199 aa] {ON} some
           similarities with uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 199

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 4/135 (2%)

Query: 24  LPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYCLVWT 83
           LPRD++RSKFT W    +                 Y F  ++   E+F  +C    L+  
Sbjct: 21  LPRDMYRSKFT-WTVRHVFMKKQTFLKLPALFYGIYYF--SNVFDEIFA-MCYRITLISI 76

Query: 84  LGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNT 143
           +    Y+  +        L  ++  +  VI+ +P  D   WD +A ++N+  Y +G W+T
Sbjct: 77  VINGWYSGMQATKNLSLNLERRMDFLAEVIKVQPHIDMGKWDIIAANMNEFFYTKGTWHT 136

Query: 144 PYCLYSGKQAYGMFK 158
               + GK  + +FK
Sbjct: 137 EEFFFDGKHCHNVFK 151

>Suva_8.398 Chr8 (714632..715528) [897 bp, 298 aa] {ON} YAR031W
           (REAL)
          Length = 298

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 63/144 (43%), Gaps = 4/144 (2%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           VQ  I LPR+ F S  ++  YE  H                 V   N +   L+  +   
Sbjct: 89  VQGNIALPRNAFDSYLSYLLYEITHFPPFVFSFVVLIILLISV--ENLDVHTLYTVLFVC 146

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYE 137
             L   LG L Y+  +++ R+ F+    + L++ VI  +P+   + W  +  ++N+ L+E
Sbjct: 147 LFLADFLG-LGYSVLRFNARD-FDDNFNIKLLLEVITRKPAVKGEEWRTITCNMNRYLFE 204

Query: 138 RGLWNTPYCLYSGKQAYGMFKSWL 161
             LW TPY  +S    Y  F + L
Sbjct: 205 NELWGTPYYFHSENNCYRYFITLL 228

>SAKL0H20614g Chr8 (1809584..1810294) [711 bp, 236 aa] {ON} some
           similarities with uniprot|P38723 Saccharomyces
           cerevisiae YHL048W COS8 Nuclear membrane protein member
           of a family of conserved often subtelomerically-encoded
           proteins regulation suggests a potential role in the
           unfolded protein response
          Length = 236

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 64/140 (45%), Gaps = 11/140 (7%)

Query: 24  LPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICG-GYCLVW 82
           LPRD+F+++ + W   +++                 +F+        +G I G G CL+ 
Sbjct: 22  LPRDIFKTR-SRWRCYKLYKSIAIRISL-------LIFLIAQVLATFYGGIEGFGLCLIP 73

Query: 83  TLGVLIYTS-SKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLW 141
           TL ++++++       +   L GQ+  +V V   RP  D   WD +A  +N+ +   G W
Sbjct: 74  TLILILFSALIVLTTSSSLGLKGQMEFLVQVTTLRPGLDISRWDIIANRMNEYMLNTGKW 133

Query: 142 -NTPYCLYSGKQAYGMFKSW 160
            +  Y  + G++ +  F+ W
Sbjct: 134 LSENYFFFDGEECFKYFREW 153

>Kwal_27.10096 s27 (192352..193374) [1023 bp, 340 aa] {ON} YNL336W
           (COS1) - similar to subtelomerically-encoded proteins
           [contig 42] FULL
          Length = 340

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFS 163
           VI  RP AD   W+ +   LN +LY+ GL+N PYC++ G+    +F+  +  
Sbjct: 80  VIDQRPGADTLKWNLITQRLNGLLYDEGLYNNPYCIFDGEHCQELFRELVLE 131

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%)

Query: 101 ELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           ++  +L  +  V   RP A  + W+ VA  +NK +YE   W++    + G+     FK
Sbjct: 249 KIEARLTFLKTVSLVRPHAQVEGWNVVAKRMNKYMYEEKGWHSKEFFHDGEDCSRYFK 306

>KAFR0C00130 Chr3 complement(15602..16237) [636 bp, 211 aa] {ON} 
          Length = 211

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 102 LTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           ++  + L   +I  RP+ D   W+ +  S+N  L+E+G W+TPY  Y G+  Y  FK  +
Sbjct: 69  ISSNVRLFQYIIEYRPNIDPHAWNIITSSINLYLFEQGEWSTPYRFYDGQSTYAYFKGMI 128

>YAR023C Chr1 complement(179281..179820) [540 bp, 179 aa] {ON}
           Putative integral membrane protein, member of DUP240
           gene family
          Length = 179

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 103 TGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           T +  L++ VI  RPS   K W  + Y++N+ L++ GLW TPY  +   Q Y  FK
Sbjct: 54  TFRTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFK 109

>ZYRO0D00154g Chr4 (5577..6647) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 64/145 (44%), Gaps = 14/145 (9%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTN-----SETGELFGTI 74
           Q+ +LP+  F+S  T  FYE   H                ++ +N       TGE+F T+
Sbjct: 8   QKPVLPKQPFKSDSTWSFYEISKHRFPQVISCLCLVGWVSLYGSNLINKIGLTGEMFATL 67

Query: 75  CGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKV 134
             G+ ++ +L  L Y  SK++  N  EL  Q      V+ + P  D + W  +A  LN  
Sbjct: 68  VLGFSVLLSLARLQY--SKFY-PNTTELVQQ------VLESNPGVDIEKWAEIANRLNIY 118

Query: 135 LYERGLWNTPYCLYSGKQAYGMFKS 159
            Y+  LW  P+  ++ +    +FK 
Sbjct: 119 FYQEHLWPMPHFFFNNQPVQLVFKD 143

>NCAS0I00840 Chr9 complement(154605..155312) [708 bp, 235 aa] {ON} 
          Length = 235

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 108 LMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           L + +I+ +P+ D ++WD +A  +N+ LYE G WNTP   Y G   Y  FK
Sbjct: 114 LFLEIIQWKPNVDPRSWDLIALHINQHLYEMGNWNTPGFFYDGHLVYAWFK 164

>Smik_1.105 Chr1 (168370..168972) [603 bp, 200 aa] {ON}  YGL053W
           (REAL)
          Length = 200

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 81  VWTLGVLIY-TSSKYHLRNCF------ELTGQLALMVGVIRTRPSADQKTWDAVAYSLNK 133
           V  LGVL++ T     +  CF      +   Q  L+V VI  +P+   K W  + Y++N+
Sbjct: 50  VHVLGVLLFLTPFALIVPICFFREQLGDRNFQRKLLVEVITRKPAVKGKEWKTITYNMNQ 109

Query: 134 VLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
            L+   LWNTPY  Y  +  +  F S +  H
Sbjct: 110 YLFVNNLWNTPYYFYRDEDCHRYFLSLIEGH 140

>YAR027W Chr1 (183770..184477) [708 bp, 235 aa] {ON}  UIP3Putative
           integral membrane protein of unknown function; interacts
           with Ulp1p at the nuclear periphery; member of DUP240
           gene family
          Length = 235

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 106 LALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           + L+V VI  +P+   K W  +AY++N+ L++ G+W+TPY  +   + +  FKS +
Sbjct: 107 IKLLVEVITRKPAVGGKEWRIIAYNMNQYLFDHGIWHTPYYFFCEHRCHKFFKSLI 162

>ZYRO0A13948g Chr1 complement(1108143..1109129) [987 bp, 328 aa]
           {ON} some similarities with uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 328

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 70  LFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAY 129
           + G +   +  ++  G L Y+ S               L+  V+++ P  D + WD +A 
Sbjct: 40  MIGRVVFEFAFIFPFGWLYYSKSH---------PDTTLLVQQVLKSNPGLDIEKWDEIAN 90

Query: 130 SLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
            LN   Y+  +WNTPY  Y G+Q    F+ 
Sbjct: 91  RLNSSFYQEHIWNTPYFFYDGQQGQLAFRD 120

>ZYRO0B00154g Chr2 (3082..4164) [1083 bp, 360 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 360

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXX-------XXYVFMTNSETGELFG 72
           Q  +LP+D+FR+  T  FYE   H                      Y++  +   G +  
Sbjct: 8   QRPVLPKDLFRNGLTWMFYEISKHRFPWVVSCLCLVAGWVVLYGSNYIY-KDVSLGSMIS 66

Query: 73  TICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLN 132
           T+     L+     L   +SK H +   EL  Q      V+ + P  D + WD +A  LN
Sbjct: 67  TLLWMLALLLPFSWL--HNSKLHPKIMTELVQQ------VLESNPGVDIEKWDEIANRLN 118

Query: 133 KVLYERGLWNTPYCLYSGKQAYGMFKS 159
              Y+   WNTPY  Y G+    +FK+
Sbjct: 119 SSFYQEHFWNTPYFFYDGQGLQLLFKA 145

>NDAI0G02310 Chr7 complement(517385..518269) [885 bp, 294 aa] {ON} 
          Length = 294

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 104 GQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
            ++ L++ +I  +P+A  ++WD +A  +NK LY  G +NTP   Y G + Y  F+ ++ 
Sbjct: 121 NKMKLLMDIIENKPNASVQSWDIIARHMNKYLYLEGYYNTPNFFYDGNEVYYWFRRFVL 179

>YKL219W Chr11 (14485..15708) [1224 bp, 407 aa] {ON}  COS9Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 407

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 57/143 (39%), Gaps = 3/143 (2%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+++LP+D+F   FT  FYE                     F+  S+   +        C
Sbjct: 47  QKVVLPQDLFMDNFTWMFYEFFKCFTFRTWLLLLLLMWLPGFL--SQIKSINRIFPFKLC 104

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVG-VIRTRPSADQKTWDAVAYSLNKVLYER 138
           ++ +  V I+  + Y   +   LT QL      ++   P  D   W+ VA +LN   YE 
Sbjct: 105 ILVSCLVGIFLPNIYSFSHKSVLTNQLTQFSKEIVEHAPGTDTHDWETVAANLNSYFYEN 164

Query: 139 GLWNTPYCLYSGKQAYGMFKSWL 161
             WNT Y  ++  +    F+  L
Sbjct: 165 KAWNTEYFFFNAAECQKAFRKVL 187

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 61/151 (40%), Gaps = 20/151 (13%)

Query: 16  PSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTIC 75
           P   + + LP+  +R KFT W  +RI +                    + + G LF  +C
Sbjct: 237 PDNLEHVQLPKKTYRYKFT-WVLKRIFNLWLFPAFILFLA----CIYVSWDKGHLFRILC 291

Query: 76  --GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNK 133
             GG+ L+    V ++ + +        +  ++  +  +I  + S     WD +A  +N+
Sbjct: 292 CGGGFLLM----VRVFQNMRPF---SMHMEDKMQFLSTIINEQESG-ANGWDEIAKKMNR 343

Query: 134 VLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
            L+E+ +W +    + G         W F+H
Sbjct: 344 YLFEKKVWTSEEFFFDGIDC-----EWFFNH 369

>ZYRO0E00132g Chr5 (2603..3472) [870 bp, 289 aa] {ON} weakly similar
           to uniprot|P38363 Saccharomyces cerevisiae YML132W COS3
           Protein involved in salt resistance interacts with
           sodium:hydrogen antiporter Nha1p member of a family of
           conserved often subtelomerically- encoded proteins
          Length = 289

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%)

Query: 107 ALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
            L+  V+   P  D K WD +A  LN + Y+  +WNTPY  Y G+Q    FK 
Sbjct: 29  VLVRQVLELNPQRDFKKWDDIASKLNLLFYQEHIWNTPYFFYDGQQTQLAFKD 81

>SAKL0H20636g Chr8 (1810817..1811494) [678 bp, 225 aa] {ON} weakly
           similar to uniprot|P25354 Saccharomyces cerevisiae
           YCR007C Putative integral membrane protein member of
           DUP240 gene family
          Length = 225

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 57/144 (39%), Gaps = 23/144 (15%)

Query: 24  LPRDVFRSKFT---------HWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTI 74
           LPRD FR KF+          WF   I                 +V +  +       T+
Sbjct: 23  LPRDAFRCKFSWKCYLLFSNTWFI--ISSMLLVILTLLAAHFGGFVMLVPTLALCPIFTV 80

Query: 75  CGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKV 134
                ++ T G+              +L G+  L+V +  TRP+ D   WD +A  +N  
Sbjct: 81  VPATVVIATRGI------------GLDLQGRARLLVEITVTRPALDMSKWDIIAADINNF 128

Query: 135 LYERGLWNTPYCLYSGKQAYGMFK 158
           + ++G W++    Y+G++ +  FK
Sbjct: 129 MLKKGKWSSKQYFYNGEECFDFFK 152

>Kwal_26.7673 s26 complement(466671..467774) [1104 bp, 367 aa] {ON}
           YNL336W (COS1) - similar to subtelomerically-encoded
           proteins [contig 55] FULL
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           VI+ +P A+   WD VA  +N+ LY  G W  PYC+Y G+    +F+
Sbjct: 85  VIKIQPGANLSKWDVVAAHINERLYRSGAWYNPYCIYDGEYCISLFR 131

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 23/56 (41%)

Query: 108 LMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFS 163
           L+  ++  +P  D   WD VA   N  L    +W TP   Y G      F  ++ S
Sbjct: 272 LLAIIVEVKPKTDTMAWDNVAKQFNAYLQREKVWPTPEFFYDGNDCLWAFNKFVSS 327

>Suva_2.722 Chr2 complement(1264397..1264660,1264664..1264828) [429
           bp, 143 aa] {OFF} YFL062W (HSP)
          Length = 143

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 15/130 (11%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTIC-GGY 78
           Q I LP+DVFRS F+ WF  +I+                +  +++     L    C    
Sbjct: 23  QNISLPKDVFRS-FSTWFCYQIYKTLASRIWLLLLPLGIWWKISSRWNYPLMAAACMDAA 81

Query: 79  CLVWTLGVLIYTS---SKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
            L + + ++IY     SK H + C E          +I++ P  D + W+ +  + N  +
Sbjct: 82  LLTFPIHMMIYRKRAISKQHTQFCKE----------IIKSVPGTDIEDWEPIVINFNSYM 131

Query: 136 YERGLWNTPY 145
           YE  LWN  Y
Sbjct: 132 YENKLWNNEY 141

>SAKL0C10978g Chr3 complement(991612..992388) [777 bp, 258 aa] {ON}
           some similarities with uniprot|P47187 Saccharomyces
           cerevisiae YJR161C COS5 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 258

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 58/150 (38%), Gaps = 9/150 (6%)

Query: 15  DPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTI 74
           +P V  + +LPRDVF ++FT + Y  +                 ++F   + + E +  I
Sbjct: 51  EPQVGSQPVLPRDVFSNEFTFFLYFLVR---SPFFWVSLVLFGTFLFFAITASSEGWTAI 107

Query: 75  C------GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVA 128
           C       G   V +  ++    S   +   FEL   +  +  V   +P      WD VA
Sbjct: 108 CVLLSIFTGIASVVSFVLVARQLSDVEVSRGFELEQSVQFLFEVRDVKPGMRTVKWDIVA 167

Query: 129 YSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
             +N  L+E   +   Y  Y GK     FK
Sbjct: 168 SRMNDYLFETKYYPHRYAFYDGKSCLDGFK 197

>Smik_18.2 Chr18 (1570..2265) [696 bp, 231 aa] {ON} YHL044W (REAL)
          Length = 231

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 62/144 (43%), Gaps = 4/144 (2%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGT----IC 75
           + I+LPRD + + F+++F + I                 Y+     +   +F      + 
Sbjct: 18  EPIVLPRDTYLNWFSYFFKQHIQLFYFMFFHSVVVIVFGYITFHFEDDLVVFLACFFMVL 77

Query: 76  GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
           G   L + + + +      ++ +  +   ++ L+V VI  +PS    TW+ +AY++N+  
Sbjct: 78  GFGLLFFYIPLCLDMGGPKYVLDGLDFNCKMNLLVQVIEHKPSISIDTWNRIAYNMNQYA 137

Query: 136 YERGLWNTPYCLYSGKQAYGMFKS 159
           YE  L+      Y G   Y +F+ 
Sbjct: 138 YEHHLFPENSLFYDGSSCYKVFRE 161

>KLTH0D00374g Chr4 complement(33818..34939) [1122 bp, 373 aa] {ON}
           weakly similar to uniprot|P53344 Saccharomyces
           cerevisiae YGR295C COS6 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 373

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           VI   P   ++ WD  A  +N   YE+GLW    CLYSG+Q +  F+
Sbjct: 92  VIEEGPGMQEEQWDIAAARMNSHFYEQGLWPNSCCLYSGRQCHAAFR 138

>ZYRO0A00220g Chr1 (9173..10243) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P47187 Saccharomyces cerevisiae
           YJR161C COS5 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 62/150 (41%), Gaps = 24/150 (16%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHH----------XXXXXXXXXXXXXXXYVFMTNSETGE 69
           Q  +LP+D+FR++ T  FYE   H                          + +++   G 
Sbjct: 8   QRPVLPQDLFRNELTWMFYEMCKHRFPWVVSCLCLVAGWVVAQMNFTYKNMLVSDMTAGA 67

Query: 70  LFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAY 129
           LFG  C    LVW    + Y   K++  N  EL  Q      V+ + P  D + W  +A 
Sbjct: 68  LFG--CA---LVWPFVRVRYL--KFY-PNTTELVQQ------VLESNPEVDIEKWAEIAN 113

Query: 130 SLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
            LN   Y+  LW+TP+  ++ +    +FK 
Sbjct: 114 RLNIYFYQEHLWSTPHFFFNNQHVQLVFKD 143

>NDAI0G01470 Chr7 (324888..325607) [720 bp, 239 aa] {ON} 
          Length = 239

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 81  VWTLGVLIYTSSKYHLRNC-FELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
           +++  ++   SS +  + C   L  ++ +++ VI  +P+A   +WD +A  +N+ LY  G
Sbjct: 83  LFSFLLMFLISSYWMFKLCKMNLQSEIKILLEVIECKPNASPHSWDIIACHMNEYLYSEG 142

Query: 140 LWNTPYCLYSGKQAYGMFK 158
            ++TP   Y G   Y  F+
Sbjct: 143 FYSTPNFFYDGSGVYRWFR 161

>YBR302C Chr2 complement(810340..811479) [1140 bp, 379 aa] {ON}
           COS2Protein of unknown function, member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 379

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 7/141 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+    L  ++     
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNCIYPLIVSL----- 77

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKVLYER 138
           LV  LG  I+      L     L+ QL      I    PS+D   W+ VA +LN  LYE 
Sbjct: 78  LVLFLGP-IFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 139 GLWNTPYCLYSGKQAYGMFKS 159
            +WNT Y  ++       F++
Sbjct: 137 NVWNTKYFFFNAMVCQEAFRT 157

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 61/164 (37%), Gaps = 33/164 (20%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           +  SW  P   ++  LP++ +R K T WF +RI +                +FM      
Sbjct: 203 TEKSWS-PVGLEDAKLPKEAYRFKLT-WFLKRISN----------------IFMLIPFLN 244

Query: 69  ELFGT-ICGGYCLV-------WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD 120
            L    +  G CL+       W L +L+       +     +  ++  +  +I  + S  
Sbjct: 245 FLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVL-IMSMEHKMQFLSTIINEQESG- 302

Query: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
              WD +A  +N+ L+E+  W      + G         W F+H
Sbjct: 303 ANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDC-----EWFFNH 341

>YML132W Chr13 (7244..8383) [1140 bp, 379 aa] {ON}  COS3Protein
           involved in salt resistance; interacts with
           sodium:hydrogen antiporter Nha1p; member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 379

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 7/141 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+    L  ++     
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNCIYPLIVSL----- 77

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKVLYER 138
           LV  LG  I+      L     L+ QL      I    PS+D   W+ VA +LN  LYE 
Sbjct: 78  LVLFLGP-IFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 139 GLWNTPYCLYSGKQAYGMFKS 159
            +WNT Y  ++       F++
Sbjct: 137 NVWNTKYFFFNAMVCQEAFRT 157

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 61/164 (37%), Gaps = 33/164 (20%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           +  SW  P   ++  LP++ +R K T WF +RI +                +FM      
Sbjct: 203 TEKSWS-PVGLEDAKLPKEAYRFKLT-WFLKRISN----------------IFMLIPFLN 244

Query: 69  ELFGT-ICGGYCLV-------WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD 120
            L    +  G CL+       W L +L+       +     +  ++  +  +I  + S  
Sbjct: 245 FLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVL-IMSMEHKMQFLSTIINEQESG- 302

Query: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
              WD +A  +N+ L+E+  W      + G         W F+H
Sbjct: 303 ANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDC-----EWFFNH 341

>YNR075W Chr14 (779916..781040) [1125 bp, 374 aa] {ON}  COS10Protein
           of unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 374

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 6/135 (4%)

Query: 24  LPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYCLVWT 83
           LP D+FR++ T W    I +               +  M ++    L  ++     L+  
Sbjct: 21  LPEDIFRNRLT-WLCSEIRNSGFWIWSLSWLPLAVWWGMASTWFYPLLTSVVLILALIAI 79

Query: 84  LGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNT 143
           L V+    SKY L N  +LT    L   +I++ P A    WDAVA   N  LYE   W T
Sbjct: 80  LPVVQIQYSKYTLSN--QLTQ---LSKEIIKSAPGAYSADWDAVAIHFNSYLYENKAWKT 134

Query: 144 PYCLYSGKQAYGMFK 158
            +  ++G      F+
Sbjct: 135 AHFFFNGTDCQEAFR 149

>YNL336W Chr14 (8330..9475) [1146 bp, 381 aa] {ON}  COS1Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 381

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 60/141 (42%), Gaps = 7/141 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+    L  ++     
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNCIYPLIVSL----- 77

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVG-VIRTRPSADQKTWDAVAYSLNKVLYER 138
           LV  LG  I+      L     L+ QL      V    PS+D   W+ VA +LN  LYE 
Sbjct: 78  LVLFLGP-IFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 139 GLWNTPYCLYSGKQAYGMFKS 159
             WNT Y  ++       F++
Sbjct: 137 KAWNTKYFFFNAMVCQEAFRT 157

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 63/165 (38%), Gaps = 33/165 (20%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           S  SW  P   ++  LP++ +R K T WF +RI +                +FM      
Sbjct: 203 SEKSWS-PVGLEDAKLPKEAYRFKLT-WFLKRISN----------------IFMLIPFLN 244

Query: 69  ELFGT-ICGGYCLV-------WTLGVLIYTSSKYHLRNC-FELTGQLALMVGVIRTRPSA 119
            L    +  G CL+       W L +L+       +     ++  ++  +  +I  + S 
Sbjct: 245 FLCCIYVSRGMCLLLRTFYLGWILFMLVQGFQNMRMIVLSVKMEHKMQFLSTIINEQESG 304

Query: 120 DQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
               WD +A  +N+ L+E+ +W      + G         W FSH
Sbjct: 305 AN-GWDEIAKKMNRYLFEKKVWKNEEFFFDGIDC-----EWFFSH 343

>YGR295C Chr7 complement(1081584..1082729) [1146 bp, 381 aa] {ON}
           COS6Protein of unknown function, member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 381

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 9/142 (6%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+ +LP+D+FRS FT + YE                   +  ++N     ++  +     
Sbjct: 23  QKTVLPQDLFRSSFTWFCYEIYKSLVFRIWMLLWLPLSVWWKLSN---NWIYPLMVSLLV 79

Query: 80  LVW-TLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKVLYE 137
           L W  + VL+     + L     L+ QL      I +  PS+D   W+ VA +LN   YE
Sbjct: 80  LFWGPVFVLVI----FRLSRKRSLSKQLTQFCKEITKNTPSSDPHDWEVVAANLNSYFYE 135

Query: 138 RGLWNTPYCLYSGKQAYGMFKS 159
              WNT Y  +S       F++
Sbjct: 136 NKAWNTKYFFFSAMSCQEAFRT 157

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 65/162 (40%), Gaps = 27/162 (16%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           S  SW  P   ++  LP++ +R K T W  +RI +                VF++ ++  
Sbjct: 203 SEKSWS-PVGLEDAKLPKEAYRFKLT-WVLKRIFNRRCLPLFLFYLHN---VFISRND-- 255

Query: 69  ELFGTICGGYCLVWTLGVLIYTSSKYHLRN------CFELTGQLALMVGVIRTRPSADQK 122
              GTI     LV    VL +  ++   RN        ++  ++  +  +I  + S    
Sbjct: 256 ---GTIARPLFLV----VLFFIMTR-DFRNMRMIVLSVKMEHKMQFLSTIINEQESG-AN 306

Query: 123 TWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
            WD +A  +N+ L+E+ +W      + G         W FSH
Sbjct: 307 GWDEIAKKMNRYLFEKKVWKNEEFFFDGIDC-----EWFFSH 343

>TBLA0E04360 Chr5 (1107926..1108534) [609 bp, 202 aa] {ON} 
          Length = 202

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 86  VLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPY 145
           +LI  ++    +    + GQL LM+ VI  +P  D + WD++   +N  L+    W    
Sbjct: 92  ILILLTAPIRKKYVLGVDGQLELMLLVIDNKPGLDLEKWDSITLQINSHLFNTHRWMNTD 151

Query: 146 CLYSGKQAYGMFK 158
            ++ GKQ   +F+
Sbjct: 152 FIFDGKQCLQLFE 164

>YJR161C Chr10 complement(742848..743999) [1152 bp, 383 aa] {ON}
           COS5Protein of unknown function, member the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 383

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 60/141 (42%), Gaps = 7/141 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+    L  ++     
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFPIWMLLWLPLSVWWKLSNNCIYPLIVSL----- 77

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVG-VIRTRPSADQKTWDAVAYSLNKVLYER 138
           LV  LG  I+      L     L+ QL      V    PS+D   W+ VA +LN  LYE 
Sbjct: 78  LVLFLGP-IFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 139 GLWNTPYCLYSGKQAYGMFKS 159
             WNT Y  ++       F++
Sbjct: 137 KAWNTRYFFFNAMGCQEAFRT 157

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 60/159 (37%), Gaps = 21/159 (13%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           +  SW  P   +++ LP+D+ RSK T WF +RI                      +    
Sbjct: 203 TEKSWS-PVGLEDVQLPKDIHRSKLT-WFLKRIFTIYSLPLWLAFLN----CICVSQHFC 256

Query: 69  ELFGTICGGY---CLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWD 125
             F  +C G     +VW    +  T+    + +      ++  ++ +I  + S     WD
Sbjct: 257 LAFRILCPGLFFLMMVWLFQNMRTTALLVKMEH------KMQFLLTIINEQESGAN-GWD 309

Query: 126 AVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
            +A  +N+ L+E+  W      + G         W FSH
Sbjct: 310 EIARKMNRYLFEKKAWKNEEFFFEGIDC-----EWFFSH 343

>YFL062W Chr6 (6426..7565) [1140 bp, 379 aa] {ON}  COS4Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 379

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 15/145 (10%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+            Y 
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNWI----------YP 72

Query: 80  LVWTLGVL----IYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKV 134
           L+ +L VL    ++    + L     L+ QL      I ++ PS+D   W+ VA +LN  
Sbjct: 73  LMVSLLVLFWGPVFVLVIFRLSRKRSLSKQLTQFCKEITKSTPSSDPHDWEVVAANLNSY 132

Query: 135 LYERGLWNTPYCLYSGKQAYGMFKS 159
           LYE   WN  Y  ++       F++
Sbjct: 133 LYENKAWNIRYFFFNAMGCQEAFRT 157

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 62/164 (37%), Gaps = 33/164 (20%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           S  SW  P   ++  LP++ +R K T WF +RI +                +FM      
Sbjct: 203 SEKSWS-PVGLEDAKLPKEAYRFKLT-WFLKRISN----------------IFMLIPFLN 244

Query: 69  ELFGT-ICGGYCLV-------WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD 120
            L    +  G CL+       W L +L+       +     +  ++  +  +I  + S  
Sbjct: 245 FLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVL-IMSMEHKMQFLSTIINEQESGA 303

Query: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
              WD +A  +N+ L+E+ +W      + G         W FSH
Sbjct: 304 N-GWDEIARKMNRYLFEKKVWKNEEFFFDGIDC-----EWFFSH 341

>Suva_1.97 Chr1 complement(160666..160809) [144 bp, 48 aa] {OFF}
           YAR027W (HSP)
          Length = 48

 Score = 40.8 bits (94), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 104 GQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLY 148
            ++ L++ VI  +P      W  +A+++N+ LY+RG W TPY  Y
Sbjct: 4   AKIKLLLEVIARKPPIVGVEWKVIAFNMNQYLYDRGYWRTPYRFY 48

>SAKL0D01254g Chr4 (95413..96000) [588 bp, 195 aa] {ON} some
           similarities with uniprot|Q07788 Saccharomyces
           cerevisiae YDL248W COS7 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 195

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%)

Query: 100 FELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
            E+T +   +  VI  +P  D + WD +AY++NK LY  G W      Y G+     FK 
Sbjct: 93  LEVTQRTRFLTNVIEAKPFTDMEKWDIIAYNMNKHLYLGGDWPRNDYFYDGENCRDTFKK 152

>KLTH0D00242g Chr4 complement(20418..21098) [681 bp, 226 aa] {ON}
           some similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 226

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 15/143 (10%)

Query: 24  LPRDVFRSKFTHWF-YERIHHX---XXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           LPRDVF +    WF YE + H                  + F    +      T+ G   
Sbjct: 23  LPRDVFHN----WFQYEVVRHKFYFAVAVIQVILFIISTHNFFQAQKNANKILTVTGA-- 76

Query: 80  LVWTLGVLIYTSSK--YHLRNCFELTG--QLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
            V+   V+IY +    + +   F  T   ++  +  +I  RP  D   WD +A   N + 
Sbjct: 77  -VYLSSVVIYFTGLIFFQVERGFVTTAANKVQFLKELITIRPGIDMIEWDILATKANTIF 135

Query: 136 YERGLWNTPYCLYSGKQAYGMFK 158
           Y   +  +PY  Y G   Y  F+
Sbjct: 136 YNESVLTSPYYFYDGASCYSFFR 158

>YDL248W Chr4 (1802..2953) [1152 bp, 383 aa] {ON}  COS7Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 383

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FRS FT + YE                   +  ++N+    L  ++     
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNCIYPLIVSL----- 77

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKVLYER 138
           LV  LG  I+      L     L+ QL      I    PS+D   W+ V  +LN  LYE 
Sbjct: 78  LVLFLGP-IFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPHDWEVVVANLNSYLYEN 136

Query: 139 GLWNTPYCLYSGKQAYGMFKS 159
             WNT    ++      MF++
Sbjct: 137 KAWNTKNFFFNATDCEKMFRT 157

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 60/159 (37%), Gaps = 21/159 (13%)

Query: 9   SGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG 68
           +  SW  P   +++ LP+D+ RSK T WF +RI                      +    
Sbjct: 203 TEKSWS-PVGLEDVQLPKDIHRSKLT-WFLKRIFTIYSLPLWLAFLN----CICVSQHFC 256

Query: 69  ELFGTICGGY---CLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWD 125
             F  +C G     +VW    +  T+    + +      ++  ++ +I  + S     WD
Sbjct: 257 LAFRILCPGLFFLMMVWLFQNMRTTALLVKMEH------KMQFLLTIINEQESG-ANGWD 309

Query: 126 AVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSH 164
            +A  +N+ L+E+  W      + G         W FSH
Sbjct: 310 EIARKMNRYLFEKKAWKNEEFFFDGIDC-----EWFFSH 343

>KLTH0B10230g Chr2 (861584..862198) [615 bp, 204 aa] {ON} some
           similarities with uniprot|P36034 Saccharomyces
           cerevisiae YKL219W COS9 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 204

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%)

Query: 103 TGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
           +  L  M  ++      + + WD +A  +N+V Y    W TPY  Y G+  +  FK++  
Sbjct: 103 SNTLHFMKEIVAVGLQMEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFKNYYL 162

Query: 163 SH 164
            H
Sbjct: 163 KH 164

>TDEL0F02400 Chr6 complement(444921..446048) [1128 bp, 375 aa] {ON} 
          Length = 375

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 118 SADQKT----WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSHI 165
           S+D++T    WD VA  LN+  Y  G W TPYCL+ G      F+ ++   I
Sbjct: 115 SSDKETLAIGWDKVASKLNRKFYNAGDWKTPYCLFDGSHCEIFFRCYVLKPI 166

>YHL044W Chr8 (13565..14272) [708 bp, 235 aa] {ON} Putative integral
           membrane protein, member of DUP240 gene family; green
           fluorescent protein (GFP)-fusion protein localizes to
           the plasma membrane in a punctate pattern
          Length = 235

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 61/144 (42%), Gaps = 3/144 (2%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMT--NSETGELFGTICGG 77
           + +ILPRD+  SK  ++  + I                  + ++   +    +   +   
Sbjct: 24  ETVILPRDITPSKCAYFLKQNIVFISYIFIHIIITIILNRLALSAHGNTLIIILAALLIT 83

Query: 78  YCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYE 137
             L   L +   + S+Y LR C +   +  L+  VI  +P+ D  TWD +AY +N+ +Y+
Sbjct: 84  ISLFLLLLLPYLSCSRYKLR-CLDDDCKFKLLAEVITHKPNMDLSTWDRIAYDMNQFVYD 142

Query: 138 RGLWNTPYCLYSGKQAYGMFKSWL 161
           R +       Y G   Y +FK  +
Sbjct: 143 RRICADRSFFYDGSYCYQVFKKLV 166

>SAKL0C10956g Chr3 (990412..990927) [516 bp, 171 aa] {ON} some
           similarities with uniprot|P53822 Saccharomyces
           cerevisiae YNL336W COS1 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 171

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 51/140 (36%), Gaps = 1/140 (0%)

Query: 19  QQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGY 78
           + + ILPRDVF +    + Y  +                 +    + +      ++  G 
Sbjct: 11  EPQPILPRDVFSNGLILFLYFLVRSSLFWVSLVLFGTSLFFAITASCQALAAL-SVVTGI 69

Query: 79  CLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYER 138
              ++L ++    S   +   F L  +   +V +    P  +   WD VA  +N  L+E 
Sbjct: 70  LFAFSLPIIATQVSGICVSRGFGLEQKTRFLVEIRDINPGMNMPKWDIVASRMNDYLFEA 129

Query: 139 GLWNTPYCLYSGKQAYGMFK 158
             +   Y LY GK     FK
Sbjct: 130 KYYRNKYALYDGKSCLDGFK 149

>Suva_12.273 Chr12 complement(443438..444577) [1140 bp, 379 aa] {ON}
           YFL062W (REAL)
          Length = 379

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 17/151 (11%)

Query: 6   DRYSGGSWDDPSVQ-QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTN 64
           D  S GS     V+ Q IILP+D+FR+ FT W + +I++                 +   
Sbjct: 8   DEKSEGSLSSKCVESQNIILPKDIFRNFFT-WLFYQIYNSLAFHFWLALWLPLIIWWKLA 66

Query: 65  SETGELFGT---ICGGYCLVWTLGVLIY--TSSKYHLRNCFELTGQLALMVGVIRTRPSA 119
            +   LF     +  G+  +  + ++      SK + + C E          +I++ P  
Sbjct: 67  GDWLYLFIAAMLMLLGFSFIPIILIICRRRAVSKQYTQFCKE----------IIKSAPGT 116

Query: 120 DQKTWDAVAYSLNKVLYERGLWNTPYCLYSG 150
           D + W+++   LN  +YE  +WN  Y  + G
Sbjct: 117 DTEDWESIVIKLNSYMYENKIWNNKYFFFDG 147

>Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W
           (REAL)
          Length = 204

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 105 QLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           ++ L+V VI   P+ + K W  + + +N+ L+  G WN PY  Y  +  +  F S +
Sbjct: 81  EIKLLVEVIAREPAVNGKEWRTITHKMNRYLFNEGKWNIPYYFYCEESCHRYFLSLI 137

>NCAS0H00970 Chr8 complement(180888..181661) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 102 LTGQLALM---VGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +TG  A M   + +I+ +P+A  K+WD +A  +N   Y  G W      YSGK+ Y  F
Sbjct: 101 ITGTQAKMKFFLEIIQYKPNATSKSWDVIAAHMNTYFYREGHWANENFFYSGKECYNWF 159

>YHL043W Chr8 (14901..15413) [513 bp, 170 aa] {ON}  ECM34Putative
           protein of unknown function; member of the DUP380
           subfamily of conserved, often subtelomerically-encoded
           proteins
          Length = 170

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPY 145
           +I++ PS D ++WD VA   N  +YE  LWNT Y
Sbjct: 134 IIKSAPSTDMESWDRVAADFNSYMYENKLWNTEY 167

>Skud_64.1 Chr64 (3..983) [981 bp, 327 aa] {ON}  YBR302C (REAL)
          Length = 327

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 6/131 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+I+LP+D+FR+ FT   YE                   +  M+++       T     C
Sbjct: 15  QKIVLPKDIFRNGFTWSCYETFKSLAFRIWLLSWLPVTTWWKMSSNWIYPFLATNLLILC 74

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
           L + L ++     K   R   +L  Q +    +I   P  D + W+++A +LN  +YE  
Sbjct: 75  LCF-LPLIEMLCRK---RALSKLPTQFS--KEIIANSPGTDVENWESIAANLNLYMYENK 128

Query: 140 LWNTPYCLYSG 150
           LW T Y  Y  
Sbjct: 129 LWKTKYFFYGA 139

>ZYRO0D00352g Chr4 (26055..27125) [1071 bp, 356 aa] {ON} weakly
           similar to uniprot|P43542 Saccharomyces cerevisiae
           YFL062W COS4 Protein of unknown function member of a
           family of conserved often subtelomerically-encoded
           proteins
          Length = 356

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 54/130 (41%), Gaps = 9/130 (6%)

Query: 24  LPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELF-GTICGGYCL-- 80
           LP DVFR +F    YE I +               +V     E  ELF G    G  L  
Sbjct: 17  LPADVFRYRFIWKIYETIKNYPWVTSQLVLYMSFLFVVEPCVEISELFIGVYLTGMFLSM 76

Query: 81  VWTLGVLIYTSSKYHLRNCFELTGQLALMVG-VIRTRPSADQKTWDAVAYSLNKVLYERG 139
           ++ L +L     +Y  R+  +    + L+   V+   P  D + WD V   +N VLY+ G
Sbjct: 77  IYILFLL-----RYICRDDSKPFSNVELLRDTVLAVDPGVDARKWDIVTSKVNYVLYDNG 131

Query: 140 LWNTPYCLYS 149
              TPY  ++
Sbjct: 132 YRRTPYYFFN 141

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 105 QLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTP-YCLYSGKQAYGMFKS 159
           ++  +   ++  P  D + WD +A  +N  L+E+G+W  P    + GK+    ++S
Sbjct: 265 RIKFLATAMQHAPGNDLEKWDHIARHMNYYLHEKGVWRRPEENFFDGKECLDFYRS 320

>NCAS0I00280 Chr9 (37829..38506) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 103 TGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           T Q      +IR RP+    TW +V  +LN+ L+  G W T YC Y  K+   ++
Sbjct: 92  TIQRVFCEEIIRNRPNKYGYTWHSVIINLNEFLFANGAWPTRYCFYDEKEILALY 146

>Smik_9.252 Chr9 complement(407060..408235) [1176 bp, 391 aa] {ON}
           YBR302C (REAL)
          Length = 391

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 59/156 (37%), Gaps = 9/156 (5%)

Query: 5   EDRYSGGSWDDPSVQ-QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMT 63
           ED  S G      ++ QE +LP+DVFR+  T + YE                   +  M+
Sbjct: 19  EDEKSVGLLSPEHLESQETVLPQDVFRNGLTWYSYEVYKSLIFRIWLLLWLPLSIWWKMS 78

Query: 64  NSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLA-LMVGVIRTRPSADQK 122
            + T   +  +   +  +    VL +    + L     L+ QL      + R  P  +  
Sbjct: 79  TNWT---YPCLASSFLFL----VLAFLPLSHSLSRDRALSKQLTEFSKAITRNAPGTNAD 131

Query: 123 TWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
            W  VA SLN  LYE   WNT Y  +        F+
Sbjct: 132 DWKNVAASLNSYLYESKAWNTRYLFFEALDCQEAFR 167

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 4/42 (9%)

Query: 120 DQKT----WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +QKT    WD +A  +NK L+E+ +W      + G      F
Sbjct: 310 EQKTGANGWDEIAKKMNKYLFEKKVWKNEEFFFDGTDCERFF 351

>SAKL0C10868g Chr3 (986125..986898) [774 bp, 257 aa] {ON} weakly
           similar to uniprot|P53822 Saccharomyces cerevisiae
           YNL336W COS1, Protein of unknown function, member of the
           DUP380 subfamily of conserved, often
           subtelomerically-encoded proteins
          Length = 257

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 62/161 (38%), Gaps = 30/161 (18%)

Query: 15  DPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTI 74
           +P V  + +LPRDVF ++FT + Y  +                 +V +    T   FG I
Sbjct: 51  EPQVGSQPVLPRDVFSNEFTFFLYFLVRDPFF------------WVSLVLFGTCLSFGII 98

Query: 75  C-GGYCLVWTLGVLIYTSSKYHLRNCF---------------ELTGQLALMVGVIRTRPS 118
               Y + W   VL + +S +     F               EL  ++  ++ +   +P 
Sbjct: 99  TLRTYSVFWP--VLFFMASFFFGSASFGAIAGVASHGISKHLELEQEIRFLIEIGDVKPG 156

Query: 119 ADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
            +   WD VA  +N  L+E G +   Y  Y G+     FK 
Sbjct: 157 INILQWDIVASRMNDYLFETGHYFGKYAFYDGRHCCNEFKE 197

>Smik_3.4 Chr3 (3476..4723) [1248 bp, 415 aa] {ON} YGL263W (REAL)
          Length = 415

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
           +I+  P  D + W+ VA + N  LYE  LWNT Y  + G      F+  L 
Sbjct: 142 IIKNTPGIDIEGWERVAVNFNSYLYENKLWNTEYYFFDGSSCQEAFRKMLL 192

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 102 LTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           L  +L  +  +      +D   W  +A   N  ++E+ +WN+P     G      FK W 
Sbjct: 323 LIHKLQFLSYITCEHEKSDATNWSQIAKRTNTYMFEQKIWNSPILFSDGIDCEKFFK-WY 381

Query: 162 FS 163
           FS
Sbjct: 382 FS 383

>YGL263W Chr7 (2790..3932) [1143 bp, 380 aa] {ON}  COS12Protein of
           unknown function, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins
          Length = 380

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           +I   P  D + W+ VA + N  LYE  LWNT Y  + G      F+  L
Sbjct: 107 IITNTPGIDTEDWERVAVNFNSYLYENKLWNTEYFFFDGSSCQEAFRKML 156

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 102 LTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           L  +L  +  +      +D   W  +A   N  ++E+ +WN+P     G      FK W 
Sbjct: 288 LIHKLQFLSYITCGHEKSDATNWSQIAKRTNTYMFEQKIWNSPILFSDGIDCEKFFK-WY 346

Query: 162 FS 163
           FS
Sbjct: 347 FS 348

>Skud_55.1 Chr55 complement(256..1125) [870 bp, 289 aa] {ON} YGR295C
           (REAL)
          Length = 289

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           +I   P      WDA+A +LN  +YE  LW T Y  + G      F++
Sbjct: 24  IIENTPGTHADDWDAIAVNLNSYMYENKLWKTEYLFFDGSHCQEAFRT 71

>Kwal_49.19404 s49 (2490..3092) [603 bp, 200 aa] {ON} [contig 369]
           FULL
          Length = 200

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 102 LTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +  ++ L   V + RPS + K W+++A  +N  ++E+GL++ PY  + G++    F
Sbjct: 107 VVARVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFF 162

>Kwal_56.22593 s56 complement(194937..195539) [603 bp, 200 aa] {ON}
           [contig 184] FULL
          Length = 200

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 102 LTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +  ++ L   V + RPS + K W+++A  +N  ++E+GL++ PY  + G++    F
Sbjct: 107 VVARVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFF 162

>Smik_18.5 Chr18 (7625..8875) [1251 bp, 416 aa] {ON}  YDL248W (REAL)
          Length = 416

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 51/132 (38%), Gaps = 8/132 (6%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           QE +LP+D+FR+KFT + YE                   +  M+ +       +I     
Sbjct: 59  QETVLPQDIFRNKFTWYSYEIYKSLAFRIWLLLWLPISVWWKMSKNWAYPFVASI----- 113

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSADQKTWDAVAYSLNKVLYER 138
               LG+     S    R    L+ QL     +I R  P  +   W  VA SLN  LYE 
Sbjct: 114 -FLFLGLAFLPCSHLLFRKR-ALSKQLTEFSKIITRNAPGTNADDWKNVAASLNSYLYES 171

Query: 139 GLWNTPYCLYSG 150
             WNT +  +  
Sbjct: 172 KAWNTRHFFFDA 183

>Skud_53.1 Chr53 complement(1..876) [876 bp, 292 aa] {ON}  YGR295C
           (REAL)
          Length = 292

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 52/139 (37%), Gaps = 6/139 (4%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           ++I+LP+DVFR+ FT + YE                      M+ +       T    Y 
Sbjct: 23  RKIVLPKDVFRNGFTWFCYETFKSLAFRIWLLSWLPVTTCWKMSTNWIYSFLAT----YL 78

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERG 139
           L+  L  L         R   +   Q +  +      P  D ++W+ +A +LN  +YE  
Sbjct: 79  LILCLFFLPLIQMSCRRRAVSKQLTQFSKEISA--NSPGTDVESWETIAANLNSYMYENK 136

Query: 140 LWNTPYCLYSGKQAYGMFK 158
           LW T Y  Y        F+
Sbjct: 137 LWKTKYFFYGAWNCQEAFR 155

>TDEL0B03200 Chr2 (564384..565469) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 118 SADQKT----WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
           S++Q+T    WD VA  LN+  Y  G W TP+C++ G +    F+ ++ 
Sbjct: 112 SSEQETLAFGWDKVASQLNRKYYTEGDWKTPHCIFDGAECESYFRRYVL 160

>KLTH0G19580g Chr7 (1693206..1694351) [1146 bp, 381 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein, member of a
           family of conserved, often subtelomerically-encoded
           proteins; regulation suggests a potential role in the
           unfolded protein response
          Length = 381

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           V R  P  + K+WD +   +N+ ++  G W + +CL+ G+  Y  F+
Sbjct: 92  VTREAPGVNVKSWDDITERINENIHSEGDWPSRFCLFEGRSCYTFFR 138

>SAKL0D15290g Chr4 (1274588..1275202) [615 bp, 204 aa] {ON} some
           similarities with uniprot|P43542 Saccharomyces
           cerevisiae YFL062W COS4 Protein of unknown function
           member of a family of conserved often
           subtelomerically-encoded proteins
          Length = 204

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 88  IYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCL 147
           +Y + ++ LR   + + ++A        +P  D + WD VA ++N+ +    LW+  +  
Sbjct: 85  MYIAGRFKLRELVKFSEEVA------EVKPGTDMERWDIVASNMNEFMQAEKLWSILHSF 138

Query: 148 YSGKQAYGMFK 158
           Y G+  +  F+
Sbjct: 139 YDGQHCFQQFR 149

>Smik_1.91 Chr1 (161600..162202) [603 bp, 200 aa] {ON} YAR028W
           (REAL)
          Length = 200

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 64/152 (42%), Gaps = 15/152 (9%)

Query: 2   SVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVF 61
           +VK D  S  S     +++ ++LP D F S   +  YE +H                 + 
Sbjct: 9   NVKLDTLSEPSAH--LIEENVVLPEDTFSSYLNYLLYELVHCKPIVILVSVITTLVLLII 66

Query: 62  MTNSETGELFGTICGGYCLV-WTLGVLIYTSSKYHLRNCFELTGQ---LALMVGVIRTRP 117
             ++        IC    ++ ++L +L       H +    +  Q   + L+V VI  +P
Sbjct: 67  PFHN------IDICAVVFMISFSLSILSLFLVVMH-KFVLPVAEQGFIIKLLVEVIAYKP 119

Query: 118 SADQKTWDAVAYSLNKVLYERGLWNTPYCLYS 149
           +     W  +A ++N+ L++  LWNTPY  ++
Sbjct: 120 AG--MAWGTIACNMNQYLFKERLWNTPYYFFT 149

>KLTH0C00264g Chr3 (12563..12979) [417 bp, 138 aa] {ON} some
           similarities with uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 138

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 77  GYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLY 136
           G  L    G+LI  + K   R   +   +L  M  +   +P  D K  D +A  +N  L 
Sbjct: 5   GLTLALITGLLINFAMK---RVATDSMMELQFMKEIAAIKPGIDMKDCDVLAARMNTYLS 61

Query: 137 ERGLWNTPYCLYSGKQAYGMFK 158
              +  TPY  Y+GK  Y  F+
Sbjct: 62  SNSVLATPYYFYNGKSCYPFFR 83

>Smik_1.93 Chr1
           (162740..162757,162761..162979,162983..163018,
           163028..163117,163121..163174) [417 bp, 139 aa] {OFF}
           YGL053W (PSEUDO)
          Length = 139

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 13/127 (10%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYV--FMTNSETGELFGTIC 75
           +++ ++LP D+F    ++ FYE  +                 +  F+    T      + 
Sbjct: 24  IKKNVVLPVDIFNLYLSYRFYEMYYCISLTFLSMVMGVSILIIIFFVITCHTLPFLADLP 83

Query: 76  GGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
           G              SS+ H++          L+V VI ++P+ ++K    +AY++N+  
Sbjct: 84  GFADFTNCSSFKTDQSSRLHIK----------LLVEVIASKPTVNEKE-KTIAYNMNQCF 132

Query: 136 YERGLWN 142
            E+GLWN
Sbjct: 133 LEKGLWN 139

>Smik_16.6 Chr16 (5125..5739) [615 bp, 204 aa] {ON} YGL263W (REAL)
          Length = 204

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           +I+  P  D + W+ VA + N  LYE  LWNT Y  +     +  F+
Sbjct: 121 IIKNTPGTDIENWERVAENFNFYLYENKLWNTKYFFFDDNSCHEAFR 167

>TBLA0B05730 Chr2 (1355413..1356048) [636 bp, 211 aa] {ON} 
          Length = 211

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 25/53 (47%)

Query: 105 QLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +L  +  + R  P ++Q  W+ +  ++N  +Y    WNTPY  Y    A   F
Sbjct: 99  KLKFLTEMKRINPGSNQLLWNQLTLNINTFIYNENYWNTPYFFYDKNSAMKYF 151

>TDEL0A06960 Chr1 (1219819..1220964) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 63/164 (38%), Gaps = 20/164 (12%)

Query: 10  GGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSE--- 66
            GS D   V   I  P++ FRSKFT   YE                    V+  +S    
Sbjct: 22  SGSTDREDVNTAI--PKNQFRSKFTWGCYEASKSYLSIALLLLVGVLLLAVYWIDSSVHF 79

Query: 67  ----TGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQK 122
               T  +   +CG   LV+  G++    S   L     ++    LM  V+    S++  
Sbjct: 80  RWFVTVMIVLILCGPLTLVF--GMIKRDKSVESL-----VSKNAILMAEVVSEILSSNHS 132

Query: 123 T----WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
           +    WD VA  LN+     G W TPYC + G     +F+ ++ 
Sbjct: 133 SSALEWDNVAARLNRDFLVTGEWRTPYCFFDGVLCESLFRRYVL 176

>KLTH0B10296g Chr2 (867082..867360) [279 bp, 92 aa] {ON} conserved
           hypothetical protein
          Length = 92

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 115 TRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS-WLFSHI 165
            +P  D + WD +A  +N  LY+     +PY  Y+G+  Y  FK+ +L  H+
Sbjct: 2   VKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFKAKYLLPHL 53

>YHL048W Chr8 (6401..7546) [1146 bp, 381 aa] {ON}  COS8Nuclear
           membrane protein, member of the DUP380 subfamily of
           conserved, often subtelomerically-encoded proteins;
           regulation suggests a potential role in the unfolded
           protein response
          Length = 381

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 58/146 (39%), Gaps = 17/146 (11%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSE-----TGELFGTI 74
           Q+ +LP+DVFR++ T WF   I+                  +  +S         L    
Sbjct: 23  QKTVLPQDVFRNELT-WFCYEIYKSLAFRIWMLLWLPLSVWWKLSSNWIHPLIVSLLVLF 81

Query: 75  CGGYCLVWTLGVLIYTS-SKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNK 133
            G + ++   G+    S SK  ++ C E+T             PS+D   W+ VA +LN 
Sbjct: 82  LGPFFVLVICGLSRKRSLSKQLIQFCKEIT----------EDTPSSDPHDWEVVAANLNS 131

Query: 134 VLYERGLWNTPYCLYSGKQAYGMFKS 159
             YE   WNT Y  ++       FK+
Sbjct: 132 YFYENKTWNTKYFFFNAMSCQKAFKT 157

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 57/140 (40%), Gaps = 15/140 (10%)

Query: 14  DDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGT 73
           + P   ++I LP++ +R K T W  +RI +               Y F+    +G     
Sbjct: 207 ESPFDLEDIQLPKEAYRFKLT-WILKRIFNLRCLPLFL-------YYFLIVYTSGN--AD 256

Query: 74  ICGGYCLVWTLGVLIYTSSKYHLRNCF---ELTGQLALMVGVIRTRPSADQKTWDAVAYS 130
           +   + L   +   I T    ++R      ++  ++  +  +I  + S     WD +A  
Sbjct: 257 LISRF-LFPVVMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESG-ANGWDEIAKK 314

Query: 131 LNKVLYERGLWNTPYCLYSG 150
           +N+ L+E+ +WN     Y G
Sbjct: 315 MNRYLFEKKVWNNEEFFYDG 334

>TBLA0E01640 Chr5 (395468..396157) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 104 GQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           GQ+ L+  V + +PS   + WD +A  LN  LYE   +      Y+GKQ   +F+
Sbjct: 105 GQMKLLAEVTKYKPSLYIEKWDLIASHLNDYLYEMNAFPDREFFYNGKQCMHLFQ 159

>Suva_14.7 Chr14 (7591..8013) [423 bp, 140 aa] {ON} YJR161C (REAL)
          Length = 140

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
            I + P  + + W+A+  +LN  +YE  LWN  Y  + G+     F+
Sbjct: 31  TIESAPGTETEEWEAIVINLNSYMYENKLWNNRYFFFDGRSCQQSFR 77

>Suva_1.98 Chr1 complement(160845..161072,161076..161162) [315 bp,
          105 aa] {OFF} YCR007C (HSP)
          Length = 105

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%)

Query: 14 DDPSVQQEIILPRDVFRSKFTHWFYERIH 42
          D P + ++I+LP DVF+S FT+++YE  H
Sbjct: 34 DAPLISEDIVLPEDVFKSYFTYFYYEWTH 62

>NCAS0C03030 Chr3 (596013..596771) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 70  LFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAY 129
           +FG       + W  G+LI    K   ++  + +  L+L   +I   P++   +WD    
Sbjct: 119 IFGIFYTLPFIFW-YGLLILL--KIDKKDSVKESQPLSLFKEIIDRTPNSTTASWDITTS 175

Query: 130 SLNKVLYERGLWNTPYCLYSGKQAYGMF 157
            LN +LYE   W T Y ++ GK+ +  F
Sbjct: 176 HLNDMLYEGKKWPTKYMMWDGKECHAWF 203

>Smik_16.462 Chr16 complement(798062..799213) [1152 bp, 383 aa] {ON}
           YBR302C (REAL)
          Length = 383

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 8/148 (5%)

Query: 2   SVKEDRYSGGSWDDPSVQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVF 61
           ++++++  G S       QE +LP+D+FR+KFT + YE                   +  
Sbjct: 17  NIEDEKSMGLSSPKHLESQETVLPQDIFRNKFTWYSYEIYKSLAFRIWLLLWLPLSVWWK 76

Query: 62  MTNSETGELFGTICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVI-RTRPSAD 120
           M+         +I         L   + T S  H R    L+ QL     +I +  PS +
Sbjct: 77  MSTDWVYPFLTSIFLLL----GLFFPLLTQSLSHDR---ALSKQLTEFSKIITKNAPSMN 129

Query: 121 QKTWDAVAYSLNKVLYERGLWNTPYCLY 148
              W +VA + N  LYE   WNT +  +
Sbjct: 130 TDDWKSVAANFNSYLYESKAWNTRHFFF 157

>Skud_1.80 Chr1 (152939..152944,152948..153196,153443..153919) [732
           bp, 243 aa] {ON} YGL053W (REAL)
          Length = 243

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 16/130 (12%)

Query: 18  VQQEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGG 77
           ++  + LP D+F S  ++  YE  H+                V M       +F      
Sbjct: 108 IEDNVALPEDIFSSYPSYLLYELAHYKPTMSLFM--------VLMILISLTVVFRE--NF 157

Query: 78  YCLVWTLG--VLIYTSSKYHL----RNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSL 131
            CLV  L   VLI   S   L        E   Q+ L++ VI  +P+   + W  + Y++
Sbjct: 158 TCLVIFLASIVLICCLSPVALCPFEEQISEELYQIKLLLEVITRKPAVRGREWRTITYNM 217

Query: 132 NKVLYERGLW 141
           N+ L++ GLW
Sbjct: 218 NQYLFDNGLW 227

>TDEL0D00660 Chr4 complement(115547..116641) [1095 bp, 364 aa] {ON} 
          Length = 364

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 124 WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           WD VA  LN+  Y  G W TPYC++ G +    F+
Sbjct: 125 WDKVASVLNRKFYVAGDWKTPYCIFDGAKCESYFR 159

>KLLA0C19063g Chr3 complement(1692492..1693121) [630 bp, 209 aa]
           {ON} conserved hypothetical protein
          Length = 209

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 116 RPS-ADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
           +PS  D K WD VA  +NK LYE G W      Y GK+   MF
Sbjct: 128 KPSYIDMKQWDIVARVVNKHLYEAGSWPNNRFFYDGKRCQAMF 170

>Smik_9.248 Chr9 complement(405227..405625) [399 bp, 132 aa] {ON}
           YJR161C (REAL)
          Length = 132

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           ++      + ++W++VA + N  LYE  LWNT Y  + G   +  F+
Sbjct: 20  IVENTAGTEIESWESVAGNFNSYLYENKLWNTKYFFFDGPSCHEAFR 66

>Smik_4.183 Chr4 (337090..337404) [315 bp, 105 aa] {OFF} YAR023C
           (HSP)
          Length = 105

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 124 WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           W  + Y++N+ L+ + LW TPY  +   + Y  FK+
Sbjct: 1   WKTITYNMNEYLFNKDLWKTPYYFFDEHECYEFFKT 36

>KLLA0A11957g Chr1 (1041208..1041834) [627 bp, 208 aa] {ON}
           conserved hypothetical protein
          Length = 208

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 65  SETGELFGTICGGYCLV---WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQ 121
           SE G +  ++    CL+    T+  +I T ++  L N  +         G+   +  A  
Sbjct: 77  SEDGAIVCSVLICVCLLVMGATMLFMILTPTQEILHNPDD---------GLFFLKLIATG 127

Query: 122 KTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMF 157
            +W+ +   +N  L++RGLW +  C+Y G+Q Y +F
Sbjct: 128 YSWEQIGRIMNSYLFQRGLWWSNSCIYDGQQCYVLF 163

>Suva_16.529 Chr16
           complement(913015..913104,913108..913224,913228..913527)
           [507 bp, 169 aa] {OFF} YFL062W (HSP)
          Length = 169

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 59/144 (40%), Gaps = 15/144 (10%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETG-ELFGTICGGY 78
           Q I+LP+D+FR+ FT + Y+                   +  ++    G  L   +C   
Sbjct: 22  QNIVLPKDIFRNIFTWFCYQIYKTLAFRIWLLLWLPLGVWWEISGRWNGYPLVAAMCMDV 81

Query: 79  CLV-WTLGVLIYT--SSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVL 135
            L+ + + ++IY   +   H++ C E          +IR+ P  D + W+ +  + N  +
Sbjct: 82  ALLTFPINMIIYRKHAVSKHIQFCKE----------IIRSVPGTDIEDWEPIVLTFNSYM 131

Query: 136 YERGLWNTPYCLYSGKQAYGMFKS 159
           Y    WN  +  +   + Y  F+ 
Sbjct: 132 YGNKFWNKVF-FFDVPRCYESFRK 154

>Kwal_26.9047 s26 (1053474..1053833) [360 bp, 119 aa] {ON} YHL048W
           (COS8) - similar to other subtelomerically-encoded
           proteins [contig 68] FULL
          Length = 119

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 79  CLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYER 138
            ++  +GV++Y   K       ++  +L  +  +   +P A  + W+ VA  +NK +YE 
Sbjct: 3   IVLLLIGVVLYPRMKI---KEMKIEERLKFLKTISLVKPHAQIEGWNIVAKRMNKYMYEE 59

Query: 139 GLWNTPYCLYSGKQAYGMFK 158
             W+     Y+G+     FK
Sbjct: 60  KGWHNREFFYNGEDCLNAFK 79

>Suva_1.95 Chr1 complement(158136..158255) [120 bp, 40 aa] {OFF}
          YAR028W (HSP)
          Length = 40

 Score = 33.5 bits (75), Expect = 0.018,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 16 PSVQQEIILPRDVFRSKFTHWFYE 39
          P + + + LP D+FR++F+H  YE
Sbjct: 15 PLITENVALPEDIFRARFSHLLYE 38

>Suva_1.78 Chr1 complement(138943..139005,139009..139113) [168 bp,
           56 aa] {OFF} YAR027W (HSP)
          Length = 56

 Score = 33.9 bits (76), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 106 LALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTP 144
           + L+V VI  R    +  W A+A +LN+ L++  LWNTP
Sbjct: 19  IKLLVEVI-ARKQVLKGEWKAIACNLNQYLFDNDLWNTP 56

>TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON} 
          Length = 153

 Score = 35.4 bits (80), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 50/131 (38%), Gaps = 10/131 (7%)

Query: 23  ILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXX--XXYVFMTNSETGELFGTICGGYCL 80
           +LPR++F    + W Y  I++                 Y F   S+   +   I G   +
Sbjct: 20  LLPREIF----SKWSYVLINYKVFSSLLALELLFFGSLYCFEIRSKDIAILTFIIGIILV 75

Query: 81  VWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGL 140
            +T G + Y  S+           +L  +  V   RP  D + W+ VA  LN + Y+   
Sbjct: 76  AFT-GFITYLCSR---DTGLTDENKLVFLKEVTVARPGIDNERWNVVARRLNPIFYQNSR 131

Query: 141 WNTPYCLYSGK 151
             T Y  Y G+
Sbjct: 132 SATAYFFYDGE 142

>TDEL0A01190 Chr1 complement(200994..202103) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 118 SADQKT----WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           S++Q+T    WD VA  LN+  Y  G W TPY  + G+Q    F+
Sbjct: 118 SSEQETLALGWDNVACRLNRKFYAAGEWKTPYYYFDGQQCEDYFR 162

>Smik_9.244 Chr9 complement(403860..404315) [456 bp, 151 aa] {ON}
           YAR028W (REAL)
          Length = 151

 Score = 35.4 bits (80), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 99  CFELTG----QLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAY 154
           CFE       ++ L++ +   +P+   K W  +A+S+N+ L+  GLW+  Y  Y  ++  
Sbjct: 47  CFERINDRDFRIELLMEITTRKPAG--KKWRTIAHSVNQDLFNEGLWHRTYYFYCDRECQ 104

Query: 155 GMF 157
             F
Sbjct: 105 SFF 107

>Skud_107.1 Chr107 (3..590) [588 bp, 196 aa] {OFF} YKL219W (HSP)
          Length = 196

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 19/39 (48%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSG 150
           +I   P  D + W+ +A +LN  +YE   W T Y  Y  
Sbjct: 13  IIANSPGTDVENWEPIAANLNSYMYENKFWKTKYFFYDA 51

>Skud_8.1 Chr8 (1116..2270) [1155 bp, 384 aa] {ON} YHL048W (REAL)
          Length = 384

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           +I++ P      W+A A + N  ++E  LWNT Y  + G      F++
Sbjct: 109 IIKSSPGIHVDDWEATAANFNSFMHENRLWNTEYFFFDGLSCQEAFRT 156

>Smik_1.89 Chr1 (159430..160005) [576 bp, 191 aa] {ON} YAR027W
           (REAL)
          Length = 191

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 105 QLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           ++ L++ VI  +P+   K W  + + +   L +  L NTPY  Y  K+    F+S +
Sbjct: 62  KVKLLLEVITCKPAVKGKEWRIITHIMIHYLLDNSLLNTPYYFYCEKKCSKFFESLV 118

>KLTH0B10274g Chr2 (865279..865761) [483 bp, 160 aa] {ON} conserved
           hypothetical protein
          Length = 160

 Score = 33.9 bits (76), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 117 PSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           P  + K    VA  +N VL++  L  TPY  Y G+  Y  F++
Sbjct: 59  PGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDGESCYSCFRN 101

>TDEL0A01180 Chr1 complement(200029..200700) [672 bp, 223 aa] {ON} 
          Length = 223

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 124 WDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLFSHI 165
           WD VA  LN+  Y+ G W T    + G    G FK ++   I
Sbjct: 120 WDKVACRLNRKFYDAGDWKTLNLFFDGSNCEGFFKMYVLKPI 161

>Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {ON}
           YKL048C (REAL)
          Length = 643

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 82  WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLW 141
           +TLGV   +    H+R  +  T    + + +I  +P      W+A  YS+N+V+ +  LW
Sbjct: 88  YTLGVSAGSGQFGHVRKAYSSTSNKVVAIKIIPKKP------WNAQQYSMNQVMRQIQLW 141

Query: 142 NT 143
            +
Sbjct: 142 KS 143

>KLTH0A00264g Chr1 complement(21453..21722) [270 bp, 89 aa] {ON}
           conserved hypothetical protein
          Length = 89

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 21/29 (72%)

Query: 131 LNKVLYERGLWNTPYCLYSGKQAYGMFKS 159
           +N++LY  G W +P C++ G+Q + +F++
Sbjct: 1   MNELLYSSGKWPSPRCVFEGEQCHFIFQN 29

>Suva_1.93 Chr1 complement(157916..157996) [81 bp, 27 aa] {OFF}
           YGL053W (HSP)
          Length = 27

 Score = 30.4 bits (67), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 122 KTWDAVAYSLNKVLYERGLWNTPYCLY 148
           + W ++   +N+ L+E GLW TPY  Y
Sbjct: 1   EEWRSITNIMNQYLFENGLWKTPYYFY 27

>ZYRO0C18590g Chr3 complement(1460662..1461690) [1029 bp, 342 aa]
           {ON} weakly similar to uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 342

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 36/88 (40%), Gaps = 2/88 (2%)

Query: 77  GYCLVWTLGVLIYT-SSKYHLRNCFELTGQLALMV-GVIRTRPSADQKTWDAVAYSLNKV 134
           GY     +G+L +    ++ +R    L+    +    V+   P  D K W  VA  +N  
Sbjct: 55  GYIGAVVIGLLFFLLRHQFRIRKDKVLSNTKEMFSRNVLAVNPGLDTKKWHEVASKMNNE 114

Query: 135 LYERGLWNTPYCLYSGKQAYGMFKSWLF 162
            YE+  W + +    G + +  F+  + 
Sbjct: 115 FYEQDYWRSRHFFCDGDECHNSFREHIL 142

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 101 ELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYS-GKQAYGMFKS 159
           ++T ++  +  V+   P  D + WD +A  +N  L   G+W   +  ++ GK+    ++S
Sbjct: 252 DITQRVKFLATVMHFAPGDDLEKWDRIASHMNWYLRVEGIWTHAHEKFADGKECLDFYES 311

>Smik_17.8 Chr17 complement(5956..6321) [366 bp, 122 aa] {OFF}
           YJR161C (HSP)
          Length = 122

 Score = 32.0 bits (71), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 8/127 (6%)

Query: 20  QEIILPRDVFRSKFTHWFYERIHHXXXXXXXXXXXXXXXYVFMTNSETGELFGTICGGYC 79
           Q+ +LP+++FR+KFT + YE I+                  + T+++    F      + 
Sbjct: 1   QKTVLPQEIFRNKFTWYSYE-IYKSLAFRILLLLWLPLGVWWKTSTDWTYPFVVSIFLFL 59

Query: 80  LVWTLGVLIYTSSKYHLRNCFELTGQLALMVG-VIRTRPSADQKTWDAVAYSLNKVLYER 138
            +  L +    S K        L+ QL      + +  P  D   W+ VA +LN   Y  
Sbjct: 60  GLAFLLLAQLLSRKR------ALSKQLTQFSKEITKNTPGTDPSDWEVVATNLNSYFYRN 113

Query: 139 GLWNTPY 145
             WNT Y
Sbjct: 114 KTWNTKY 120

>Skud_1.85 Chr1 (156117..156233) [117 bp, 39 aa] {OFF} YGL053W (HSP)
          Length = 39

 Score = 30.0 bits (66), Expect = 0.35,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 140 LWNTPYCLYSGKQAYGMFKS 159
           LWNTPY  YS K+++G F +
Sbjct: 1   LWNTPYHFYSDKKSHGFFTT 20

>ZYRO0F18700g Chr6 complement(1550815..1551843) [1029 bp, 342 aa]
           {ON} weakly similar to uniprot|P53053 Saccharomyces
           cerevisiae YGL263W COS12 Protein of unknown function
           member of a family of conserved often subtelomerically-
           encoded proteins
          Length = 342

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 22/52 (42%)

Query: 111 GVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSWLF 162
            V+   P  D K W  VA  +N   YE+  W + +    G + +  F+  + 
Sbjct: 91  NVLAVNPGLDTKKWHEVASKMNNEFYEQDYWRSRHFFCDGDECHNSFREHIL 142

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 101 ELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLY-SGKQAYGMFKS 159
           ++T ++  +  V+   P  D + WD +A  +N  L   G+W   +  +  GK+    ++S
Sbjct: 252 DITQRVKFLATVMHFAPGDDLEKWDRIASHMNWYLRVEGIWTHAHEKFPDGKECLDFYES 311

>Smik_1.101 Chr1 (166879..167193) [315 bp, 104 aa] {ON} YAR027W
           (REAL)
          Length = 104

 Score = 30.4 bits (67), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 131 LNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           +N+ L +  LWNTPY  YS K+    FK
Sbjct: 1   MNQYLLDNTLWNTPYYFYSEKKCSKFFK 28

>Skud_11.1 Chr11 (2..898) [897 bp, 298 aa] {ON}  YKL219W (REAL)
          Length = 298

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 18/39 (46%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSG 150
           +I   P  D + W+ +A ++N  +Y    W T Y  Y  
Sbjct: 29  IIANSPGTDVENWETIAANINSYMYVNKFWKTKYFFYGA 67

>KLTH0B06710g Chr2 (538970..540142) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein member of a family
           of conserved often subtelomerically-encoded proteins
           regulation suggests a potential role in the unfolded
           protein response
          Length = 390

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 21/47 (44%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           V+   P    + WD VA  LN  L+  G W     L+ G   + +F+
Sbjct: 106 VLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFR 152

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 20/55 (36%)

Query: 106 LALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFKSW 160
           + L   ++   P  D   WD VA  +NK L            Y G+     FK W
Sbjct: 303 MELWATIVAVEPRGDTSEWDRVASHMNKYLVTASAAGRAAQFYDGENCMQRFKKW 357

>Smik_1.98 Chr1
           (165490..165567,165571..165675,165679..165780,
           165777..165824,165828..165917,165921..165965,
           165971..166084) [582 bp, 194 aa] {OFF} YGL053W (PSEUDO)
          Length = 194

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 8/89 (8%)

Query: 74  ICGGYCLVWTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSAD-QKTWDAVAYSLN 132
           I  G  LV ++  L  T    H+        ++ L++ V+  +P    +K W  + Y++ 
Sbjct: 53  ISCGLALVCSMAHLYPTVPMNHV------NFRMKLLLDVVTHKPVVKGKKEWRTITYNVK 106

Query: 133 KVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           + L++ GLW+T Y  YS +     F S +
Sbjct: 107 QYLFD-GLWHTQYHFYSQQDRCRYFLSLI 134

>ZYRO0E00440g Chr5 (28214..29269) [1056 bp, 351 aa] {ON} weakly
           similar to uniprot|P38723 Saccharomyces cerevisiae
           YHL048W COS8 Nuclear membrane protein member of a family
           of conserved often subtelomerically-encoded proteins
           regulation suggests a potential role in the unfolded
           protein response
          Length = 351

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 21/47 (44%)

Query: 112 VIRTRPSADQKTWDAVAYSLNKVLYERGLWNTPYCLYSGKQAYGMFK 158
           V+   P  +   W   A  +N  LYE+G W T    ++ K+    F+
Sbjct: 109 VLAVDPGVEATKWREAASKMNTALYEQGFWKTLNFFFNEKECRDGFR 155

>YIR043C Chr9 complement(437043..437735) [693 bp, 230 aa] {OFF}
           Possible pseudogene in strain S288C; YIR043C and the
           adjacent ORF, YIR044C, together may encode a
           non-functional member of the conserved, often
           subtelomerically-encoded Cos protein family
          Length = 230

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 124 WDAVAYSLNKVLYERGLWNTPYCLYSG 150
           WD +A  +N+ L+E+ +WN     Y G
Sbjct: 160 WDEIAKKMNRYLFEKKVWNNEEFFYDG 186

>YAR029W Chr1 (186321..186545) [225 bp, 74 aa] {ON} Member of DUP240
           gene family but contains no transmembrane domains; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 74

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 20/31 (64%)

Query: 131 LNKVLYERGLWNTPYCLYSGKQAYGMFKSWL 161
           +NK L++  +W+TPY  Y  +  + +F S++
Sbjct: 1   MNKYLFDHKIWSTPYYFYCEEDCHRLFLSFI 31

>YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON}
           ELM1Serine/threonine protein kinase that regulates
           cellular morphogenesis, septin behavior, and
           cytokinesis; required for the regulation of other
           kinases; forms part of the bud neck ring
          Length = 640

 Score = 29.6 bits (65), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 82  WTLGVLIYTSSKYHLRNCFELTGQLALMVGVIRTRPSADQKTWDAVAYSLNKVLYERGLW 141
           +TLGV   +    ++R  +  T    + V +I  +P      W+A  YS+N+V+ +  LW
Sbjct: 88  YTLGVSAGSGQFGYVRKAYSSTLGKVVAVKIIPKKP------WNAQQYSVNQVMRQIQLW 141

Query: 142 NT 143
            +
Sbjct: 142 KS 143

>Smik_11.1 Chr11 (1..498) [498 bp, 165 aa] {OFF} YBR302C (HSP)
          Length = 165

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 120 DQKT----WDAVAYSLNKVLYERGLWNTPYCLYSG 150
           +QKT    WD +A  +N+ L+E+ +W      + G
Sbjct: 84  EQKTGANGWDEIAKKMNRYLFEKKVWKNEEFFFDG 118

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score = 29.3 bits (64), Expect = 6.3,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%)

Query: 81  VWTLGVLIYTSSKYHLRNCFELTGQLALM 109
           +W LGVL+Y    Y     FELTGQ A++
Sbjct: 290 IWALGVLLYKLLFY--TTPFELTGQFAIL 316

>KNAG0A05740 Chr1 (857368..859917) [2550 bp, 849 aa] {ON} 
          Length = 849

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 70  LFGTICGGYCLVWTLGVLIYTSS---KYHLRNCFELTGQLALMVGVI 113
           +FG +C    + W LG  I   S   ++HL +  +L G    M  +I
Sbjct: 605 VFGVVCASELIAWQLGKSILQDSYLIRFHLESVEDLLGYATFMTPLI 651

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.463 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,517,262
Number of extensions: 566379
Number of successful extensions: 1899
Number of sequences better than 10.0: 147
Number of HSP's gapped: 1872
Number of HSP's successfully gapped: 182
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)