Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034408.844ON1053105352990.0
KAFR0A028508.844ON1042103218500.0
TDEL0B005408.844ON1115109316590.0
NCAS0B002808.844ON1081104916440.0
Skud_13.248.844ON1128113316270.0
Suva_13.268.844ON1122100615670.0
Smik_13.178.844ON1131100615580.0
CAGL0B02365g8.844ON1050107315350.0
TPHA0I002708.844ON1039100714570.0
KLTH0C03784g8.844ON997102414400.0
ZYRO0G14256g8.844ON125973214021e-174
Kwal_27.102398.844ON91499813731e-173
Ecym_46158.844ON1067103812651e-156
SAKL0D01364g8.844ON108284812371e-151
YML117W (NAB6)8.844ON113467411081e-132
NDAI0E002708.844ON119850410931e-130
Kpol_1068.58.844ON103251010591e-126
KLLA0D01485g8.844ON11517029911e-115
ABL122C8.844ON10436349411e-109
TBLA0B032808.844ON13623058822e-99
KLLA0E19031g6.183ON6522044604e-47
NCAS0H010406.183ON6292024542e-46
AFL061C6.183ON5232074437e-46
Ecym_22336.183ON5762084468e-46
KNAG0M004306.183ON4432014291e-44
KLTH0H04906g6.183ON5692054254e-43
KAFR0B066906.183ON5332024216e-43
Kpol_1002.696.183ON5902024238e-43
TBLA0B052106.183ON7102244289e-43
Kwal_27.111586.183ON5672044211e-42
TDEL0G016206.183ON5842024212e-42
SAKL0A05280g6.183ON5822064202e-42
CAGL0C01419g6.183ON6392024232e-42
NDAI0F022606.183ON6802024224e-42
TPHA0J022106.183ON5932084132e-41
Smik_6.3906.183ON6252024115e-41
ZYRO0G08140g6.183ON6322034098e-41
YPL184C (MRN1)6.183ON6122024081e-40
Suva_16.1236.183ON5962024033e-40
Skud_16.946.183ON6142024035e-40
ZYRO0C05060g6.104ON71690870.15
CAGL0H10604g2.306ON41695850.21
TBLA0C018208.670ON39466840.22
Kwal_26.87638.670ON42666830.31
TDEL0G036706.104ON61782781.4
NDAI0F01720singletonON47493771.6
NCAS0B016008.670ON373210771.9
NCAS0I009903.379ON300122752.3
TPHA0D012108.670ON364215762.4
KAFR0D016608.797ON21273733.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03440
         (1053 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...  2045   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   717   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   643   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     637   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   631   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   608   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   604   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   595   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   565   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   559   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   544   e-174
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   533   e-173
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   491   e-156
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   481   e-151
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   431   e-132
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     425   e-130
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   412   e-126
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   386   e-115
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   367   e-109
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   344   2e-99
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   181   4e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   179   2e-46
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   175   7e-46
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   176   8e-46
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   169   1e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   168   4e-43
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   166   6e-43
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   167   8e-43
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   169   9e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   166   1e-42
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   166   2e-42
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   166   2e-42
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   167   2e-42
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    167   4e-42
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   163   2e-41
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   162   5e-41
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   162   8e-41
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   161   1e-40
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   159   3e-40
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   159   5e-40
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    38   0.15 
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...    37   0.21 
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    37   0.22 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    37   0.31 
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    35   1.4  
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    34   1.6  
NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {O...    34   1.9  
NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 ...    33   2.3  
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    34   2.4  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    33   3.8  

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score = 2045 bits (5299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 997/1053 (94%), Positives = 997/1053 (94%)

Query: 1    MDFQLKRNNAQHGYNQNHPGFTQDSVNNRDAENSGPRPTYPQVMYQFNQNTHGYPQGTVS 60
            MDFQLKRNNAQHGYNQNHPGFTQDSVNNRDAENSGPRPTYPQVMYQFNQNTHGYPQGTVS
Sbjct: 1    MDFQLKRNNAQHGYNQNHPGFTQDSVNNRDAENSGPRPTYPQVMYQFNQNTHGYPQGTVS 60

Query: 61   KQAPLSQQSHXXXXXXXXXXXXXXXMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP 120
            KQAPLSQQSH               MTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP
Sbjct: 61   KQAPLSQQSHPFPQNFAQNFPPNSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP 120

Query: 121  QTNYTAQRKGSHTGMANGTGSMNYYRTDPQIINGLFQIPFEISYKILPKGDDLYRTRSLL 180
            QTNYTAQRKGSHTGMANGTGSMNYYRTDPQIINGLFQIPFEISYKILPKGDDLYRTRSLL
Sbjct: 121  QTNYTAQRKGSHTGMANGTGSMNYYRTDPQIINGLFQIPFEISYKILPKGDDLYRTRSLL 180

Query: 181  LGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQR 240
            LGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQR
Sbjct: 181  LGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQR 240

Query: 241  LKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSI 300
            LKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSI
Sbjct: 241  LKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSI 300

Query: 301  AIEFVDKDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSI 360
            AIEFVDKDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSI
Sbjct: 301  AIEFVDKDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSI 360

Query: 361  PMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKK 420
            PMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKK
Sbjct: 361  PMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKK 420

Query: 421  DQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSE 480
            DQEFFPNN              ADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSE
Sbjct: 421  DQEFFPNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSE 480

Query: 481  HSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPP 540
            HSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPP
Sbjct: 481  HSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPP 540

Query: 541  GFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPITDSLESQMKTSTQVATAMGSDF 600
            GFIPATPSGPMSP              DHAGGKFAHPITDSLESQMKTSTQVATAMGSDF
Sbjct: 541  GFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDF 600

Query: 601  NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID 660
            NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID
Sbjct: 601  NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID 660

Query: 661  PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE 720
            PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE
Sbjct: 661  PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE 720

Query: 721  SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLF 780
            SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLF
Sbjct: 721  SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLF 780

Query: 781  DHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERRE 840
            DHRYEGLVINYGKDRCGNINRNLVAG             RDVRLSQLEEKRRNQDAERRE
Sbjct: 781  DHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERRE 840

Query: 841  MVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGS 900
            MVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGS
Sbjct: 841  MVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGS 900

Query: 901  YTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEV 960
            YTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEV
Sbjct: 901  YTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEV 960

Query: 961  SSPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDV 1020
            SSPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDV
Sbjct: 961  SSPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDV 1020

Query: 1021 MAQYLAQLQHSTFMYAANVLGASNEGTEQYDDQ 1053
            MAQYLAQLQHSTFMYAANVLGASNEGTEQYDDQ
Sbjct: 1021 MAQYLAQLQHSTFMYAANVLGASNEGTEQYDDQ 1053

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1032 (44%), Positives = 591/1032 (57%), Gaps = 132/1032 (12%)

Query: 86   MTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLP------------------------- 120
            + N  PTPFDTAYGATLLPSHLLMGSPF+S+PN+P                         
Sbjct: 70   LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNNGSSTPRK 129

Query: 121  ------------QTNYTAQRKGSHTGMANGTGSMNYYRTDPQIINGLFQIPFEISYKILP 168
                        +++  ++++ S       T + N    + +I+  LF  P  ISY ILP
Sbjct: 130  SFFKVSNRPISSRSSRFSEKRKSFIINNPTTNNSNNNNNNKEILEKLFTEPINISYVILP 189

Query: 169  KGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQ 228
            KGDD YRTRSLL  N+D+ ++LH+F++ FV+NNS+ES+Y+            +LSFLS  
Sbjct: 190  KGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCDIILSFLSRH 249

Query: 229  ICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHF 288
            ICL+FYNNVLQRLKEFK+ L + SL L+FVS++   T             D  G  +L F
Sbjct: 250  ICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKT-----------TRDNQG-PSLEF 297

Query: 289  DMAAQTGATRSIAIEFVDKD---VILTRDELLNKKLKFL--SEGNNRYILEHIAVFKTQH 343
            ++  +  ATRS+AIE    +   +IL +++L  K L  +  ++ N RY+LE I +  T  
Sbjct: 298  NIVTR-DATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDK 356

Query: 344  GTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPH 403
              K FGKNYAI++FL+I MA+EIMDY+++   +L++ K  +V +  P  ++   +     
Sbjct: 357  SNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTI-QPLIENNVMNNSSAL 415

Query: 404  ANDTESNRDTSPPNSKKD----QEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQ 459
            ++ T      S   +         FF  N               ++V  + +KLK I+L+
Sbjct: 416  SSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGIKLK 475

Query: 460  ESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGS 519
            + +L +   DYPEP F   ++H   +  S+P  Q   I G      TPR    + ND+ S
Sbjct: 476  DISLDILPRDYPEPEFNFSTDHLPNVTISVPT-QLDQIPG------TPRTQEIYINDM-S 527

Query: 520  PPASFLPLDLNHSNSVPNLPPG-FIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPI 578
            P  SF  +D+ +S+S      G FI  TP   +                      F HPI
Sbjct: 528  P--SFEGIDMMNSSSTMLSGNGTFISNTPM-LIPSQSFYMDQNTQIQEAPFRSNSFIHPI 584

Query: 579  TDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKH 638
            TDSLE+Q+ TS +VA+AMGSD  NRTIYIGNINPRS+AEDICNVVRGGILQ+IKFIE+KH
Sbjct: 585  TDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKH 644

Query: 639  ICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYI 698
            ICF+TFIEA+AAVQFYANAFIDPIVLHGNTLKLGWG Y+GPLPK IALAVTIGASRNVY+
Sbjct: 645  ICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYV 704

Query: 699  SLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMN 758
            SLPE AFKDKYI DP+FK YHE FKLP  E LR DF  YG  EQIN L+DSHCCWVNFMN
Sbjct: 705  SLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMN 764

Query: 759  ISSAIRLVEDASTKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXX 818
            ISSAI+LVE+A+   D FN+ FD RY GLVINYGKDRCGNIN+NL+AG            
Sbjct: 765  ISSAIKLVEEATNDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAG--KNSRFYKIRQ 822

Query: 819  XRDVRLSQLEEKRRNQDAERREMVNG---------TIPEENPFDAFAINTGSAEKKDE-L 868
              + +LS+LEEKRR+ D  RRE  NG         TI  E+       N  S E   + L
Sbjct: 823  NHNFKLSKLEEKRRDHD--RRE--NGFKHVYNDEETIYNESMETDNQHNEESKENDGKFL 878

Query: 869  SLDSLGISIMEVESASPISPVMGD---LEDHTNGSYTDAGIAPLNYTNNSGSSSDIELII 925
             LDSLGIS+   ES + I+  + D   ++   N           N + +S SSSDIELII
Sbjct: 879  QLDSLGISL---ESKNEIADDINDALTVDQFENEKSITKNNGFENTSFHSDSSSDIELII 935

Query: 926  NPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPDTISRQYAEASYHNEL 985
            N PN       +   D   L    D  K++            + +T +R      Y N+ 
Sbjct: 936  NSPN------SLRTKDNDVL----DSEKIIN-----------SANTTNRTGNANGYKND- 973

Query: 986  VTGNDHPDTGYGKAENG----RHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLG 1041
                      Y K  N        +   R +RTIPGSDVMAQYLAQLQHSTFMYAAN+LG
Sbjct: 974  ----------YTKNRNDGMRNNRSRNRSRYSRTIPGSDVMAQYLAQLQHSTFMYAANILG 1023

Query: 1042 ASNEGTEQYDDQ 1053
            AS  G E+Y D+
Sbjct: 1024 AS--GEEEYYDE 1033

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1093 (37%), Positives = 580/1093 (53%), Gaps = 159/1093 (14%)

Query: 86   MTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNL------------PQTNYTAQRKGSHT 133
            + N  PTPFDTAYG TLLPSHLLMGSPFVS+PNL                Y+  +  S +
Sbjct: 53   VMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSSS 112

Query: 134  GMANGTGSMNY-----YRTDPQIINGL----------------------FQIPFEISYKI 166
            G + G  +  Y       + P   N L                      F+ PF ++Y++
Sbjct: 113  GRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRV 172

Query: 167  LPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLS 226
            LPKG+D +RTRSLL  N+D  +DLH+FV+ F     VESVY+ K   + +    LLSF S
Sbjct: 173  LPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFK--SEGDHVSILLSFFS 230

Query: 227  VQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGM--- 283
              ICL+FYN+VLQRL E+K  L + +L LSFVS+  + +    +   +      D     
Sbjct: 231  KAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPDAFNIT 290

Query: 284  --ANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNN-RYILEHIAVFK 340
               +L +D+  + GATRSI I F       ++DEL++KKL+FL + NN RY+LE I +  
Sbjct: 291  AAGSLRYDVINR-GATRSIMITF---KTPCSKDELIDKKLEFLKKENNTRYVLESIDLVT 346

Query: 341  TQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQK 400
                +K F +NYA++TFL+I MA+EI+DY++L+ ++L ++K F++ +   PQ        
Sbjct: 347  ADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQ--PQIPDGKRLS 404

Query: 401  KPHANDTESNRDTSPPNSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQE 460
               A++  S    S     K      N                 ++D +  KL+S+  ++
Sbjct: 405  VSSASNGRSMESISGNYRSK------NASVTSLESSGSIISLDQEIDEMTYKLQSVNSKK 458

Query: 461  STLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSP 520
            + L++   +Y +P FE  ++H   +  S        +  P     T   +   PN    P
Sbjct: 459  NILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEY-VLPNQ-DMP 516

Query: 521  PASFLPLDLNHSNSVPNL---PPGFIPA-----TPSGPMSPXXXXXXXXXXXXXXDHAGG 572
                LP D+N++ SV ++   PP  +P      TP G   P                  G
Sbjct: 517  ----LPNDMNYAPSVQDVDAVPPSMVPMSTMPNTPYGCYMPPPNV-----------RQNG 561

Query: 573  KFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIK 632
                PIT SL+ Q  TS +VA++MG    NRT+YIGNI+PRSR EDICNVVRGGILQN+K
Sbjct: 562  NMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVK 621

Query: 633  FIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGA 692
            F+  K ICF+TF+EASAAVQFY NAFIDPIVLHGN LK+GWG ++GPLPK IALAVT+GA
Sbjct: 622  FLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGA 681

Query: 693  SRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCC 752
            SRNVY+SLPE AFKDKYI DP+++ Y++ F+LP +E LR DF HYG IEQIN LND HCC
Sbjct: 682  SRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCC 741

Query: 753  WVNFMNISSAIRLVEDASTK-QDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXX 811
            WVNF NIS+AI+LVE+   +   +F ++   RY+GLVI YGKDRCGN+N+N +AG     
Sbjct: 742  WVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRF 801

Query: 812  XXXXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLD 871
                     ++RLS++EE+RR  +   R        +   F +  I   S  K+D   +D
Sbjct: 802  YKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVD 861

Query: 872  SLGIS-IMEVESASPISPV--------------MGDLEDHTNGSY--------------T 902
             +     ++ +S SP   V              +  L + + G+                
Sbjct: 862  DVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREK 921

Query: 903  DAGIAPLNYTNN------SGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVA 956
            +A     N++ N      S +SSD+ELIIN P +   +    +   +     +D+RKL  
Sbjct: 922  EATKLTRNHSENDETSAKSDASSDVELIINSPEEEESN---FKSKSNRGFRKNDRRKLAN 978

Query: 957  LHEVSSPP----------------------PPLAPDTISRQYA---EASYHNELV---TG 988
              E +S                        PP+AP TISR Y+   +  Y++E +    G
Sbjct: 979  CAEGASSKERFKSTTNDVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDFEG 1038

Query: 989  NDHPDTGYGKA--------ENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVL 1040
                D    ++        +  R R    R+ ++IPGSDVMAQYLAQLQHSTF+YAAN+L
Sbjct: 1039 ESFDDESQQESNFDFESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANIL 1098

Query: 1041 GASNEGTEQYDDQ 1053
            GASN+G   Y D+
Sbjct: 1099 GASNDGDNNYLDE 1111

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1049 (40%), Positives = 573/1049 (54%), Gaps = 137/1049 (13%)

Query: 91   PTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNY-------------------------- 124
            PTPFDTAYGATLLPSHLLMGSPFV+TP    +                            
Sbjct: 80   PTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVG 139

Query: 125  ---TAQRKGSHTGMANGTGSMNYYR-----TDPQIINGLFQIPFEISYKILPKGDDLYRT 176
               +A+R+G+         S   YR     TDP+    LF  PF +SYKILP GDD YRT
Sbjct: 140  NPPSARRQGNQNDPNRRRSS---YRSKVPETDPKT---LFLQPFRMSYKILPSGDDAYRT 193

Query: 177  RSLLLGNIDDMVDLHTFVSKFVQNNSVESVYIT------KEGQQPEKYGFLLSFLSVQIC 230
            RSLL  N+ + ++LHTF+++FV+ + +ESVY+       K     E    LLSFL+ ++C
Sbjct: 194  RSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVC 253

Query: 231  LNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGD--GMANLHF 288
            L FYNNVLQRLKEFK +LK+ +L LSFVS++ +    E +       D+       +++F
Sbjct: 254  LTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETN---IVDEPSFYTKESVYF 310

Query: 289  DMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKV 347
            +++    ATRSI I+F +     +  EL +KKLKFL++ NN RYILE I +         
Sbjct: 311  ELS-NPQATRSILIQFKNP---CSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENE 366

Query: 348  FGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPH--AN 405
            F K+YAI+TF++I MAMEI DYLK++  +  +    +VQV   P+     S K+    + 
Sbjct: 367  FPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVI--PKAVSCVSSKRASIISK 424

Query: 406  DTESNRDTSPPNSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKL 465
            D ++N +T     KK+     ++               + +D L  KLKS  ++E  L +
Sbjct: 425  DNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLDKLSEKLKSTNIEELILIV 484

Query: 466  RVEDYPEPLFEQFSEHSNGIVQSL-----PVPQTRPIGGPQSSIS-TPRAFGAFPNDIGS 519
                YP P F    EH      SL     P  Q  P    +     T    G+ P +   
Sbjct: 485  DTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQF 544

Query: 520  PPASFLPLDLNHSNSVPNLPPGFIPATP-----SGPMSPXXXXXXX-XXXXXXXDHAGGK 573
            P             ++PNLP G+I   P     +  M P                +    
Sbjct: 545  P-------------NMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMNNNYNNNTN 591

Query: 574  FAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKF 633
            + +PI+ +LE    T++QV  ++G+D  NRTIYIGNIN RS+ EDICNVVRGGILQN+K+
Sbjct: 592  YRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKY 651

Query: 634  IEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGAS 693
            IE KHICFITFIEASAA+ FYAN+FIDPIVLH +TLK+GWG Y  PLPK +ALAVT+GAS
Sbjct: 652  IEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGAS 711

Query: 694  RNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCW 753
            RNVY+SLPE AFKDK+I DP+++ YH+ +KLP  + LR DF  YG IEQIN L DSHCCW
Sbjct: 712  RNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCW 771

Query: 754  VNFMNISSAIRLVEDASTK-QDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXX 812
            VNF+NIS+AIRLVEDA    +  F++ F++RY+GL+INYGKDRCGN+N++L++       
Sbjct: 772  VNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFY 831

Query: 813  XXXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEE---NPFDAFAINT---------G 860
                    +V+L +LEEKR+  D ER   +  T   +   +  DAF I           G
Sbjct: 832  KKVKSISNNVKLKELEEKRK-ADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDG 890

Query: 861  SAEKKDELS--------LDSLGISIMEVESASPISPVMGD-LEDHTNGSYTDAGIAPLNY 911
            + EK + LS         ++LG  I       P   +M + ++++T G+ T   I+    
Sbjct: 891  NIEKGNTLSKIDTDVNGFNALGFKI------EPKHDMMNETMDNNTEGNNTLENIS---- 940

Query: 912  TNNSGSSSDIELIINPPNDPNRSVGVLEGDPST-LSPPSDKRKLVALHEVSSPPPPLAPD 970
               S  SS+IEL+I+ P +      V +GD  T   P S+       +  S+       D
Sbjct: 941  ---SDESSNIELMISSPKE-----SVQKGDVITNQKPHSNNHHNFKRNSSSNRQRYKETD 992

Query: 971  TISRQYAEASYHNELVTGNDHPDTGYGKA-------ENGRHRQQLPRNARTIPGSDVMAQ 1023
            T   Q    + +N   T   + + G+G +       +N +      + AR IPGSDVMAQ
Sbjct: 993  T---QNTHRNNNNSNATFAPNKEFGFGISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQ 1049

Query: 1024 YLAQLQHSTFMYAANVLGASNEGTEQYDD 1052
            YLAQLQHSTFMYAAN+LGAS E    YD+
Sbjct: 1050 YLAQLQHSTFMYAANILGASAEDGSYYDE 1078

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1133 (38%), Positives = 578/1133 (51%), Gaps = 254/1133 (22%)

Query: 91   PTPFDTAYGATLLPSHLLMGSPFVSTPNL-----PQTNYTAQRKGSHTGMAN-------- 137
            PTPFDTAYGA+LLPSHLLMGSPFVS+PN+     P  +   +RK     ++N        
Sbjct: 65   PTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGYNGNS 124

Query: 138  ------GTGSM---NYY------------------------------------------- 145
                  G G M   NYY                                           
Sbjct: 125  SNHNHSGNGMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSRSNIFD 184

Query: 146  RTDPQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVES 205
              +P+I   L Q PF I+YKILP GDD YRTRSLL+ N+D   DLH+ V  FV+ N++ES
Sbjct: 185  EINPEI---LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLES 241

Query: 206  VYITK-------EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFV 258
             Y          E  + E    L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV
Sbjct: 242  AYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFV 301

Query: 259  SMR------------QRPTKVEGKIYRRFAADDGDGM-ANLHFDMAAQTGATRSIAIEFV 305
             +             ++P +V+ +++   AA+D   + A+LH D+  +  ATRSI IEF 
Sbjct: 302  CLNYESECLSTFVEGEKPKEVDEQVH---AANDSMMISASLHHDVENK-DATRSIIIEFK 357

Query: 306  DKDVILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAM 364
                 L + EL  K+L+FL E  N RYILE I +  T   +  F +NYA++TFL+I MA+
Sbjct: 358  SA---LEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAV 414

Query: 365  EIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP-------- 416
            E++DYLK   K L ++K FYV +T     S  +S    + + T + R + P         
Sbjct: 415  EVLDYLKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKND 474

Query: 417  ------------------NSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIEL 458
                              NS      +  N               +++D L  KL+ IEL
Sbjct: 475  NNNNSNKGNISSINAQNNNSSIGSSIY-GNSNISLTSLSSSVSLNEEIDLLTTKLQGIEL 533

Query: 459  QESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIG 518
              ++L++   DY  P   + S H + I  S  V  +R                 FP DI 
Sbjct: 534  DGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSR----------------HFPQDIP 577

Query: 519  SPPASFLPL-------DLNHSNSVPNLPPGFIPATPSGPMSPXXXXXXXXXXXXXXDHAG 571
            SP    LPL       D N SN    + P  + A PS P+S                   
Sbjct: 578  SP----LPLNEQMFMNDSNQSNGA--VIPQQLIAAPS-PLSSNLQINQRV---------- 620

Query: 572  GKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNI 631
                + IT SLE     S +VA++MGSD  NRTIYIGNINPRSRAEDICNVVRGGILQ+I
Sbjct: 621  --LPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSI 678

Query: 632  KFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIG 691
            K+I  K I F+TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIG
Sbjct: 679  KYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIG 738

Query: 692  ASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHC 751
            ASRNVY+SLPE AFK+K+I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHC
Sbjct: 739  ASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHC 798

Query: 752  CWVNFMNISSAIRLVEDASTK------------QDHFNQLFDHRYEGLVINYGKDRCGNI 799
            CW+NFMNISSAI LVE+ + +            +    + FD RY+GL+INYGKDRCGNI
Sbjct: 799  CWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858

Query: 800  NRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINT 859
            N+NLVAG              ++RLS+LEE+RR  + +++E           FD      
Sbjct: 859  NKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE----------SFDKV---- 904

Query: 860  GSAEKKDELSLDSLGIS----------IMEVES------ASPISPVMGDLEDHTNGSYTD 903
                    L+L+SLGIS          ++E E+       S I     +  + T      
Sbjct: 905  --------LNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTGLGGLG 956

Query: 904  AGIAPLNYTNNSGSSSD-----------------IELIINPPNDPNRSVGVLEGDPSTLS 946
             G+A  +    +   +D                 IE+I++ P+DP  ++       S+ +
Sbjct: 957  LGVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1016

Query: 947  PPSDKR----------KLVALHEVSS--PPPPLAPDTISRQYAEASYHNELVTGNDHPDT 994
              + KR           +  L+  SS    PP AP T+S  + + S            D+
Sbjct: 1017 VINSKRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKS-------ETSFQDS 1069

Query: 995  GYGKAENGRHRQQ--LPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045
               +  N R R++  LPR+ RTIPGSDVMAQYLAQ+QHSTFMYAAN+LGAS E
Sbjct: 1070 RNAETANNRERKRGSLPRH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1121

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1006 (40%), Positives = 537/1006 (53%), Gaps = 174/1006 (17%)

Query: 148  DPQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVY 207
            DP+    L Q PF I+YKILP GDD YRTRSLL+ N+DD  DLH+ V  FV++N++ES Y
Sbjct: 190  DPET---LLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAY 246

Query: 208  ITK-------EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSM 260
            I         E ++ +    L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV +
Sbjct: 247  IVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCL 306

Query: 261  ----RQRPTKVEGKIYRR----FAADDGDGM--ANLHFDMAAQTGATRSIAIEFVDKDVI 310
                +  PT VE +   R     A DD   M  A+LH D+  +  ATRSI IEF      
Sbjct: 307  NYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENK-DATRSIIIEFKSP--- 362

Query: 311  LTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDY 369
            L + EL  +KL+FL    N RYILE I +  T   +  F +NY ++TFL+I MA+E++DY
Sbjct: 363  LEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDY 422

Query: 370  LKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP------------- 416
            LK   K+L ++K FYV +T     S  +S    + + + S+R ++P              
Sbjct: 423  LKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINNIN 482

Query: 417  ---NSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKLRVEDYPEP 473
               N+         N               ++++ L  KL+ I+L  + L++   DYP P
Sbjct: 483  NNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDGTILEVTCHDYPTP 542

Query: 474  LFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSN 533
            +  + S H + I  S  V  +R                 F  DI SP    LPL+ +   
Sbjct: 543  VINEHSAHLSNIKISKTVDNSR----------------QFTQDIPSP----LPLNEHMFM 582

Query: 534  SVPNLPPGFIPA----TPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPITDSLESQMKTS 589
            +  N   G I +    T   P SP                      +PIT SLE     S
Sbjct: 583  TDSNQSNGTIVSQQLITAPSPQSPNPQMNQRV------------LPNPITQSLEQNFNVS 630

Query: 590  TQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASA 649
             +VA++MGSD  NRTIYIGNINPRSRAEDICNVVRGGILQNIK+I  K ICF+TFIEA++
Sbjct: 631  AKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAAS 690

Query: 650  AVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKY 709
            AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIGASRNVY+SLPE AFK+K+
Sbjct: 691  AVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKF 750

Query: 710  IKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDA 769
            I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHCCW+NFMNISSAI LVE+ 
Sbjct: 751  IHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEM 810

Query: 770  S---TKQDHFNQL---------FDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXX 817
            +   T  D   +L         FD RY+GL+INYGKDRCGNIN+NLVAG           
Sbjct: 811  NEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKR 870

Query: 818  XXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGIS- 876
               ++RLS+LEE+RR  + +++E           FD              L+L+SLGIS 
Sbjct: 871  PSYNIRLSKLEERRRQNENDKKE----------SFDKV------------LNLESLGISL 908

Query: 877  -------IMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSG------------- 916
                   I E E+       + +  +  NG+ T           NS              
Sbjct: 909  DPHKGTDIDEAEAEGTTGAEVENEVEAENGNETVGLGGLGLGVVNSDVKRALSDETDYDE 968

Query: 917  ----------SSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKR--------KLVALH 958
                      SSSDIE+I++ P+DP  ++       S+ +  + KR         LV L 
Sbjct: 969  FFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLVGLS 1028

Query: 959  EVS-----SPPPPLAPDTISRQYAEASYH-------NELVTGNDHPDTGYGKAENGRHRQ 1006
            + +        PP AP T+S  +++ +         N  VT N             + R 
Sbjct: 1029 QFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDN-----------KTKKRG 1077

Query: 1007 QLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052
              PR+ RTIPGSDVMAQYLAQ+QHSTFMYAAN+LGAS E     D+
Sbjct: 1078 SFPRH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

 Score = 62.4 bits (150), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/29 (89%), Positives = 29/29 (100%)

Query: 91  PTPFDTAYGATLLPSHLLMGSPFVSTPNL 119
           PTPFDTAYGA+LLPSHLLMGSPFVS+PN+
Sbjct: 65  PTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1006 (40%), Positives = 532/1006 (52%), Gaps = 187/1006 (18%)

Query: 155  LFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITK---- 210
            L Q PF I+YKILP GDD YRTRSLL+ N+D   DLH+ V  FV++N++ES YI      
Sbjct: 191  LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250

Query: 211  ---EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKV 267
               + +Q      L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV +       
Sbjct: 251  DDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCL-----NY 305

Query: 268  EGKIYRRFAADDG-------------DGM--ANLHFDMAAQTGATRSIAIEFVDKDVILT 312
            + K    F  DD                M  A+LH D+  +  ATRSI +EF      L 
Sbjct: 306  DFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENK-DATRSIIVEFKSP---LK 361

Query: 313  RDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLK 371
              EL NKKL+FL   NN RYILE I +  T   +  F +NYA++TFL+I MA+E++DYLK
Sbjct: 362  STELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLK 421

Query: 372  LNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP--------------- 416
               K+L ++K FYV +      S  +S    +   T ++R + P                
Sbjct: 422  KYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSNNH 481

Query: 417  -------------NSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTL 463
                         NS +   +   N               +++D L  KL+ I+L  + L
Sbjct: 482  KSNISDANTHNSNNSTRASLY--GNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTDL 539

Query: 464  KLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPAS 523
            ++   DY  P   + S H + +  S  V  +R                 FP+DI SP   
Sbjct: 540  EINYHDYQTPTVHEHSTHLSNVKISKTVENSR----------------QFPHDIPSP--- 580

Query: 524  FLPL-------DLNHSNSVPNLPPGFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAH 576
             LPL       D NHSN   ++ P  + ATPS P+S                       +
Sbjct: 581  -LPLNERMFMNDSNHSNG--SIVPQQLMATPS-PVSSTIQMNQRV------------LPN 624

Query: 577  PITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEA 636
            PIT SLE     S +VA++MGSD  NRTIYIGNINPRSRAEDICNVVRGGILQ+IK++  
Sbjct: 625  PITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPE 684

Query: 637  KHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNV 696
            K ICF+TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIGASRNV
Sbjct: 685  KRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 744

Query: 697  YISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNF 756
            Y+SLPE AFK+K+I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHCCW+NF
Sbjct: 745  YVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 804

Query: 757  MNISSAIRLVEDASTKQDHFNQ------------LFDHRYEGLVINYGKDRCGNINRNLV 804
            MNISSAI LVE+ + +    N+             F  RYEGL+INYGKDRCGNIN+NLV
Sbjct: 805  MNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLV 864

Query: 805  AGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEK 864
            AG              ++RLS+LEE+RR  + +++E           FD           
Sbjct: 865  AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERA---------FDK---------- 905

Query: 865  KDELSLDSLGIS--------IMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSG 916
               L+L+SLGIS        I E+E+ + I   + +  +  N S    GI  L     S 
Sbjct: 906  --ALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGVASS 963

Query: 917  ----SSSD--------------------IELIINPPNDPNRSVGVLEGDPSTLSPPSDKR 952
                ++SD                    IE+I++ P+DP  ++       S+ +  + KR
Sbjct: 964  EVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVINSKR 1023

Query: 953  KLVALHEVSSP-------------PPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKA 999
             + A  E  +               PP AP T+S   ++    NE    +  P+ G   +
Sbjct: 1024 PVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKK---NETPIRDIVPN-GETTS 1079

Query: 1000 ENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045
               ++R   PR+ RTIPGSDVMAQYLAQ+QHSTFMYAAN+LGAS E
Sbjct: 1080 NRKKNRGSFPRH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1124

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 1/38 (2%)

Query: 91  PTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR 128
           PTPFDTAYGA+LLPSHLLMGSPFVS+PN+ Q  Y+  R
Sbjct: 65  PTPFDTAYGASLLPSHLLMGSPFVSSPNM-QGGYSPAR 101

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1073 (38%), Positives = 553/1073 (51%), Gaps = 193/1073 (17%)

Query: 91   PTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTN-----------------------YTAQ 127
            PTPFDTAYGA+LLPSHLLMGSP +ST NLP+ N                       +  Q
Sbjct: 51   PTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGFVLQ 110

Query: 128  RKGSHTGMAN---------------------------GTGSMNYYRTDPQIINGLFQIPF 160
              G+   M++                           G   + + +  P  +      P 
Sbjct: 111  SNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPI 170

Query: 161  EISYKILPKGDDLYRTRSLLLGNI---DDMVDLHTFVSKFVQNNSVESVYITKEGQQPEK 217
             I+Y++LP GDD Y+TRSLL  N+   D+M  L  F+   +  + VESVY+ ++   P K
Sbjct: 171  SINYRVLPSGDDTYKTRSLLFENVQKNDEM--LSVFMRLIINYSQVESVYVFQQTDTPSK 228

Query: 218  --------YGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSM--------- 260
                        LSFLS Q  L+FYNN LQRL +FK++L +  L +SFVS          
Sbjct: 229  DKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDKD 288

Query: 261  -----------RQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDV 309
                        +R  K   ++ +  A     G      D      ATRSIAIEF  +  
Sbjct: 289  KDKDKDKDINTEKRNIKRSQELLKEPAL----GEEIFSHD------ATRSIAIEFYSQ-- 336

Query: 310  ILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMD 368
             + +D L  +KL FL + +N RYILE + +   +     F  NY I+TF++I MA+E++D
Sbjct: 337  -VEQDALF-EKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLD 394

Query: 369  YLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNN 428
            YLK N+    + + F+V +     Q  +++        TE ++  S  N           
Sbjct: 395  YLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHISTEGSKSVSEVN----------- 443

Query: 429  XXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEH---SNGI 485
                            +++ L ++L S++L+E  LK+   DYP+P      +H   S   
Sbjct: 444  ----LANGGNTVMIDRELESLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGSTNF 499

Query: 486  VQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPN--LPPGFI 543
               +      P G   S +          + IGSP ++++   ++H   +PN  LP G  
Sbjct: 500  SMYIFDDGMNPEG--NSGMYLHDNLTDHSSIIGSPFSNYIDPSISHV-MLPNNGLPVGGF 556

Query: 544  PATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHP---ITDSLESQMKTSTQVATAMGSDF 600
             A    P+ P                +G  F H    IT S+E ++ TS ++A AMG D 
Sbjct: 557  DAPGKFPIEPI---------------SGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDA 601

Query: 601  NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID 660
            +NRT+YIGNINPRS+ EDICNVVRGGILQN+KFIE K ICF+TFIEASAA QF AN+FID
Sbjct: 602  DNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFID 661

Query: 661  PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE 720
            PIVLHGNTL++GWG  +GPLPK IALAVT+GA+RNVY+SLPE AFKDK+I DPK+K YHE
Sbjct: 662  PIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHE 721

Query: 721  SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAS-TKQDHFNQL 779
             +KLP++E LRKDF  YG IEQIN L DSHCCWVNF+NI+SAIRLVED +    + F++ 
Sbjct: 722  RYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKK 781

Query: 780  FDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERR 839
            F++RYEGL+INYGKDRCGNIN+NL+AG              D+R+ ++EEKR+ Q     
Sbjct: 782  FNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQ----- 836

Query: 840  EMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVES-ASPIS----------P 888
                    E+N           ++KK+ + LDSLGIS+    S  S +S           
Sbjct: 837  --------EDNLL---------SQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGG 879

Query: 889  VMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSV-GVLEGDPSTLSP 947
            V  DLE  +N   +D      N     G SS    I +  +  + SV    E   S  + 
Sbjct: 880  VKQDLE--SNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFENSASKETS 937

Query: 948  PSDKR---------KLVALHEVSSPPPPLAPDTISRQYAEASY---HNELVTGNDHPDTG 995
             SD++           V    +S   PP AP TI+  Y + SY    N      D+P   
Sbjct: 938  SSDRKYQTTNSRGDTFVPKTNLSH-APPRAPSTINMTYKKISYVPPLNGQAPKMDYPKK- 995

Query: 996  YGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTE 1048
            Y +  N    QQ     R IPGSDVMAQYLAQLQHSTFMYAAN+LGAS E  E
Sbjct: 996  YKRTHNNFPNQQ---PTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEE 1045

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1007 (37%), Positives = 529/1007 (52%), Gaps = 135/1007 (13%)

Query: 94   FDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTA--------QRKGSHTGM---------- 135
            FD AYG TLLPSH+LM SPFVSTPN    ++ A         R+ S+  +          
Sbjct: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP 171

Query: 136  ------ANGTGSMNYYRTDP--------QIINGLFQIPFEISYKILPKGDDLYRTRSLLL 181
                  +    S NY + D         ++      I ++ISY+ILPKGDD Y TRSLL 
Sbjct: 172  HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHTRSLLF 231

Query: 182  GNIDDMVDLHTFVSKFVQNNSVESVYI--TKEGQQPEKYGFLLSFLSVQICLNFYNNVLQ 239
             NI++ +DLHTF+ KFV    +ESVY+  + E  Q      LLSF S  ICL+FYN+VLQ
Sbjct: 232  ENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQ 291

Query: 240  RLKEFKEQLKASSLELSFVSM---RQRPTKVEGKIYRRFAADDGD-GMANLHFDMAAQTG 295
            +L E+K QL + +L+LSFVS+   +    K  GKI      ++ D  + +L     A  G
Sbjct: 292  KLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFG 351

Query: 296  ATRSIAIEFVDKDVILTRDELLNKKLKFLSE-GNNRYILEHIAVFKTQHGTKVFGKNYAI 354
            ATRS+ IEF DK V    D+ +   L FLS   N RYI+E + +         F  +Y I
Sbjct: 352  ATRSLCIEF-DKRVDKI-DDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVI 409

Query: 355  ITFLSIPMAMEIMDYLKLNIKQLHLTKFFYV---QVTHPPQQSPAASQKKPHANDTESNR 411
            ++FL+I M +E++ Y++       +    YV   +  H    S   S  K   +DT +  
Sbjct: 410  LSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTSDTLNTY 469

Query: 412  DTSPP---NSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKLRVE 468
                P   N++ D    P+                ++++ + NKL  +E+Q  T  L + 
Sbjct: 470  TLESPINHNTEVDMNDIPS------------IYDENEIE-IANKLSELEIQTHTFNLDIS 516

Query: 469  DYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDI-GSPPASFLPL 527
            +Y  P  E  +EH       LP            ++S  R    + N I  SPP+ ++  
Sbjct: 517  NYSNPHIEIRAEH-------LP------------NVSISRDPMIYANPIYQSPPSGYME- 556

Query: 528  DLNHSNSVPNLPPGFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAH-PITDSLESQM 586
              N   + P L    +    +                    H   +  + P+  +L+SQ 
Sbjct: 557  --NMWTTTPFLSSHIVHEEYAN-----------DRVDYNMKHYNNQLYNVPLPQTLQSQF 603

Query: 587  KTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIE 646
             TS ++A+ MG    NRTI+IGNINPRS+ EDICNV RGGI+Q +K+I  K+ICF+ FI+
Sbjct: 604  ATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFID 663

Query: 647  ASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFK 706
              AA QFYAN+FIDPI+LH NTLK+GWG + GPLPK I LAVT GASRNVY+SLPE AFK
Sbjct: 664  PQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFK 723

Query: 707  DKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLV 766
            DKYI DP +K YH  + LP+++ LR+DF  +G +EQIN L D HCCW+NF NI SAI+LV
Sbjct: 724  DKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLV 783

Query: 767  EDASTK-QDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLS 825
            E    +  ++F++ + +RY+GL+I YGKDRCGN+N++LV+               ++RL 
Sbjct: 784  ELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQ 843

Query: 826  QLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASP 885
            QLEE+R+  D E +++ N  I      D+  I T   +   E    SL    +  ++   
Sbjct: 844  QLEEERKRND-EIKQIDNKRI----NLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFK 898

Query: 886  ISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTL 945
             S    D++D                   S SS+D+ELIIN P +  +S    +  P+ L
Sbjct: 899  NSENESDIDDSA-----------------SNSSTDVELIINSPGNGFKSHRNRKPKPNNL 941

Query: 946  SPPSDKRKLVALHEVSSPPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHR 1005
                ++ K+ A+  V     P+AP+ +S  Y     HN  V   D+P     ++E  R R
Sbjct: 942  D-LGERPKVDAI--VFKADGPMAPNKLSHDYHRT--HNTRV---DNP-----RSERTRKR 988

Query: 1006 QQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052
                   + IPGSDVM+QYLAQ+QHSTFMYAANVL AS E  E YD+
Sbjct: 989  TH----KKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDE 1031

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1024 (37%), Positives = 536/1024 (52%), Gaps = 149/1024 (14%)

Query: 92   TPFDTAYGATLLPSHLLMGSPFVSTPNL---------------PQTNYTAQRKGS-HTGM 135
            TPFDT+YG +LLPSHLLM SPF++TP +                Q++Y     GS    M
Sbjct: 51   TPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRM 110

Query: 136  ANGTGSMNY-----YRTDPQIINGLFQIPFEISYKILPK----GDDLYRTRSLLLGNIDD 186
               T   N+     YR +  +     Q  +E+ + ILP+    G D Y TRSLL  N++ 
Sbjct: 111  PPPTEKRNFKHGSSYRHNSSVQ----QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNP 166

Query: 187  MVDLHTFVSKFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKE 246
               LH F++KF + + VESVY+    QQ      L+SFL+ + CL+FYN VLQ+L EFK+
Sbjct: 167  DTHLHDFLTKFEKFDRVESVYLVDSQQQ----SVLVSFLTKETCLDFYNGVLQKLSEFKK 222

Query: 247  QLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVD 306
            +LK+  L L+F S+R   T              G  +  +  ++  + GATRS+ +EF D
Sbjct: 223  ELKSKELTLNFASLRDVKT--------------GPTLQEIKIEVL-RAGATRSLILEFQD 267

Query: 307  KDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEI 366
            K  +     LL+K L F+     RY++E I +      +K FG +YAII F+SI MA+E 
Sbjct: 268  KVDL----ALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALET 323

Query: 367  MDYLKLNIKQLH-LTKFFYVQVTHPPQQSP----AASQKKPHANDTESNRDTSPPNSKKD 421
            ++YLK    +L  L KF YV  T    +S     ++SQ    A    S+ D S       
Sbjct: 324  VEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDIS------- 376

Query: 422  QEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEH 481
                                  + V  L +KL+   L E TL +    Y  PL E+ SEH
Sbjct: 377  --------------------GGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEH 416

Query: 482  SNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNS-VPNLPP 540
               +  S  +     +    S+ ++P+      ND     +    + L  +NS  P  PP
Sbjct: 417  LPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPP 476

Query: 541  GFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPITDSLESQMKTSTQVATAMGSDF 600
              IP  P                           + P+  +L+ Q  T+ QVATAMG   
Sbjct: 477  --IPGYP----------------------FYMNMSKPLGQTLQQQYTTTAQVATAMGGGL 512

Query: 601  NNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFID 660
             NRT+YIGNI+PRS+ EDICNVVRGGILQ++K+IEAKHICF+TFIEA++AVQF+AN+ I+
Sbjct: 513  GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIE 572

Query: 661  PIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHE 720
            PIVLHGN LK+GWG ++G LP+ I+LAVTIGASRNVY+SLPE AFKDK+IKDP+++ + E
Sbjct: 573  PIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKE 632

Query: 721  SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAST-KQDHFNQL 779
             F+LP+KE L +DF  +G IE +N L D HCCW+NFMNIS+AI+LVEDA+    D F++ 
Sbjct: 633  KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEK 692

Query: 780  FDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERR 839
            F +RY+GL I YGKDRCGN+N+NLVA               ++RL + ++   +   E +
Sbjct: 693  FGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQKGASDAPTEVK 752

Query: 840  EMVNGTIPEENPFDAFAINTGSAE------------KKDEL--------SLDSLGISIME 879
            +     + +    DAF I+ G  +            ++DEL        +   LGIS+  
Sbjct: 753  DEAK-ELDKPIKADAFGISVGDTQNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLAS 811

Query: 880  VESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINP--PNDPNRSVGV 937
                   +PV  +     + S   + +  L     S  +S +E    P  P  P     V
Sbjct: 812  STGEETNTPVSDESSKEESVSSESSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANV 871

Query: 938  LEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPDTISRQYAEASYHNEL------VTGNDH 991
             E  PS  S    +    +L  V    PPLAP T+SRQY   S HN         T    
Sbjct: 872  PE-KPSAFSAIIPRVSSASLDAV----PPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSS 926

Query: 992  PDTGYGKAENGR---HRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTE 1048
            P     ++++ +   H ++  R ++ IPGSDVMAQYLAQLQHSTFMYAAN+LG  +  T 
Sbjct: 927  PRYNDIRSQDSKKPLHPRR--RKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETV 984

Query: 1049 QYDD 1052
             YD+
Sbjct: 985  FYDE 988

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  544 bits (1402), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 311/732 (42%), Positives = 427/732 (58%), Gaps = 64/732 (8%)

Query: 146 RTDPQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVES 205
           R   +  + +F+ PF ++Y++LPKGDD YRTRSLL  N++  VDL++FVSK+ +   VES
Sbjct: 201 RAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVES 260

Query: 206 VYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPT 265
           +Y+ K+     K+  LLSFLS +ICL+ YN+VLQRL EFK  LK+ SL +SFVS++ R  
Sbjct: 261 IYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKH 320

Query: 266 KVEGKIYRR--------FAADDGDG-------------------MANLHFDMAAQTGATR 298
             E ++ +            DD D                    +A+L +D+  + GATR
Sbjct: 321 VDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNR-GATR 379

Query: 299 SIAIEFVDKDVILTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITF 357
           S+A+E    D    + +LL+++L FLS  NN RY+LE I +   +   K F KNYAI+TF
Sbjct: 380 SVALEL---DGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTF 436

Query: 358 LSIPMAMEIMDYLKLN-IKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP 416
           L+I MA+E++DY++ N   +    K F+V V+  PQ S            T SN  T P 
Sbjct: 437 LNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIV------TTSNSIT-PV 489

Query: 417 NSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLK------LRVEDY 470
            S        N                + V   ++  + I+   S+LK      + V++Y
Sbjct: 490 ASGGSAGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEY 549

Query: 471 PEPLFEQFSEH-SNGIVQSLPVPQTRPIGGPQ-SSISTPRAFGAFPNDIGSPPASFLPLD 528
           P+P F +FS+H SN  V       T+ I  P    +  P         +G  P    PLD
Sbjct: 550 PKPFFAEFSDHLSNASVLEASALDTQ-ISSPHPQEVIVPSQDSPL---VGGAP----PLD 601

Query: 529 LNHSNSVPNLPPGFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPITDSLESQMKT 588
             H  + P L    +P  P   M+                        PIT SL+ Q  T
Sbjct: 602 AVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKT-------MIKPITQSLQKQFAT 654

Query: 589 STQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEAS 648
           S +VA +MG    NRT+YIGNI+PRS+ EDICNVVRGGILQ+I+F++ KHICF+TFIEAS
Sbjct: 655 SAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEAS 714

Query: 649 AAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDK 708
            AVQFY NAFIDPIVLHGN LK+GWG ++GPLPK ++LAVT+GASRNVY+SLP+ AFKDK
Sbjct: 715 TAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDK 774

Query: 709 YIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVED 768
           YI DP+++ Y + +KLPA+E LR DF  +G IEQIN L+D HCCWVNFMNISSAI+LVE+
Sbjct: 775 YINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEE 834

Query: 769 ASTKQ-DHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQL 827
                 + F++ FD+RY GL+I YGKDRCGN+N+NL++G              ++RLS++
Sbjct: 835 IKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRM 894

Query: 828 EEKRRNQDAERR 839
           EE+R+  +   R
Sbjct: 895 EEERKKHEETLR 906

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 979  ASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAAN 1038
            +S HN     + H     G+   GR+++   RNA+ IPGSDVMAQYLAQLQHSTFMYAAN
Sbjct: 1184 SSSHNSGDRMSSHVGNSRGQQGKGRNKR---RNAKAIPGSDVMAQYLAQLQHSTFMYAAN 1240

Query: 1039 VLGASNEGTEQY 1050
            +LGA+ EG   Y
Sbjct: 1241 ILGATAEGDVDY 1252

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/26 (84%), Positives = 25/26 (96%)

Query: 94  FDTAYGATLLPSHLLMGSPFVSTPNL 119
           FDTAYG TLLPSHLL+GSPFVS+P+L
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSPDL 112

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  533 bits (1373), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 364/998 (36%), Positives = 520/998 (52%), Gaps = 159/998 (15%)

Query: 109  MGSPFVSTPNLPQ-------TNYTAQR-KGSHTGMANG---TGSMNYYRTDPQIINGLFQ 157
            M SPF++TP +         TN ++Q  K +   M       GS  + +       G  Q
Sbjct: 1    MSSPFLATPGVGHSSPHRHVTNKSSQAYKSTQLRMPPSDAIRGSRRHNKEKHLYDEGTRQ 60

Query: 158  IPFEISYKILPK---GD-DLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQ 213
            IP+++++ ILP+   GD D +RTRSL   N++  V LH F++ F + + +ESVY+    Q
Sbjct: 61   IPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQ 120

Query: 214  QPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYR 273
            Q      L+SFL+ + CL+FYN +LQ+L EFK++L++  L LSF S    P KVE     
Sbjct: 121  Q----SVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS----PQKVE----- 167

Query: 274  RFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNNRYIL 333
                  G  +  + F++  + GATRS+ +EF D+    +    L KK  F      RY++
Sbjct: 168  -----SGPTLQEIKFEVL-RAGATRSLGLEFKDEIDFAS----LLKKFDFFDNSGPRYVI 217

Query: 334  EHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNI-KQLHLTKFFYVQVTHPPQ 392
            E I    T   +K FG NYAI+ F+SI MA+E M+YLK+   +   LTK  YV  T    
Sbjct: 218  ESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSG 277

Query: 393  QSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNK 452
            +S            T SN + S  N                           +V   ++ 
Sbjct: 278  KSEF---------QTFSNSELSDQNDV-------------------------EVQDSISS 303

Query: 453  LKSIELQESTLKLRVE--------DYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSI 504
             + I L E ++ +  E         Y  P+ E+ ++H + I  S  +       G  SSI
Sbjct: 304  FEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSI 363

Query: 505  STPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPGFIPATPSGPMSPXXXXXXXXXXX 564
            ++P+      ++  +P +          NS+ +L    + A   GP  P           
Sbjct: 364  ASPQPQEVLVSNSEAPSS---------RNSIVSL----LSARSQGPTYPVPGY------- 403

Query: 565  XXXDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVR 624
                H     + P+  +L+ Q   + QVATAMG    NRT+YIGNI+PRS+ EDICNVVR
Sbjct: 404  ----HYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVR 459

Query: 625  GGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPI 684
            GGILQ++K+IEAKHICF+TFIEA++AVQF+AN+ I+PIVLHG+ LK+GWG ++G LP+ I
Sbjct: 460  GGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSI 519

Query: 685  ALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQIN 744
            +LAVTIGASRNVY+SLPE AFKDK+IKDP+++ + E FKLP+K+ L  DF  +G IE IN
Sbjct: 520  SLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELIN 579

Query: 745  MLNDSHCCWVNFMNISSAIRLVEDA-STKQDHFNQLFDHRYEGLVINYGKDRCGNINRNL 803
             L D HCCW+NFMNIS+AI+LVEDA ++  + F++ F++RY GL I YGKDRCGN+N+NL
Sbjct: 580  FLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNL 639

Query: 804  VAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENP-----FDAFAIN 858
            V+               ++RL      RR Q ++          +EN       DAF I+
Sbjct: 640  VSNKNSKYFKKVKKASYNIRL------RRQQKSDIEAQAKSGKGDENSEKKLQVDAFGIS 693

Query: 859  TGS--------AEKK---DELSLDS--------LGISIMEVESASPISPVMGDLEDHTNG 899
             GS         E+K   +EL L S        LGIS+ +  + +  +   G      + 
Sbjct: 694  VGSQPDARYSDEEQKIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSV 753

Query: 900  SYTDAGIAPLNYTNNSGSSSDIE-------LIINPPNDPNRSVGVLEGDP-STLSPPSDK 951
            S   + +  L     S ++S +E                 RS GV +    S ++P   K
Sbjct: 754  SSGSSEVDILVSAPGSANTSQLEGGGPTQRTTAASNGKKERSSGVSKLHCFSEIAPRVSK 813

Query: 952  RKLVALHEVSSPPPPLAPDTISRQYAEASYHNELVTGNDH---PDTGY-----GKAENGR 1003
              L A+       PPLAP  ++  Y  A   +    G+DH   P +G       K+  G+
Sbjct: 814  ASLDAV-------PPLAPAALNCHYNSAPRRSARKNGHDHDSNPVSGSKSDIGSKSTQGK 866

Query: 1004 HRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLG 1041
              +   RNA+ IPGS+VMAQYLAQLQHSTFMYAA++LG
Sbjct: 867  SSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILG 904

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  491 bits (1265), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 353/1038 (34%), Positives = 526/1038 (50%), Gaps = 157/1038 (15%)

Query: 92   TPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGSHTGMANGTGSMNYYRTDPQI 151
            TPFD  YGA+LLPSH+LMGSPFVSTP  PQ ++      S +  +N + S  YY   P I
Sbjct: 85   TPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHP----SASSHSNHSRSFLYY-PQPPI 139

Query: 152  INGL-------FQI----PFEISYKILPKGDDLYRTRSLLLGNID--DMVDLHTFVSKFV 198
            +  +       F +    P+++++KILPKG D Y TRSLL  N++  +  D+H F++ F+
Sbjct: 140  LKPIPPRRRKSFSLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFI 199

Query: 199  QNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFV 258
            +   +ES+Y+  +      +  LLSFL+   CL+FYNN+LQR  EFK +L ++ L +SFV
Sbjct: 200  KFGPIESIYLLDDS-----HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFV 254

Query: 259  SMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLN 318
                               D+ +    L  ++  + G TRS+ IEF D+ + LT D L++
Sbjct: 255  -----------------CQDETNWFRLLQMNVVTR-GVTRSLCIEFEDQSMELTSD-LIH 295

Query: 319  KKLKFLSEGNNRYILEHIAVFKTQH-GTKVFGKNYAIITFLSIPMAMEIMDYLKL--NIK 375
            +K+ +L   ++R+++E I +        + F   Y +I F+ I MA+E+ +YL+     K
Sbjct: 296  EKIPWLF-FSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKK 354

Query: 376  QLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNXXXXXXX 435
            QL ++K  +V V               H++D       +  N  + +             
Sbjct: 355  QLGISKIQFVNVN-------------GHSSDLSDEDAVAAANGLQRES--------RTSS 393

Query: 436  XXXXXXXADDVDGLVNKLKSIELQESTLKLRV--EDYPEPLFEQFSEHSNGIVQSLPVPQ 493
                     +   LV    S++L    + L+V   +YP PL E   +H + +  S P   
Sbjct: 394  VSSISLPISNSSDLVELFHSLDLALGIISLQVIPSEYPVPLIESHDDHLHSVTISRP--- 450

Query: 494  TRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPL-DLNHSNSVPNLPPGFIPATPS---G 549
            ++ +    S +           +  +     L L D +   + P++ P  +    S   G
Sbjct: 451  SKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPG 510

Query: 550  PMSPXXXXXXXXXXXXXXDHAGGK---------FAHPITDSLESQMKTST-QVATAMGSD 599
            PM                +  GG             PI  +L+ Q  T T QV  +    
Sbjct: 511  PMGGQVLGTSQSLSLHNPNDNGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGS---- 566

Query: 600  FNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFI 659
             NNRT+YIGNI+PRS+ EDICNVVRGGILQNIK+I +K ICF+TFIEA+AA+QFYANA +
Sbjct: 567  -NNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASL 625

Query: 660  DPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYH 719
            +PIVLHGN L++GWG  +G LPK IALAVTIGASRNVY+SLPE +FK+KYI +P+FK YH
Sbjct: 626  EPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYH 685

Query: 720  ESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAST----KQDH 775
              +KLP++E LR+DF  YG +EQIN L+D HCCWVNFMNI+ AIRLVED ++      + 
Sbjct: 686  GKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745

Query: 776  FNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRR--- 832
            F+  FD RY+ L+I YGKDRCGN+N+NL A                 + ++ ++ +R   
Sbjct: 746  FHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTS 805

Query: 833  ---NQDAERREMVNGTIP--EENPF--DAFAINTGSAEKKDELSLDSLGISIMEVESASP 885
               + DA + +     +P   + P   +   +N       D    + LGIS+    S++ 
Sbjct: 806  SASSDDARKDDASTEKVPVSSKEPVCDEILGLN------DDNALAEGLGISL----SSAY 855

Query: 886  ISPVMGDLEDHTNG---SYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNRSV-GVLEGD 941
            ++    D+   TN    S T+       YT  +  SSDI++I+ PP + N+   G     
Sbjct: 856  VNEYGDDISKRTNKKNRSKTETVEEDTGYT--TSGSSDIDIIVAPPLEHNKGKEGNSNHG 913

Query: 942  PSTLSPPSDKR-------------------------KLVALHEVSSPPPPLAPDTISRQY 976
             S       KR                         +LV  +      PPL P  I++ +
Sbjct: 914  KSKRKSQGGKRLQNGAQDGVGGGYGGHSQHYLAGSFELVNSNTYLDSIPPLVPSPINQHF 973

Query: 977  AEASY----------HNELVTGNDHP-DTGYGKAENGRHRQQLPRNARTIPGSDVMAQYL 1025
             + S           +N L   N++  + G     N   R++  + ++ I G DVM+QYL
Sbjct: 974  HDKSLCRGSAHVNDNNNALGGFNNYSYNCGGSNNGNRTRRRRQAKFSKPIAGQDVMSQYL 1033

Query: 1026 AQLQHSTFMYAANVLGAS 1043
             QL HSTF+Y+ N+LGA+
Sbjct: 1034 EQLHHSTFLYSTNILGAT 1051

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  481 bits (1237), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 318/848 (37%), Positives = 443/848 (52%), Gaps = 171/848 (20%)

Query: 35  GPRPTYPQVM-YQFNQNTHGYPQGTVSKQAPLSQQSHXXXXXXXXXXXXXXXMTNGMPTP 93
           G +P YPQ M Y      +G  Q T+    P SQQ +               M +   TP
Sbjct: 22  GIQPHYPQTMAYHPMGPMNGGVQPTMQMSLP-SQQGYYAGSP----------MPSAPQTP 70

Query: 94  FDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR------------KGSHTGMANGTGS 141
           FDT+YGATLLPSHLLMGSPF+STP      +   R              S+ G   G+  
Sbjct: 71  FDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTYSNNGKNKGSSK 130

Query: 142 MNYYRTDPQIINGLFQI-----------------------------------PFEISYKI 166
            N  R   ++ NG   +                                   P+ I++KI
Sbjct: 131 KNN-RDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSSEPYVINFKI 189

Query: 167 LPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYIT----------------- 209
           LPKGDD Y TRSLLL N++  + LH F++KFV+   +ESVY+                  
Sbjct: 190 LPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEEEEEEEEEE 249

Query: 210 ----KEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPT 265
               +E  + +K   LLSFL+   CL+FYNNVLQ+L +FK  L + SL L+FVS+     
Sbjct: 250 EEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSLTSEDI 309

Query: 266 KVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLS 325
           +                      D   + GATRSIA+EF +     T  +L  + ++ LS
Sbjct: 310 R----------------------DDVLRKGATRSIALEFKNS---FTTKQL--ESIEILS 342

Query: 326 EGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFY 384
             +N R+++E I +  T+   K F  +YAII F+SI MA+E   YL    ++L +++ F+
Sbjct: 343 NASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFF 402

Query: 385 VQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNXXXXXXXXXXXXXXAD 444
           V        + +   K  +     +++D S  +   DQ                      
Sbjct: 403 V--------TDSIINKSDYFRSAPASQDASRSSVSIDQT--------------------- 433

Query: 445 DVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIG------ 498
            ++    KL+ + L+E TL ++ + YP+   E+   H   I  S P+  +          
Sbjct: 434 -LEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVSLQ 492

Query: 499 GPQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPGFIPATPSGPMSPXXXXX 558
           G Q+  S+P     + +D  +        D+   +S+ +    F+P  P           
Sbjct: 493 GNQNLTSSPVTQEMYLHDTSNSTRE----DVMIQSSMASGTSNFVPPPP----------- 537

Query: 559 XXXXXXXXXDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAED 618
                     H       PI  +L+ Q+ T+ QVA+ MG    NRT+Y+GNINPRS+ ED
Sbjct: 538 ----------HYYMDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPED 587

Query: 619 ICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTG 678
           ICNVVRGGILQ+IKF E KH+CF+TFIEA+AAVQF+ANA I+PIVLHGN LK+GWG + G
Sbjct: 588 ICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPG 647

Query: 679 PLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYG 738
            L + IALAVTIGASRNVY+SLPE AFKDK+IKDP+F+ + E ++LP+KE LR+DF ++G
Sbjct: 648 DLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFG 707

Query: 739 SIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQD-HFNQLFDHRYEGLVINYGKDRCG 797
            IEQIN L+D HCCWVNFMNI+SAI+LVEDA+   +  F+  +  RY+GL+I YGKDRCG
Sbjct: 708 EIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCG 767

Query: 798 NINRNLVA 805
           N+N+NLVA
Sbjct: 768 NVNKNLVA 775

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 60/99 (60%), Gaps = 16/99 (16%)

Query: 965  PPLAPDTISRQYAEASYH-NELVTGNDHPDT-------GYGKAENGRHRQQLPRNARTIP 1016
            PPLAP T+SR Y+ AS H N     N   D        G G   +GRHR+     ++ IP
Sbjct: 981  PPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHGRHRK-----SKAIP 1035

Query: 1017 GSDVMAQYLAQLQHSTFMYAANVLGAS---NEGTEQYDD 1052
            GS VMAQYLAQLQHSTFMYAAN+LG +   NE +  YD+
Sbjct: 1036 GSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDE 1074

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  431 bits (1108), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 278/674 (41%), Positives = 362/674 (53%), Gaps = 126/674 (18%)

Query: 444  DDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSS 503
            +++D L  KL+ +EL  + L++   DY  P  E+ S H + +  S     +R        
Sbjct: 522  EEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSR-------- 573

Query: 504  ISTPRAFGAFPNDIGSPPASFLPL-------DLNHSNSVPNLPPGFIPATPSGPMSPXXX 556
                     F  DI SP    LPL       D N SN    + P  + ATPS P+SP   
Sbjct: 574  --------QFSQDIPSP----LPLNEHMFMNDSNQSNGA--IIPQQLIATPS-PVSPNLQ 618

Query: 557  XXXXXXXXXXXDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRA 616
                               +PIT SLE     S +VA++MGSD  NRTIYIGNINPRS+A
Sbjct: 619  MNQRV------------LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKA 666

Query: 617  EDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTY 676
            EDICNVVRGGILQ+IK+I  K ICF+TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y
Sbjct: 667  EDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHY 726

Query: 677  TGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLH 736
            +GPLPK I+LAVTIGASRNVY+SLPE AFK+K+I DP++K  HE+  LP  E LR+DF  
Sbjct: 727  SGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFST 786

Query: 737  YGSIEQINMLNDSHCCWVNFMNISSAIRLVEDA---STKQDHFNQL---------FDHRY 784
            YG IEQIN L+DSHCCW+NFMNISSAI LVE+    ST Q+   ++         F  RY
Sbjct: 787  YGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRY 846

Query: 785  EGLVINYGKDRCGNINRNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRRNQDAERREMVNG 844
            +GL+INYGKDRCGNIN+NL+AG              ++RLS+LEEKRR  + + +E    
Sbjct: 847  KGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKA-- 904

Query: 845  TIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDA 904
                   FD              L+L+SLGIS+   +          +   H N S  +A
Sbjct: 905  -------FDK------------PLNLESLGISLDAHKDNGGGETGTANNTGHENESELEA 945

Query: 905  GIAPLNYTNNSG------SSSDI---------------------------ELIINPPNDP 931
                 N T + G      +SSD+                           E+I++ P+DP
Sbjct: 946  ENENGNETGSFGGLGLAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDP 1005

Query: 932  NRSVGVLEGDPSTLSPPSDKR--------KLVALHEVS-----SPPPPLAPDTISRQYAE 978
              ++       S+ +  + KR        + V + +++        PP AP T+S  +++
Sbjct: 1006 EYALKSQTLRSSSQTVINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSK 1065

Query: 979  ASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAAN 1038
                N      D    G       + R    R+ RTIPGSDVMAQYLAQ+QHSTFMYAAN
Sbjct: 1066 ----NNETPMQDIFTNGETANNRKKKRGSFARH-RTIPGSDVMAQYLAQVQHSTFMYAAN 1120

Query: 1039 VLGASNEGTEQYDD 1052
            +LGAS E     D+
Sbjct: 1121 ILGASAEDNTHPDE 1134

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 1/38 (2%)

Query: 91  PTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR 128
           PTPFDTAYGA+L PSHLLMGSPFVS+PN+ Q+ Y + R
Sbjct: 65  PTPFDTAYGASLFPSHLLMGSPFVSSPNM-QSGYNSAR 101

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  425 bits (1093), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/504 (45%), Positives = 316/504 (62%), Gaps = 35/504 (6%)

Query: 576  HPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE 635
            +PI  +LE +  TS QVA++MG +  NRTIYIGN+NPRS+AED+CNVVRGGILQ+IK I 
Sbjct: 701  YPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIA 760

Query: 636  AKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRN 695
            +K ICF+TFIEASAAVQFYAN+FIDP++LHGNTLK+GWG Y  PL K IALAVTIGASRN
Sbjct: 761  SKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRN 820

Query: 696  VYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVN 755
            VY+SLPE AFKDK++ DP++K +HE +KLP+++ LR DF  YG IEQIN L+DSHCCWVN
Sbjct: 821  VYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVN 880

Query: 756  FMNISSAIRLVEDAST--KQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXX 813
            FMNI+SAI+LVED +   K + F++ F+HRY+GL+INYGKDRCGN+NRNL++        
Sbjct: 881  FMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYR 940

Query: 814  XXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENP-FDAFAINTGSA-----EKKDE 867
                   + +L QL+EKRR +  + +E+  G    + P  DA  I          +K  E
Sbjct: 941  KVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPE 1000

Query: 868  LSLDSLGISIMEVESASPISPVMG-----DLEDHTNGSYTDAG-----IAPLNYTNN--S 915
             + D         ES +     +G     + + H +    + G     +  + + ++  S
Sbjct: 1001 SNEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDDEQNDEKGEEQEEVDVIAHADDISS 1060

Query: 916  GSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPDTISRQ 975
             +SSD+E+II+ P++ + +  + E   +      +++K+  L +  +   P   +TI   
Sbjct: 1061 VNSSDVEIIIDCPHNESDTSMIQEKKKTIR---KNQQKIDRLAKARNAMFPEHRETI--- 1114

Query: 976  YAEASYHNELVTGNDHPDTGYGKAENGRHRQQLP------RNARTIPGSDVMAQYLAQLQ 1029
                  +N+L     + D    K   G  + Q P      +  R IPG+DVMAQYL QLQ
Sbjct: 1115 ---PDINNKLFHDRKNKDKNRRKQVQGGIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQ 1171

Query: 1030 HSTFMYAANVLGASNEGTEQYDDQ 1053
            HSTFMYAAN+LG S E    YD++
Sbjct: 1172 HSTFMYAANILGVSAEDNTYYDEE 1195

 Score =  212 bits (539), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 188/568 (33%), Positives = 259/568 (45%), Gaps = 136/568 (23%)

Query: 86  MTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPN--LPQTNYTAQ-------------RKG 130
           + N  PTPFDTAYGATLLPSHLLMGSP+VSTPN  +P +   +Q             RK 
Sbjct: 79  LPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKS 138

Query: 131 --SHTGMANGTGSM---------NYYRTDPQII------NGLFQIPFEISYKILPKGDDL 173
                 M N   S          N Y+ +PQ        N LFQ PF ISYK+LP GDD 
Sbjct: 139 FSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDA 198

Query: 174 YRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYIT-----KEGQQPE----KYGFLLSF 224
           YRTRSLL  N+   +DLH+F+  FVQ +S+ES+Y+      ++ Q  E    K   LLSF
Sbjct: 199 YRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILLSF 258

Query: 225 LSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKI-------YRRFAA 277
           LS +ICL+FYNNVLQRL EFK  L++ SL L+FV +       +G           +   
Sbjct: 259 LSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQE 318

Query: 278 DDGDGMAN-------------LHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFL 324
           ++ D   N             L FD+     ATR I IE   K     ++ LLNK L FL
Sbjct: 319 NENDVNTNEFDYRNSMNTVNALKFDL-INPDATRFIMIELKTK---CDKETLLNKHLSFL 374

Query: 325 --SEGNNRYILEHIAVF-------------------------------------KTQHGT 345
             ++ N RYILE I +F                                     K     
Sbjct: 375 IDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSK 434

Query: 346 KVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHA- 404
           + F  +YA+++F++I MAME+ DYLKLN  +  +T   YVQ+ H  +   ++S++     
Sbjct: 435 RTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVKKSLNSSSKRSSVTS 494

Query: 405 ---NDTESNRDTSPPNSKKDQ-----EFFPNNXXXXXXXXXXXXXXAD---DVDGLVNKL 453
              N  +S  DT+     KD+     + F N                +   D+D +++KL
Sbjct: 495 TTDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYEGEDDIDIDIIISKL 554

Query: 454 KSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAF 513
           + ++L+E+   L +  Y  PLF+    H   I  S+  P    +  P             
Sbjct: 555 QKLKLKETIQVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMRP------------- 601

Query: 514 PNDIGSPPASFLPLDLNHSN-SVPNLPP 540
                 PP++ +  D NH N S P LPP
Sbjct: 602 ------PPSNIVSPDQNHENLSYPILPP 623

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  412 bits (1059), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/510 (44%), Positives = 318/510 (62%), Gaps = 72/510 (14%)

Query: 576  HPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE 635
            H +  + + Q  TS ++A  MG    NRT+YIGNINPRS+AEDICNVVRGG LQ IKF +
Sbjct: 554  HQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFK 613

Query: 636  AKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRN 695
             K ICF+TFIEA++A QFYAN+FIDPI+LH NTL++GWG ++GPLPK I+LAVT+GASRN
Sbjct: 614  EKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRN 673

Query: 696  VYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVN 755
            VY+SLPE AFKDK+I DP++K YH  + LP +E LRKDF ++G +EQ+N LND HCCW+N
Sbjct: 674  VYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWIN 733

Query: 756  FMNISSAIRLVE--DASTKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXX 813
            FMNI SAI+LVE  ++S     F++ + +RY+GL+I YGKDRCGN+N++L++G       
Sbjct: 734  FMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYR 793

Query: 814  XXXXXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINT------GSAEKKDE 867
                   ++RL QLEE+R+ +  E+ ++ N +I      ++F I         S +++ +
Sbjct: 794  KVKKPSYNIRLQQLEEERKQE--EKNKISNKSI----NLNSFGIQVETPSQNESEQEEPK 847

Query: 868  LSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINP 927
            +SLD LG+S+ +  S +       DL++  +                   S+DIELII+P
Sbjct: 848  ISLDGLGMSLSKPNSEN------HDLKETDDSDSD--------------ISTDIELIIDP 887

Query: 928  P-----------------NDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPD 970
            P                 ND N ++    G+P    PP  K  L +        PPLAP 
Sbjct: 888  PVRENTKGNKNKKQNHRKNDMNNNLNF--GNP----PPVSKTLLES-------SPPLAPA 934

Query: 971  TISRQYAEASYH-----NELVT--GNDHPDTGYG-KAENGRHRQQLPRNARTIPGSDVMA 1022
            T+SR + ++S         L T   ND  +      ++N  H++   +N + +PGSDVM+
Sbjct: 935  TLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMS 994

Query: 1023 QYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052
            QYLAQLQHSTFMYAAN+LGAS++  E YD+
Sbjct: 995  QYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 136/258 (52%), Gaps = 43/258 (16%)

Query: 160 FEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEG------- 212
           F ISYK+LPKG+D Y+TRSLL  N+D  VDLH F+ KFV    +ESVY+           
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 213 -------------------QQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSL 253
                                 +    LLSFLS  ICL+FYN+VLQRL EFK QL ++ L
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 254 ELSFVSMR----QRPTKVEGKIYRRFAADDGDGM-ANLHFDMAAQTGATRSIAIEFVDKD 308
            LSFV ++     RP   E        +D    +  +L +D+  + GATRSIA+EF    
Sbjct: 371 TLSFVLLKYKNQDRPDDEE--------SDFSPALPLSLEYDIIKR-GATRSIAVEF--NQ 419

Query: 309 VILTRDELLNKKLKF-LSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIM 367
            I +++  +N KL F LS  N RYI+E + +           KN  I+TFL+I M +++M
Sbjct: 420 PITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVM 479

Query: 368 DYLKLNIKQLHLTKFFYV 385
           D ++L  K   ++K  +V
Sbjct: 480 DRIRLERKDSGISKCVFV 497

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%)

Query: 88  NGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGSHTGMANGTGSMNYYRT 147
           N  PTPFD+AYGA+LLPSHLLMGSPFVSTP + Q+      + S +   N  G ++    
Sbjct: 120 NAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYP 179

Query: 148 DPQIIN 153
            P  IN
Sbjct: 180 APPTIN 185

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  386 bits (991), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 247/702 (35%), Positives = 361/702 (51%), Gaps = 119/702 (16%)

Query: 157 QIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQN---------------N 201
           ++  +  Y ILPKG+D YR+RSLL  N++  +D+  F+ K  +N               +
Sbjct: 212 ELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGD 271

Query: 202 SVESVYITKEGQQP-------------------------------------EKYGFLLSF 224
            +E++  +     P                                      +  +LLSF
Sbjct: 272 DIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSF 331

Query: 225 LSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKIYRRFAADDGDGMA 284
            + + CL+FYNN+LQR  E K  +K+  L ++FV ++                DD + MA
Sbjct: 332 FTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ----------------DDEEWMA 375

Query: 285 NLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNNRYILEHIAVFKTQHG 344
           NL  ++ +  GATRS+ +EF D  V  T D + +  L FL + + +Y++  + V  T   
Sbjct: 376 NLKMNVIS-LGATRSLYVEFADDSV--TSDTIWDT-LPFL-KNSGKYVVIDVDVVTTDER 430

Query: 345 TKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHA 404
            K FG +Y ++ FLS+ MA+E+ + L+   + +    F        P  S     ++  +
Sbjct: 431 RKNFGLHYCLLHFLSVTMALEVKELLETGDEAVSRVSFV------TPANSADKEMRRRRS 484

Query: 405 NDTESNRDTSPPNSKKDQEFFPNNXXXXXXXXXXXXXXADDVDGLVNKLKSIELQESTLK 464
           +     ++ SP     D      +              + D+   + +     L  STL 
Sbjct: 485 SAISLKQEASPQMFSTDSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLI 544

Query: 465 LRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASF 524
           + V +Y EP+  +F  H N    S+  P T  +     S +T  +     +DI       
Sbjct: 545 VDVSEYKEPIVNEFDHHLNS--WSISKPTTLYM---HESGTTNFSSSNLSDDID------ 593

Query: 525 LPLDLNHSNSVPN-LPPGFIPATPSGPMSPXXXXXXXXXXXXXXDHAGGKFAHPITDSLE 583
            PL ++  + VP  +     P      M P                        IT +++
Sbjct: 594 -PLSISSHDPVPQQMLLNEYPYIMEPLMPPQ-----------------------ITQTIQ 629

Query: 584 SQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFIT 643
           +Q   S Q   A+ +   +RT+YIGNINPRS+AEDICNVVRGGILQ+IK++  K ICF+T
Sbjct: 630 NQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVT 686

Query: 644 FIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEI 703
           FIE +AAVQFYAN  ++PI+LHGN LK+GWG   GPLPK IALAVT+GASRNVY+SLP+ 
Sbjct: 687 FIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDK 746

Query: 704 AFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAI 763
           AFKDK+I DP+FK Y   +K+P    L+ DF  YG++EQ+N  +D HCCW+NFMNISSAI
Sbjct: 747 AFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAI 806

Query: 764 RLVEDAS-TKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLV 804
           +LVE+ S TK + F++  + RY GL+I YGKDRCGNINRNLV
Sbjct: 807 KLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLV 848

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 3/47 (6%)

Query: 999  AENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045
            A NG  R+    + + I GSDVM +YL QL H+TF+YAAN+LGA+ +
Sbjct: 1099 ANNGNPRKS---SMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 23/26 (88%)

Query: 92  TPFDTAYGATLLPSHLLMGSPFVSTP 117
           TPFD  YG TLLPSHLL+GSPFV+TP
Sbjct: 71  TPFDPVYGITLLPSHLLVGSPFVNTP 96

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  367 bits (941), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 239/634 (37%), Positives = 330/634 (52%), Gaps = 80/634 (12%)

Query: 469  DYPEPLFEQFSEHSNGIVQSLPVPQTRPIG------------GPQSSISTPRAFGAFPND 516
            +YP PL EQ SEH   I  S P     P              G    +S+  +   F ND
Sbjct: 413  EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMND 472

Query: 517  ---IGSPPASFLPLDLNHSNSVPNLP-PGFIPATPSGPMSPXXXXXXXXXXXXXXDHAGG 572
                GS P   +P +LN +  V   P  G +   P  PMS               D  GG
Sbjct: 473  PSSSGSTPM-IVPSELNLNTPVMGGPMQGQLMPGPPQPMS----------LHNPSDGNGG 521

Query: 573  KFAH--------PITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVR 624
              ++        PI  +L+ Q       A  +    NNRT+YIGNI+PRS+ EDICNVVR
Sbjct: 522  SPSYFMDPMVGAPIGQTLQRQYLAGASQANGI----NNRTVYIGNIHPRSKPEDICNVVR 577

Query: 625  GGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPI 684
            GGILQ IK+I +K ICF+TFIE +AAVQFYANA ++PIVLHGN L++GWG  +G LPK I
Sbjct: 578  GGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 637

Query: 685  ALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQIN 744
            ALAVTIGASRNVY+SLPE +FK+KYI +P+FK+YH  +KLP +E LR+DF  YG +EQIN
Sbjct: 638  ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQIN 697

Query: 745  MLNDSHCCWVNFMNISSAIRLVEDAST----KQDHFNQLFDHRYEGLVINYGKDRCGNIN 800
             L D HCCWVNFMNI+ AIRLVED+++      + F+  FD RY+ L+I YGKDRCGN+N
Sbjct: 698  YLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 757

Query: 801  RNLVAGXXXXXXXXXXXXXRDVRLSQLEEKRR---NQD--AERREMVNGTIPEENPFDAF 855
            +NL A                ++  +   K     N D   +  E++ G   + N     
Sbjct: 758  KNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGV--QMNSSKNG 815

Query: 856  AINTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNS 915
             +    +   D+   + LGIS+   +    ISP  G    +++G          +   ++
Sbjct: 816  GVGESQSLVGDQELAEGLGISLTSAQ----ISPDTGHTHHYSDGVEEGDECDDDDAGYST 871

Query: 916  GSSSDIELIINPPND-PNRSVGVL---------------EGDPSTLSPPSDKRKLVALHE 959
              SSDI++I+ PP++   R  G                   + ++ +  + +  L +L  
Sbjct: 872  SGSSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQYSLGSLDH 931

Query: 960  VSS-----PPPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGK-----AENGRHRQQLP 1009
             SS      PPPLAP ++ +  A+    +      D   + Y       A     R++  
Sbjct: 932  TSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYKSRRRRQA 991

Query: 1010 RNARTIPGSDVMAQYLAQLQHSTFMYAANVLGAS 1043
            + ++ I G DVM+QYL QL HSTF+YA N+LGA+
Sbjct: 992  KFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

 Score =  171 bits (434), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 168/315 (53%), Gaps = 45/315 (14%)

Query: 92  TPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKG--SHT--GMANGTGSMNYYRT 147
           TPFD  YGA+LLPSH+LMGSPF+STP  PQ ++     G  SH+     +   S  YY  
Sbjct: 62  TPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHSSHSLHHAQSARSSFLYYPQ 121

Query: 148 DPQI----------INGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDM--VDLHTFVS 195
            P +          +      P+ I++KILPKG D Y TRSLLL N++ +  +D+H F++
Sbjct: 122 PPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLN 181

Query: 196 KFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLEL 255
            FV+   VES+Y+       + +  LLSFL+   CL+FYNN+LQR  EFK +L +  L +
Sbjct: 182 SFVKFGPVESIYLMD-----DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSV 236

Query: 256 SFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDE 315
           SFV                   D+      L  ++  + GATRS+ +EF D    L  D 
Sbjct: 237 SFV-----------------CQDESSWFKYLQMNVVTR-GATRSLTVEFEDSVKELNEDF 278

Query: 316 LLNKKLKF-LSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKL-- 372
           +   +LKF     + R++LE I +       + FG  Y I+ F+SI MA+E+ D+L+   
Sbjct: 279 V---RLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPS 335

Query: 373 NIKQLHLTKFFYVQV 387
             +QL++++  +V V
Sbjct: 336 QKRQLNISRIQFVNV 350

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  344 bits (882), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 164/305 (53%), Positives = 213/305 (69%), Gaps = 13/305 (4%)

Query: 578  ITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAK 637
            +T +LE+   TST+++  +G    NRT+YIGNINPRS+ ED+CNVVRGGILQ I F+  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 638  HICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVY 697
            HICF+TFIEA+ A QF+ANA+IDPIVLHGN LK+GWG ++GPLPK I+LAVTIGA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 698  ISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFM 757
            +SLPE AFKDK+I +P ++ YHE +KLP +  LRKDF  YG IEQIN LND HCCW+NFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 758  NISSAIRLVEDASTKQD-HFNQLFDHRYEGLVINYGKDRCGNINRNLVAGXXXXXXXXXX 816
            NI+SAI LVE+ +      F+  FD RY GL+I YGKDRCGN+N+NLVA           
Sbjct: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVK 1040

Query: 817  XXXRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGIS 876
                 ++L ++EE+RR Q+            E N  +   ++  S  +K  ++L+SLGI+
Sbjct: 1041 KPAYQIKLKKIEEERRLQE------------ENNLRNNNKLSNNSQIRKPAVNLESLGIT 1088

Query: 877  IMEVE 881
                E
Sbjct: 1089 FESSE 1093

 Score =  147 bits (371), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 159/320 (49%), Gaps = 71/320 (22%)

Query: 152 INGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKE 211
           IN L +IP  +SYKILPKG D +RTRSLLL NI+  +D  T V  F+    +ESVY+ K 
Sbjct: 253 INKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKL 312

Query: 212 GQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKI 271
               +    LLSF+S +ICL+FYNNVLQRL EFK +L + SL LSFV ++   T     I
Sbjct: 313 NPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDYNHPI 372

Query: 272 YRRFAADDGDGMAN----------------------------------------LHFDMA 291
               A+D+GD  ++                                        L F  A
Sbjct: 373 -NEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTFASA 431

Query: 292 AQT-----GATRSIAIEFVDKDVILTRDELLNKK--LKFLSEGNNRYILEHIAVFKTQHG 344
            Q+     GATRS+ ++F   + ++++D+L+N+K  L   +  NNRYILE I++   ++ 
Sbjct: 432 LQSDLVKRGATRSLLLKF---NGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENN 488

Query: 345 TKV--------------------FGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFY 384
           TK                     FG NY ++TF +I MA+E  DY K  + +L++   F+
Sbjct: 489 TKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFF 548

Query: 385 VQVTHPPQQSPAASQKKPHA 404
           V  T+  + S  +     H+
Sbjct: 549 VSKTNYHKNSENSKSTISHS 568

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 23/100 (23%)

Query: 965  PPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAEN------------------GRHRQ 1006
            PP+A  T++R Y +     +L   ND+P       E+                  G   +
Sbjct: 1253 PPMASSTLTRTYRKT----KLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRNK 1308

Query: 1007 QLPRNAR-TIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045
               RN R TIPGSDVM+QYL QLQHSTFMYAAN+LG S E
Sbjct: 1309 NKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348

 Score = 62.4 bits (150), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 31/36 (86%)

Query: 91  PTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTA 126
           PTPFD +YGATLLPSHLLMGSPFVSTPN+    Y+A
Sbjct: 106 PTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSA 141

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  181 bits (460), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 131/204 (64%), Gaps = 20/204 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICN +RGG+LQNIK +  +H+CF+TFI+ +AA QFYA +
Sbjct: 467 NNLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMS 526

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +H    K+GWG ++GPLP PIALAV+ GASRN+Y  L  I F++    D K   
Sbjct: 527 SLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEE----DAK--- 577

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
             +   + A++ LR  F  +G++EQIN L + +CC++NF NIS+AI L  D      HFN
Sbjct: 578 --QEESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAI-LAIDKIKSNPHFN 634

Query: 778 QLFDHRYEGLVINYGKDRCGNINR 801
                    L IN+GKDRCGN+ R
Sbjct: 635 N--------LKINFGKDRCGNVPR 650

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 104/207 (50%), Gaps = 29/207 (14%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI      + + + VR G+++ +K +  K   F++F++ + A+ F+++A +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 663 VLHGNTLKLGWGTYTGPLPKPI-----ALAVTIGASRNVYISLPEIAFKD---KYIKDPK 714
            + G  +K+GWG      P+PI     A     GA+RNVYI       KD   K+  DPK
Sbjct: 293 NIDGRDIKIGWGK-----PQPIDPIVRAGIANDGATRNVYIGKLNTN-KDSCEKWGADPK 346

Query: 715 FKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQD 774
            +I      L  KE L  D   +G IE I ++ D    +V+F +I +AI+ V +  +   
Sbjct: 347 -EI------LVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGS--- 396

Query: 775 HFNQLFDHRYEGLVINYGKDRCGNINR 801
                 D  Y    + YGKDRC  I +
Sbjct: 397 -----IDPYYSNKKVFYGKDRCAFITK 418

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 130/202 (64%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICNVVRGG+LQ++K +  +++CF+TFI+ +AA QFYA +
Sbjct: 443 NNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMS 502

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +     K+GWG ++GPLP  +ALAV+ GASRNVYI    I F+   ++DP  +I
Sbjct: 503 SLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP--RI 558

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + E       + LRK F  YG +EQIN L + +CC++NF NIS+AI L  D      HF 
Sbjct: 559 FTE-------DSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAI-LALDKIKSNPHF- 609

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                  E L IN+GKDRCGN+
Sbjct: 610 -------EDLKINFGKDRCGNV 624

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 102/199 (51%), Gaps = 19/199 (9%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI      +++ + VR G+++++K I  K   FI+F++ S+A+ F+++A +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            + G  +K+GWG  T   P   A  +   A+RNV+I        D   K+P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
               +  LR+D   +G IE + ++ +    +V+F +I+SAI+ V +  +   +       
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPY------- 375

Query: 783 RYEGLVINYGKDRCGNINR 801
            YE   I YGKDRC  I +
Sbjct: 376 -YENKKIAYGKDRCAFITK 393

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  175 bits (443), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 127/207 (61%), Gaps = 20/207 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRTIY+GN+    + E+ICN VRGG+LQ+IK +  +H+CF+TFI+ +AA QFYA +
Sbjct: 337 NNLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMS 396

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +H    K+GWG ++GPLP P+ALAV+ GASRN+Y+   + A  DK  + P F  
Sbjct: 397 SLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIF-- 453

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                    +  LR  F  +G +EQIN L + +CC++NF NISSAI  ++   +      
Sbjct: 454 --------TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT--- 502

Query: 778 QLFDHRYEGLVINYGKDRCGNINRNLV 804
                 ++ L IN+GKDRCGN+ R   
Sbjct: 503 ------FKDLKINFGKDRCGNVPRQFC 523

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 106/203 (52%), Gaps = 19/203 (9%)

Query: 602 NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDP 661
           +RT+Y+GN+ P    +++ + VR G+++ +K +  K   FI+F+E ++A+ F+++A +  
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 662 IVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKD---KYIKDPKFKIY 718
           + +    +K+GWG  T   P   A     GA+RNVYI       KD   ++  DP  ++ 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTN-KDICAQWGVDPNEEVI 220

Query: 719 HESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQ 778
            E       E LR D   +G +E + ++ +    +V+F +I +AI++V + +    ++ Q
Sbjct: 221 TE-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQ 273

Query: 779 LFDHRYEGLVINYGKDRCGNINR 801
                     I YGKDRC  I +
Sbjct: 274 --------KKIFYGKDRCAFITK 288

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  176 bits (446), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 87/208 (41%), Positives = 129/208 (62%), Gaps = 22/208 (10%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRTIY+GN+    + E+ICN VRGG+LQ+IK +  +H+CF+TFI+ +AA QFYA +
Sbjct: 390 NNLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMS 449

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFK-DKYIKDPKFK 716
            +  + +H    K+GWG ++GPLP P+ALAV+ GASRN+Y  L  I F+ D+ ++ P F 
Sbjct: 450 SLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIY--LGNIDFEDDRKLEQPIF- 506

Query: 717 IYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHF 776
                     +  LR  F  +G +EQIN L + +CC++NF NISSAI  ++   +     
Sbjct: 507 ---------TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIP--- 554

Query: 777 NQLFDHRYEGLVINYGKDRCGNINRNLV 804
                  ++ L IN+GKDRCGN+ R   
Sbjct: 555 ------TFKDLKINFGKDRCGNVPRQFC 576

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 107/204 (52%), Gaps = 21/204 (10%)

Query: 602 NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDP 661
           +RT+Y+GN+ P     ++ + VR G+++++K +  K   FI+F++ ++A+ F+++A +  
Sbjct: 155 SRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKR 214

Query: 662 IVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYI----SLPEIAFKDKYIKDPKFKI 717
           + +    +K+GWG  T   P   A     GA+RNVY+    + P++    ++  DP  + 
Sbjct: 215 LNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEET 272

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
             E       E LR D   +G +E + ++ +    +V+F +I SAI++V + +    ++ 
Sbjct: 273 ITE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPYYA 325

Query: 778 QLFDHRYEGLVINYGKDRCGNINR 801
           Q          I YGKDRC  I +
Sbjct: 326 Q--------KKIFYGKDRCAFITK 341

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 599 DFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAF 658
           +  NRTIY+GN++ R R E++CNVVRGG+LQ++KF+  +H+CF+TF + +AA QFYA A 
Sbjct: 261 NLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMAS 320

Query: 659 IDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIY 718
           +  + +     K+GWG ++GPLP  +A A++ GASRNVY       F +   +DP    +
Sbjct: 321 LHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEF 373

Query: 719 HESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQ 778
            E      +  LR+   H+G +EQ+N + +  C +VNF N+ SAI  VE    K   F Q
Sbjct: 374 FE------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVK-KWPQFQQ 426

Query: 779 LFDHRYEGLVINYGKDRCGNI 799
                   L +NYGKDRCGN+
Sbjct: 427 --------LKVNYGKDRCGNV 439

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 104/201 (51%), Gaps = 30/201 (14%)

Query: 602 NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDP 661
           +RT+Y+GNI P     ++ + V+ G++++ +   AK   F++F++ ++A+ F+++A ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 662 IVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYI-SLPEIAFKDKYIKDPKFKIYHE 720
           + +    +K+GW T T   P       + GA+RNVY+ +LP+                  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------- 141

Query: 721 SFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLF 780
                ++  L KD   YG I+ + +L+     +V+  +I  AI  V  A+ ++D  N+++
Sbjct: 142 -----SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAV--ANLQRD--NKIY 192

Query: 781 DHRYEGLVINYGKDRCGNINR 801
             R     +++GKDRC  + +
Sbjct: 193 SDRR----VSFGKDRCAYVTK 209

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 125/205 (60%), Gaps = 22/205 (10%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRTIY+GN+    + E+ICN VRGG+LQ+IK +  +H+CF+TFI+ +AA Q YA  
Sbjct: 383 NNLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMT 442

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKD-PKFK 716
            +  + +H    K+GWG ++G L   +ALAV+ GASRN+Y  L  I FK    +D P F 
Sbjct: 443 SLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIY--LGNIDFKADSERDVPVF- 499

Query: 717 IYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHF 776
                     ++ LRK F  YG +EQIN L +  CC+VNF NIS+AI  ++   + +   
Sbjct: 500 ---------TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNE--- 547

Query: 777 NQLFDHRYEGLVINYGKDRCGNINR 801
                 +++ L IN+GKDRCGN+ R
Sbjct: 548 ------QFKDLKINFGKDRCGNVPR 566

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 105/202 (51%), Gaps = 17/202 (8%)

Query: 602 NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDP 661
           +RT+Y+GNI P     ++ + VR G++++++ +  K   FI+F++ S+A+ F+++A +  
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 662 IVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISL--PEIAFKDKYIKDPKFKIYH 719
           + + G  +K+GWG  T   P   A     GA+RNVYI     +     ++  DP+  I  
Sbjct: 207 LNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADPRDLIAT 266

Query: 720 ESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQL 779
           E       E LR D   YG IE + ++ +    +V+F +I SAI++V   +T   +    
Sbjct: 267 E-------EKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPY---- 315

Query: 780 FDHRYEGLVINYGKDRCGNINR 801
               Y    I YGKDRC  + +
Sbjct: 316 ----YSNKKIFYGKDRCAFVTK 333

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  166 bits (421), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 122/202 (60%), Gaps = 24/202 (11%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRTIY+GN+    + E+ICNVVRGG+LQNIK +  +  CFITFI+ +AA QFYA +
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +  N  K+GWG ++GPL   +ALA++ GASRN+YI   +   K++Y  +     
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE----- 465

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                     E LR+ F  +G +EQIN L +  CC+VNF NI+ AI  ++   +  +   
Sbjct: 466 ----------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLPE--- 512

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                 +E L IN+GKDRCGNI
Sbjct: 513 ------FEDLKINFGKDRCGNI 528

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 102/200 (51%), Gaps = 27/200 (13%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI      +++ + VR G+++++K +  K   FI+FI+   A+ F+++A +  +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVT-IGASRNVYISLPEIAFKDKYIKDPKFKIYHES 721
            + G  +K+GWG  +  +   +A  +T  GA+RNVYI         +   DP      E 
Sbjct: 188 NIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDPTITTEQE- 237

Query: 722 FKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFD 781
                   L KD   +G I+ I  L++    +V+F +IS AI +V++ S          +
Sbjct: 238 --------LEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSK--------LN 281

Query: 782 HRYEGLVINYGKDRCGNINR 801
            +Y+   I YGKDRC  I +
Sbjct: 282 EKYKNKRIFYGKDRCAFITK 301

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  167 bits (423), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 127/202 (62%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICN VR G+LQ++K +  +H+CF+TFI+ +AA QFYA +
Sbjct: 404 NNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 463

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  ++L     K+GWG ++GPLP  IALAV+ GASRNVYI    I F++   ++     
Sbjct: 464 SLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIG--NIDFEEDSKRNE---- 517

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                ++  ++ LRK F  YG +EQIN L   +CC++N+ NIS+AI  ++   +      
Sbjct: 518 -----RVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKS------ 566

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
              +  ++ L IN+GKDRCGNI
Sbjct: 567 ---NPYFKDLKINFGKDRCGNI 585

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 106/199 (53%), Gaps = 13/199 (6%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI      +++ + VR G+++++K +  K   FI+F++ S+A+ F+++A +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            + G  +K+GWG  T   P       T GA+RNVYI      + D  + +    I  ES 
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQ---LYTDAEVAE-SLNIPKES- 283

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
           ++  +E L  D   YG I+ + ++ +    +++F +I SAI++V + +    +       
Sbjct: 284 EIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASNRY------- 336

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 337 -YQNRKIFYGKDRCAFITK 354

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  169 bits (428), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 133/224 (59%), Gaps = 21/224 (9%)

Query: 578 ITDSLESQMKTSTQVATAMG--SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE 635
           I+++L  Q   +  +AT+ G  ++  NRT+Y+GN+    + ++ICN VRGG+LQ+IK + 
Sbjct: 501 ISNTLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLT 560

Query: 636 AKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRN 695
            +H+CF+TFI+ +AA QFYA + +  + +     K+GWG ++GPLP  IALAV+ GASRN
Sbjct: 561 DRHVCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRN 620

Query: 696 VYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVN 755
           VY+   +     K    P F           +  LR  F  YG +EQIN L + +CC++N
Sbjct: 621 VYLGNIDFENDIKLHNPPIF----------TELSLRNIFQQYGDVEQINFLPEKNCCFIN 670

Query: 756 FMNISSAIRLVEDASTKQDHFNQLFDHRYEGLVINYGKDRCGNI 799
           F NIS+AI  +E      D         ++ L IN+GKDRCGNI
Sbjct: 671 FTNISNAILAIEKIKNNPD---------FKDLKINFGKDRCGNI 705

 Score = 94.0 bits (232), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 113/243 (46%), Gaps = 47/243 (19%)

Query: 588 TSTQVATAMGSD-FNN---RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFIT 643
           TS Q +T   ++ F N   RT+Y+GNI      +D+ + VR G+++NIK +  K   FI+
Sbjct: 249 TSIQTSTLPNNNTFGNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFIS 308

Query: 644 FIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYIS---- 699
           F++ S+A+ F+++A +  + + G  +K+GWG  T   P      VT GA+RNVYI     
Sbjct: 309 FVDESSALLFHSDAILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSN 368

Query: 700 ---------------------LPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYG 738
                                  +   K K I D              +E LR+D   YG
Sbjct: 369 SSNNNTSSSSSSTSPSSPSNNTSDDLEKKKNIDDSPL----------TEEKLREDLKDYG 418

Query: 739 SIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDHRYEGLVINYGKDRCGN 798
            I+ + ++ D    +V+  +I SAI++V + +    +        Y+   I YGKDRC  
Sbjct: 419 EIDCVKIVQDKGFAFVHMSSILSAIKVVNNLAQTNPY--------YQNKRIFYGKDRCAF 470

Query: 799 INR 801
           I +
Sbjct: 471 ITK 473

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 124/204 (60%), Gaps = 22/204 (10%)

Query: 599 DFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAF 658
           +  NRTIY+GN+    + E+ICNVVRGG+LQ+IK +  +H+CF+TFI+ +AA Q YA A 
Sbjct: 382 NLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMAS 441

Query: 659 IDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFK-DKYIKDPKFKI 717
           +  + +H    K+GWG ++G L   +ALAV+ GASRN+Y  L  I FK D   + P F  
Sbjct: 442 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIY--LGNIDFKADSETEHPIF-- 497

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                    ++ LR  F  +G +EQIN L + +CC+VNF NIS+AI  ++          
Sbjct: 498 --------TEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKN------ 543

Query: 778 QLFDHRYEGLVINYGKDRCGNINR 801
              + ++  L IN+GKDRCGN+ R
Sbjct: 544 ---NPQFSDLKINFGKDRCGNVPR 564

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 106/202 (52%), Gaps = 17/202 (8%)

Query: 602 NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDP 661
           +RT+Y+GNI P   A  + + VR G++++I+ +  K   FI+F++ S+A+ F+++A +  
Sbjct: 145 SRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 662 IVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISL--PEIAFKDKYIKDPKFKIYH 719
           + + G  +K+GWG  T   P   +     GA+RNVYI     + +F  +   DP+ ++  
Sbjct: 205 LNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEVVT 264

Query: 720 ESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQL 779
           E       + LR D   YG IE + ++ +    +V+F +I SAI++V   +    +    
Sbjct: 265 E-------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPY---- 313

Query: 780 FDHRYEGLVINYGKDRCGNINR 801
               Y    I YGKDRC  I +
Sbjct: 314 ----YANKKIFYGKDRCAFITK 331

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 124/202 (61%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICNVVRGGILQ IK +  +H+CF+TFI+  AA QFYA +
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  I +     ++GWG + GPLP  IALAV+ GASRNVYI   +  ++D   ++P F  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF-- 514

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                     + LRK F  YG +EQ+N L + +C +VN+ NIS+AI  ++   +     N
Sbjct: 515 --------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKS-----N 561

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
            LF    + L IN+GKDRCG I
Sbjct: 562 PLF----KNLKINFGKDRCGTI 579

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 105/203 (51%), Gaps = 21/203 (10%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           +T+Y+GNI P     ++ + VR G+++ +K +  K   F+TF++ SAA+ F+++A +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISL----PEIAFKDKYIKDPKFKIY 718
            + G  +K+GWG  T   P       + GA+RNVYI L     +IA +     DP  +  
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVG--ADPNDEKI 280

Query: 719 HESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQ 778
            E       E LR D   +G I+ + ++ +    +++F +I SA+++V + +    +   
Sbjct: 281 TE-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGINPY--- 330

Query: 779 LFDHRYEGLVINYGKDRCGNINR 801
                YE   I YGKDRC  I +
Sbjct: 331 -----YENKKIYYGKDRCAFITK 348

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 127/206 (61%), Gaps = 20/206 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICN VRGG+LQ++K +  +H+CF+TFI+ +AA QFYA +
Sbjct: 396 NNLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 455

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +H    K+GWG ++G LP  +ALAV+ GASRN+Y+    I F    I +    I
Sbjct: 456 SLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVG--NIDFNA--IDETGETI 511

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + E       + LR+ F  +G +EQIN L++ +CC++NF NIS+AI  ++          
Sbjct: 512 FTE-------QNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKC------ 558

Query: 778 QLFDHRYEGLVINYGKDRCGNINRNL 803
              +  ++ L +N+GKDRCGN+ R  
Sbjct: 559 ---NPYFKNLKVNFGKDRCGNVPRQF 581

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 110/203 (54%), Gaps = 21/203 (10%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI P   A+ + + VR G+++ +K +  +   FI+F++ S+A+ F+++A +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISL----PEIAFKDKYIKDPKFKIY 718
            + G  +K+GWG  T   P   A   + GA+RNVYI      P++A   ++  DP  +I 
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNEEIV 278

Query: 719 HESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQ 778
            E       E LRKD   +G IE I ++ D    +V+F +I SAI++V + ++   +   
Sbjct: 279 SE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVNPY--- 328

Query: 779 LFDHRYEGLVINYGKDRCGNINR 801
                Y    I YGKDRC  I +
Sbjct: 329 -----YTNKKIFYGKDRCAFITK 346

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  167 bits (423), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 124/202 (61%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    + E+ICN VRGG+LQ+IK ++ +H+CF+TFI+ +AA QFYA +
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +    +     K+GWG ++GPLP  +ALAV+ GASRNVY  L  I F+    K+    I
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVY--LGNIDFEADSKKEQ--PI 568

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           ++E+        LR  F  YG +EQIN L +  CC++NF NI++AI    D      HF 
Sbjct: 569 FNET-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAI-FAMDKIKSNPHF- 619

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                  + L IN+GKDRCGN+
Sbjct: 620 -------KSLKINFGKDRCGNV 634

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 19/199 (9%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI P    +++ + VR G+++  K +  K   FI+F+E S+A+ F+++A +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            +    +K+GWG  T   P   +  +  GA+RNVYI         K  K+P         
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPL-------- 335

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
               +E LR+D   YG I+ I ++ +    +V+F +I++AI++V   + K          
Sbjct: 336 ---TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPF------- 385

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 386 -YQEKKIFYGKDRCAFITK 403

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  167 bits (422), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 128/202 (63%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRTIY+GN+    R E+ICNVVRGG+LQ++K +  +++CF+TFI+ +AA QF+A +
Sbjct: 494 NNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMS 553

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +  + +     K+GWG ++GPL   +ALAV+ GASRN+YI   + A  DK   +P F  
Sbjct: 554 SLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF-- 610

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                    ++ LRK F  YG +EQIN L + +CC++NF NIS+AI  ++   +     N
Sbjct: 611 --------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKS-----N 657

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
            +F    + L IN+GKDRCGNI
Sbjct: 658 PVF----KDLKINFGKDRCGNI 675

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 122/252 (48%), Gaps = 49/252 (19%)

Query: 591 QVATAMGSDFNN---------RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICF 641
           ++ + MGS  N+         RT+Y+GNI      +++ + VR G+++++K I  K   F
Sbjct: 201 RMQSTMGSRLNDPLDFTTAPSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAF 260

Query: 642 ITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYIS-L 700
           I+F++ ++A+ F+++A +  + ++G  +K+GWG  T   P      +  GA+RNV+I  L
Sbjct: 261 ISFLDENSALLFHSDAILKRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQL 320

Query: 701 PEIAF---KDKYIKDPKFK-------IYHES--------------------FKLPAKEV- 729
              +F   K K  K P  +       I +E+                     + P  +  
Sbjct: 321 KTKSFDPNKAKVTKMPPSRNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAK 380

Query: 730 LRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDHRYEGLVI 789
           LRKD   +G I+ I ++ D    +++F +I+SAI+ V + ++  D+        Y    I
Sbjct: 381 LRKDLADFGDIDCIKIVEDKGIAFIHFASITSAIKCVHNLNSMNDY--------YSTKKI 432

Query: 790 NYGKDRCGNINR 801
            YGKDRC  I +
Sbjct: 433 FYGKDRCAFITK 444

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 120/208 (57%), Gaps = 32/208 (15%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+GN+    R EDICN +R G+LQNIK +  +H+CF+TFI+  +A QFYA +
Sbjct: 410 NNLGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMS 469

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAF------KDKYIK 711
            I   VL     K+GWG ++GPL  P+ LAV+ GASRNVYI    I F      +++Y  
Sbjct: 470 SIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIG--NIDFTADGTKRERYFT 527

Query: 712 DPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAST 771
           D                 LR+ F  YG +EQIN L   +CC+VN+ NI++AI  ++    
Sbjct: 528 DSN---------------LRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKN 572

Query: 772 KQDHFNQLFDHRYEGLVINYGKDRCGNI 799
                    +  ++ L IN+GKDRCGNI
Sbjct: 573 ---------NPTFKNLKINFGKDRCGNI 591

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 112/203 (55%), Gaps = 14/203 (6%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GNI P   A D+ + VR G+++ +K +  K   FI+F++ ++++ F+++A +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAV-TIGASRNVYISLPEIAFKDKYIKDPKFKIYHES 721
            + G  +K+GWG    PL   IA +V T GA+RN++I        +K  KD    IYH S
Sbjct: 228 NIDGKDIKIGWGK-PSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQ-KDNDATIYHGS 285

Query: 722 --FK-LPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQ 778
             F+ +  +E LRKD   YG I+ I +  +    +V+F +I SAI++V + S    +   
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPY--- 342

Query: 779 LFDHRYEGLVINYGKDRCGNINR 801
                Y    I YGKDRC  I +
Sbjct: 343 -----YSKKKIYYGKDRCAFITK 360

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  162 bits (411), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 126/202 (62%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+G++    + E+ICN VRGG+LQ+IK +  +++CF+TFI+ +AA QFYA +
Sbjct: 439 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 498

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +    +     K+GWG ++GPLP  +ALAV+ GASRNVY+    I F    ++D   +I
Sbjct: 499 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDFVSDSLRDE--RI 554

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + ES        LR  F  YG +EQIN L + +CC+VN+ NIS+AI  ++   +      
Sbjct: 555 FTES-------NLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKS------ 601

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
              +  ++ L IN+GKDRCGN+
Sbjct: 602 ---NPYFKDLKINFGKDRCGNV 620

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 105/199 (52%), Gaps = 23/199 (11%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GN+ P    +++ + VR G+++++K I  K   FI+F++ SAA+ F+++A +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            +    +K+GWG  T   P   A   T GA+RNVYI    I  ++ ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
              ++E LR D   YG I+ I ++ +    +++F +I +AI++V +   +  +       
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRNPY------- 371

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 372 -YQNKRIFYGKDRCAFITK 389

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  162 bits (409), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 124/203 (61%), Gaps = 24/203 (11%)

Query: 599 DFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAF 658
           +  NRT+Y+GN+    + E+ICNVVRGG+LQN+K +  +H+CF+TFI+ +AA QFYA + 
Sbjct: 447 NLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSS 506

Query: 659 IDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAF-KDKYIKDPKFKI 717
           +  I +     ++GWG + G L   +ALAV+ GASRNVY+    I F +D   +DP F  
Sbjct: 507 LHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVG--NINFDEDSKREDPIF-- 562

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
                    +  LR  F  +G +EQIN L + +CC+VN+ NIS+AI  ++          
Sbjct: 563 --------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAID---------- 604

Query: 778 QLFDH-RYEGLVINYGKDRCGNI 799
           ++  H  ++ L IN+GKDRCGN+
Sbjct: 605 KIKGHPVFKDLKINFGKDRCGNV 627

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 106/207 (51%), Gaps = 17/207 (8%)

Query: 599 DFNN---RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYA 655
           +FNN   +T+Y+GN       +++ + VR G++++++ +  K   F++F++ SAA+ F++
Sbjct: 203 NFNNAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHS 262

Query: 656 NAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVT-IGASRNVYISLPEIAFKDKYIKDPK 714
           +A +  + + G  +K+GWG  T P+   +A AV    A+RNVYI       K      P 
Sbjct: 263 DAILKRLHIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSP- 320

Query: 715 FKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQD 774
                 +  +  ++ LR D   +G I+ I ++ +    +V+F +I +AI+ V + +    
Sbjct: 321 ---VDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLAN--- 374

Query: 775 HFNQLFDHRYEGLVINYGKDRCGNINR 801
                 +  Y    I YGKDRC  I +
Sbjct: 375 -----INPYYRNKKIFYGKDRCAFITK 396

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 125/202 (61%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+G++    + E+ICN VRGG+LQ+IK +  +++CF+TFI+ +AA QFYA +
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +    +     K+GWG ++GPLP  +ALAV+ GASRNVY+    I F    ++D   ++
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDFVGDSLRDE--RV 541

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + ES        LR  F  YG +EQIN L + +CC++N+ NIS+AI L  D      +F 
Sbjct: 542 FTES-------NLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSNPYF- 592

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                  + L IN+GKDRCGN+
Sbjct: 593 -------KDLKINFGKDRCGNV 607

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 105/199 (52%), Gaps = 23/199 (11%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GN+ P    +++ + VR G+++++K I  K   F++FI+ SAA+ F+++A +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            +    +K+GWG  T   P   A   T GA+RNVYI    I  ++ ++            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
              ++E LR D   YG I+ I ++ +    +++F +I +AI++V +   +  +       
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNPY------- 358

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 359 -YQNKRIFYGKDRCAFITK 376

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 124/202 (61%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+G++    + E+ICN VRGG+LQ+IK +  +++CF+TFI+ +AA QFYA +
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +    +     K+GWG ++GPLP  +ALAV+ GASRNVY+    I F    + D   +I
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDFASDSLNDE--RI 525

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + E+        LR  F  YG +EQIN L + +CC++N+ NIS+AI L  D      +F 
Sbjct: 526 FTEN-------NLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSNPYF- 576

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                  + L IN+GKDRCGN+
Sbjct: 577 -------KDLKINFGKDRCGNV 591

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 105/199 (52%), Gaps = 23/199 (11%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GN+ P    +++ + VR G+++++K I  K   FI+F++ SAA+ F+++A +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            +    +K+GWG  T   P   A   T GA+RNVYI    +  ++ ++            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
              ++E LR D   YG I+ I ++ +    +++F +I +AI++V +   +  +       
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNPY------- 342

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 343 -YQNKRIFYGKDRCAFITK 360

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  159 bits (403), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 124/202 (61%), Gaps = 20/202 (9%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANA 657
           ++  NRT+Y+G++    + E+ICN VRGG+LQ+IK +  +++CF+TFI+ +AA QFYA +
Sbjct: 428 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 487

Query: 658 FIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKI 717
            +    +     K+GWG ++GPLP  +ALAV+ GASRNVY+    I +    ++D   +I
Sbjct: 488 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDYVSDSVRDE--RI 543

Query: 718 YHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFN 777
           + E         LR  F  YG +EQIN L + +CC++N+ NIS+AI L  D      +F 
Sbjct: 544 FTEG-------KLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAI-LALDKIKSNPYF- 594

Query: 778 QLFDHRYEGLVINYGKDRCGNI 799
                  + L IN+GKDRCGN+
Sbjct: 595 -------KDLKINFGKDRCGNV 609

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 104/199 (52%), Gaps = 23/199 (11%)

Query: 603 RTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPI 662
           RT+Y+GN+ P    +++ + VR G+++++K I  K   FI+F++ SAA+ F+++A +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 663 VLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF 722
            +    +K+GWG  T   P   A   T GA+RNVYI    I  ++ ++            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 723 KLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDH 782
              + E LR D   YG I+ I ++ +    +++F +I +AI++V +   +  +       
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNLY------- 360

Query: 783 RYEGLVINYGKDRCGNINR 801
            Y+   I YGKDRC  I +
Sbjct: 361 -YQNKRIFYGKDRCAFITK 378

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 593 ATAMGSDFNNRTIYIGNINPRSRAEDICNVVR--GGILQNIKFIEAKHICFITF---IEA 647
           A A  +D NN T++IG + P+     +  +    G IL  +K  + K+  F+ F   I+A
Sbjct: 411 AQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNIL-TVKIPQGKNCGFVKFEKRIDA 469

Query: 648 SAAVQFYANAFIDPIVLHGNTLKLGWGTYT 677
            AA+Q      +   V+ G  ++L WG  T
Sbjct: 470 EAAIQ-----GMQGFVVGGCPIRLSWGRNT 494

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 16/95 (16%)

Query: 593 ATAMGSDFNNRTIYIGNINPRSRAEDICN--VVRGGILQNIKFIEAK-----HICFITFI 645
           AT  G + ++R +Y+GN++ +S  ED+       GG +QN+K IE       +  F+ +I
Sbjct: 48  ATKGGRETSDRVLYVGNLD-KSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYI 106

Query: 646 ---EASAAVQFYANAFIDPIVLHGNTLKLGWGTYT 677
              +A+ A+Q      ++ + L   TLK+ W   T
Sbjct: 107 RSHDANVALQ-----TLNGVQLENKTLKINWAFET 136

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 730 LRKDFLHYGSIEQIN-MLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDHRYEGLV 788
           L+ DF  YG+I  +  +++   C  V+F N++SAIR ++    K    N+ +  R+    
Sbjct: 323 LKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQAFELKGTELNKKYYKRW---A 379

Query: 789 INYGKD 794
           + YGKD
Sbjct: 380 MWYGKD 385

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 730 LRKDFLHYGSIEQIN-MLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDHRYEGLV 788
           LR+DF ++G+I +I+ M++   C  V F ++SS+I  +E       + N+ +   +    
Sbjct: 353 LRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESFEKPNSYLNKKYGRDWS--- 409

Query: 789 INYGKD 794
           I YG+D
Sbjct: 410 IAYGRD 415

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 601 NNRTIYIGNINPRSRAEDICNVVR--GGILQNIKFIEAKHICFITF---IEASAAVQFYA 655
           NN T++IG + P+     +  +    G IL  +K  + K+  F+ +   I+A AA+Q   
Sbjct: 384 NNTTVFIGGLTPKINEAQLQALFSPFGNIL-TVKIPQGKNCGFVKYENRIDAEAAIQ--- 439

Query: 656 NAFIDPIVLHGNTLKLGWGTYT 677
              +   ++ GN ++L WG  T
Sbjct: 440 --GMQGFIVGGNPVRLSWGRNT 459

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 586 MKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVR-GGILQNIKFIEAKHICFITF 644
           ++++  +   +GS+  N TI++G ++     +++  + R  G + ++K    K   F+TF
Sbjct: 291 LRSNGNIRQGLGSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTF 350

Query: 645 ---IEASAAVQFYANAFIDPIVLHGNTLKLGWG 674
              I+A AA++      +   ++ G  ++L WG
Sbjct: 351 KRRIDAKAAIK-----GLHGFLVRGCPIRLSWG 378

>NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {ON}
           Anc_8.670 YOR242C
          Length = 373

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 30/210 (14%)

Query: 600 FNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFI------EAKHICFITFIEASAAVQF 653
           ++ R++ I NI   +    I N + GG L+   +       +A +   + F+ ++ A  F
Sbjct: 170 YDRRSVTIENIPTYTGMYSILNQISGGPLEKFCYYRNENSRQATYTMTLNFLSSNNAQDF 229

Query: 654 YANAFIDPIVLHGNTLKLGWGTYTGPLPKPI-----ALAVTIGASRNVYISLPEIAFKDK 708
                 +   ++G  L+  W +  G +          LA T    R  YI L   + K  
Sbjct: 230 MKFGKTNLFKVNGFHLQPKWSSVEGSVSSQTNSAKSKLAKTGCICR--YIILKRHSGKTT 287

Query: 709 YIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQIN-MLNDSHCCWVNFMNISSAIRLV- 766
             K P  +       +  +E+ RKDF  YG I +I  +++   C  + + +I SA+R + 
Sbjct: 288 CTKVPILEY------VDIQEI-RKDFGCYGGIVEITPVISKKVCLSIGYYDIYSAVRAMV 340

Query: 767 --EDASTKQDHFNQLFDHRYEGLVINYGKD 794
             E++ST       L    ++   + YG D
Sbjct: 341 AYENSST------DLHKKYFQSWTLWYGND 364

>NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 bp,
           300 aa] {ON} Anc_3.379 YBR119W
          Length = 300

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 6/122 (4%)

Query: 610 INPRSRAEDICNVVRGGILQNIKFIEAK--HICFITFIEASAAVQFYANAFIDPIVLHGN 667
           I+P S +++I +  + GIL      +AK  + CFITF + S A++F  N +   + ++GN
Sbjct: 55  ISPTSESDEILDE-KNGILSISLSCKAKLSNQCFITFNDHSHAMEF-MNEYNSKLKVNGN 112

Query: 668 TLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESF--KLP 725
            +++ W      L   +   + +  +        E+A  +   K+ K K Y      KL 
Sbjct: 113 VVEIQWAKKESLLSLSLQNKIALEKALKNRKLQKELAHNESLRKNQKLKRYLRRLRHKLR 172

Query: 726 AK 727
           AK
Sbjct: 173 AK 174

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 91/215 (42%), Gaps = 20/215 (9%)

Query: 591 QVATAMGSDFN-NRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE------AKHICFIT 643
           Q  T++ S  N  R IYI +I      + I + + GG L+++K I+            + 
Sbjct: 150 QYKTSLDSSINPTRVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELV 209

Query: 644 FIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIG--ASRNVYISLP 701
           F++ + A  F   +      ++G  L    G+    L    A   TI    SR + +   
Sbjct: 210 FLKKADATNFLRYSRTHLFHINGKRLYSEPGSNNNLLNSNKAFDSTINNNISRTLIMKRY 269

Query: 702 EIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQIN-MLNDSHCCWVNFMNIS 760
               + +     +F I  + F +   E +RKDF  +G+I  I  +++   C  +++ NI 
Sbjct: 270 NKTTEKQEQVSKEFLI--DYFDI---EEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIK 324

Query: 761 SAIRLVEDASTKQDHFNQLFDHRY-EGLVINYGKD 794
           +A+    DA    D     F  +Y E  V+ YGKD
Sbjct: 325 AAM----DAMKAYDDPYSEFHKKYSEEWVVWYGKD 355

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 32.7 bits (73), Expect = 3.8,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 598 SDFNNRTIYIGNINPRSRAEDICNV-VRGGILQNIKFIEAKHICFITFIEASAAVQFYAN 656
           S    RT+Y+GNI+PR   ED+  + V+ G ++ I +   K    +   +  A ++F  +
Sbjct: 2   SSSKERTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDK---VLDTHQGYAFIEFLND 58

Query: 657 AFIDPIV-LHGNT 668
           + +D ++ L GNT
Sbjct: 59  STVDYVLKLFGNT 71

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,830,286
Number of extensions: 5342577
Number of successful extensions: 17927
Number of sequences better than 10.0: 76
Number of HSP's gapped: 18206
Number of HSP's successfully gapped: 127
Length of query: 1053
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 933
Effective length of database: 39,721,479
Effective search space: 37060139907
Effective search space used: 37060139907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)