Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034308.843ON54252426680.0
NDAI0E002808.843ON54952419470.0
NCAS0B002908.843ON54252818430.0
Skud_13.258.843ON53751116940.0
Suva_13.278.843ON55352816790.0
YML116W (ATR1)8.843ON54251316770.0
Smik_13.188.843ON54550916600.0
KNAG0J002608.843ON55049916560.0
NCAS0A02540singletonON53951716040.0
Kwal_27.102458.843ON51551015840.0
NCAS0C004008.843ON51751215730.0
Suva_13.4678.843ON54351315630.0
YMR279C8.843ON54052315600.0
SAKL0D01386g8.843ON52151015530.0
NDAI0K004008.843ON55350515510.0
CAGL0B02343g8.843ON53749715380.0
KLTH0C03806g8.843ON52551115330.0
Skud_13.4518.843ON53951715320.0
KAFR0A028408.843ON52050315270.0
Smik_13.4928.843ON54351515150.0
KAFR0B03930singletonON55549315120.0
TDEL0B005508.843ON53750914840.0
KAFR0B039408.843ON54750914800.0
CAGL0M03003g8.843ON55852014450.0
Kpol_541.168.843ON52851714380.0
TBLA0D032708.843ON55051814240.0
TPHA0C047908.843ON55648614040.0
TBLA0D03280singletonON58049813411e-180
TBLA0C01160singletonON60049211721e-154
Suva_8.435na 1ON5155068321e-104
Skud_15.545na 1ON5164918191e-102
Smik_15.560na 1ON5164768151e-102
YOR378Wna 1ON5154768131e-101
KLTH0C10560gna 1ON5154748061e-100
Kwal_23.6547na 1ON5114847754e-96
KLLA0B00352gna 1ON4984627422e-91
TDEL0G04950singletonON5124877292e-89
KNAG0D00130na 1ON5655085387e-61
KAFR0C04860na 1ON5344724151e-43
SAKL0C06116gsingletonON1851903873e-43
NCAS0A05720na 1ON5635303773e-38
CAGL0L02519gna 1ON5293983515e-35
NDAI0K02730singletonON6045503332e-32
Smik_6.24na 2ON5445131341e-07
SAKL0F00440gsingletonON5444721287e-07
Suva_10.11singletonON5405031215e-06
Skud_6.16na 2ON5495051162e-05
KLLA0C18931gna 3ON5532231143e-05
KLTH0D16962gsingletonON5711461072e-04
ABL040W2.473ON567661036e-04
NCAS0C03460na 4ON6302121020.001
SAKL0A00726gsingletonON598213980.003
CAGL0J01375g2.473ON56484960.005
SAKL0C05588gsingletonON677143940.008
Smik_13.2722.473ON56184940.009
KLLA0F13684g2.473ON571103930.010
NDAI0H022002.473ON571131930.012
YMR088C (VBA1)2.473ON56284920.012
Kwal_34.15746na 3ON518247910.017
SAKL0E02992g2.473ON57064910.018
KLTH0B10384gsingletonON551119900.024
Suva_13.2652.473ON56184890.028
NCAS0A078102.473ON56884890.030
Kpol_1039.192.242ON573242880.039
Skud_13.2442.473ON56284880.047
ZYRO0G03234g2.473ON56266860.075
TDEL0G03260singletonON612127860.076
Kwal_14.728singletonON568149850.093
YKR105C (VBA5)singletonON582420850.11
KLTH0B00132gsingletonON568147840.14
YPR198W (SGE1)singletonON543148830.15
TDEL0F039908.272ON63167840.15
NDAI0D010202.242ON592175830.17
SAKL0A08228gsingletonON569146820.23
SAKL0D04510gna 5ON531167820.23
KLLA0A04631g8.272ON57949800.35
CAGL0B02079gna 4ON624202800.36
Kpol_543.448.272ON64348790.50
KNAG0E025602.473ON57866780.70
SAKL0B12716gsingletonON632215780.71
Skud_16.503singletonON543242770.76
TDEL0D06610singletonON497122760.99
AGR076C8.272ON68649770.99
TDEL0B019008.446ON68756761.1
SAKL0H16808g8.272ON65748761.1
KLTH0C10142gsingletonON573146761.3
TBLA0E01970singletonON57853751.5
ZYRO0C01430g8.272ON59048751.6
KLTH0H16214gsingletonON551127751.6
KLLA0E24113g8.570ON57587741.8
ZYRO0E10230gsingletonON558194741.8
ZYRO0F02178gsingletonON595195732.4
TBLA0F030408.272ON90648732.8
Kwal_26.9616singletonON562149732.8
Skud_7.560na 4ON642129732.8
TPHA0I017608.570ON653175732.9
Smik_17.11singletonON544146723.2
YGR224W (AZR1)na 4ON613127723.4
NDAI0E038007.44ON62163724.0
TPHA0A017508.272ON63646714.9
Smik_16.81na 4ON625127705.4
Suva_10.9singletonON637201706.1
KLLA0F17776gna 6ON553150706.2
TPHA0G031502.473ON60065706.2
KLTH0B00594gsingletonON618127706.3
KLLA0E09879gsingletonON630167698.3
KLLA0D19941gsingletonON611129698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03430
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...  1032   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      754   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      714   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   657   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   651   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   650   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   644   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   642   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   622   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   614   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      610   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   606   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   605   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   602   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               602   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   597   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   595   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   594   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   592   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   588   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   587   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   576   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   574   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   561   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   558   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   553   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   545   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   521   e-180
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   456   e-154
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   325   e-104
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   320   e-102
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   318   e-102
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   317   e-101
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   315   e-100
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   303   4e-96
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   290   2e-91
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   285   2e-89
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   211   7e-61
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     164   1e-43
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   153   3e-43
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            149   3e-38
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   139   5e-35
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   132   2e-32
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    56   1e-07
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    54   7e-07
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    51   5e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    49   2e-05
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    49   3e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    46   2e-04
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    44   6e-04
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    44   0.001
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    42   0.003
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    42   0.005
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    41   0.008
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    41   0.009
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    40   0.010
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    40   0.012
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.012
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    40   0.017
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    40   0.018
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    39   0.024
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    39   0.028
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    39   0.030
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    39   0.039
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    39   0.047
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    38   0.075
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               38   0.076
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    37   0.093
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    37   0.11 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    37   0.14 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    37   0.15 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    37   0.15 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.17 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    36   0.23 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    36   0.23 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    35   0.35 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    35   0.36 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.50 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    35   0.70 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    35   0.71 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    34   0.76 
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    34   0.99 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    34   0.99 
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    34   1.1  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    34   1.1  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    34   1.3  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    33   1.5  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    33   1.6  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    33   1.6  
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    33   1.8  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    33   1.8  
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    33   2.4  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    33   2.8  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    33   2.8  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    33   2.8  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    33   2.9  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    32   3.2  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    32   3.4  
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44      32   4.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    32   4.9  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   5.4  
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    32   6.1  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   6.2  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    32   6.2  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    32   6.3  
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    31   8.3  
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    31   8.5  

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/524 (96%), Positives = 507/524 (96%)

Query: 19  AIDEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMS 78
           AIDEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMS
Sbjct: 19  AIDEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMS 78

Query: 79  QLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSL 138
           QLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSL
Sbjct: 79  QLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSL 138

Query: 139 VGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKN 198
           VGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKN
Sbjct: 139 VGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKN 198

Query: 199 IVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPT 258
           IVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPT
Sbjct: 199 IVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPT 258

Query: 259 NVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHY 318
           NVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAY                 YEVHY
Sbjct: 259 NVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHY 318

Query: 319 AASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFA 378
           AASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFA
Sbjct: 319 AASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFA 378

Query: 379 IWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFG 438
           IWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFG
Sbjct: 379 IWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFG 438

Query: 439 MDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKG 498
           MDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKG
Sbjct: 439 MDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKG 498

Query: 499 YRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           YRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS
Sbjct: 499 YRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/524 (69%), Positives = 431/524 (82%), Gaps = 5/524 (0%)

Query: 21  DEVSSGWTVENTD--SDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMS 78
           +E SS    EN +   D+L S  +      T   + KWQ+  YFQN+WQEY+F+ +CMMS
Sbjct: 29  EECSSITKEENNEVSEDELPSSEQEDN---TIGDHSKWQNPDYFQNKWQEYLFIFSCMMS 85

Query: 79  QLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSL 138
           QLLNQA  PQTLS+MNI+T SF S    +TWL+ASFPLVSGSFILISGR+GDIYGLK +L
Sbjct: 86  QLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 145

Query: 139 VGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKN 198
           +GG +FFIIW+LISGFT+Y+H+D FFI+SR+FQGLG+AFILPNVMG VGNIYKP+T RKN
Sbjct: 146 IGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKN 205

Query: 199 IVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPT 258
           IVIS+IGA AP+GAFMG+ FAGLIGT+NP  WPW+FYA AIAS + L  ++YSIPN+IPT
Sbjct: 206 IVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPT 265

Query: 259 NVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHY 318
           N+HGF+MDWIGS +AV+GLILLNFVWNQGPI GW KAY                 YE+ Y
Sbjct: 266 NIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKY 325

Query: 319 AASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFA 378
           A SP+LP  +T+NRH++MIL ALFLGWGSFGIFSFYYF+FLLNLRHYS +WAG TYFMFA
Sbjct: 326 AKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFA 385

Query: 379 IWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFG 438
           IWG VA+V+VG  I++ISAS+ILFFSMIAF++G+IMLSVTPV QTYFRMNLGTMIILSFG
Sbjct: 386 IWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFG 445

Query: 439 MDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKG 498
           MDMSFPAAAIILSD L  QYQGMAGSLANTMVNYSMSLCLGMG+TVE QIN++GK++LKG
Sbjct: 446 MDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKG 505

Query: 499 YRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           YRAAEYLG+G+A L +++S IYM E LW  RKER+ S  + ++S
Sbjct: 506 YRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS 549

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/528 (68%), Positives = 420/528 (79%), Gaps = 5/528 (0%)

Query: 20  IDEVSSGWTVENTDSDKLGSGNETSTHV--ATTDP---NCKWQDTTYFQNRWQEYIFVGT 74
           I E ++    E T   K G   E    V   T  P   + KWQ+  YFQN+WQEY+F+ +
Sbjct: 15  IMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFS 74

Query: 75  CMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGL 134
           CMMSQLLNQA  PQTLS+MNI+T SF+S    +TWL+ASFPLVSGSFILISGR+GDIYGL
Sbjct: 75  CMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGL 134

Query: 135 KWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNT 194
           K +LVGG IFFIIW++ISG T Y+HSDTFFIVSR+FQGL +AFILPNVMG VGNIYKP++
Sbjct: 135 KKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDS 194

Query: 195 FRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN 254
            RKNIVIS+IGA AP+GAF G+ FAGLIGT++PD WPW+FYA AIAS   L  ++YSIPN
Sbjct: 195 NRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPN 254

Query: 255 HIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXY 314
            +PTNVHGF+MDWIGS LAV+GLILLNFVWNQGPI GW  AY                 Y
Sbjct: 255 SVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTY 314

Query: 315 EVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTY 374
           EV YA SPLLP  +T+NRH++MIL ALFLGWGSFGIFSFYYF+FLLNLRHYS +WAG TY
Sbjct: 315 EVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTY 374

Query: 375 FMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMII 434
           FMFAIWG VA+V+VG  I+KISA+ ILF SM+AF++GIIMLSVTPV QTYFRMNLGTMII
Sbjct: 375 FMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMII 434

Query: 435 LSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKD 494
           LSFGMDMSFPAAAIILSD L  QYQGMAGSLANTMVNYSMSLCLGMG+TVE QIN++G D
Sbjct: 435 LSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGND 494

Query: 495 LLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           LLKGYR AEYLGIG+A L +I++ IY+ E LW  RK+ + +    +LS
Sbjct: 495 LLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLAANVVPDLS 542

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/511 (61%), Positives = 388/511 (75%), Gaps = 6/511 (1%)

Query: 28  TVENTDSDKLGSGNETSTHVAT------TDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLL 81
           +V          GNE +  ++T      T    +WQ+  YF+N W EY+F+ TCM+SQLL
Sbjct: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82

Query: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141
           NQA   QTLS+MNI+  SF SN  ++TWLMASFPLVSGSFILISGR+GDIYGLK  L  G
Sbjct: 83  NQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIG 142

Query: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201
            +  IIW+LI G T Y+ SDTFFI+SR+FQGLG+AF+LPNV+G +GNIY   TFRKNIVI
Sbjct: 143 YVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVI 202

Query: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261
           SL+GA APVGA +G  FAGLIGTKNP  WPW+FYA  I S + L  ++YSIPN+IPTN+ 
Sbjct: 203 SLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQ 262

Query: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAAS 321
            FSMDWIGS L V+GL+L+NFVWNQ PI GW +AY                 YE  +A S
Sbjct: 263 HFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKS 322

Query: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381
           PLLPR + ++RHM+ I++ALF GWGSFGIF+FYYF F LN+RHYS VWAGGTYFMF IWG
Sbjct: 323 PLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWG 382

Query: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441
           ++A+++VG+ I+K+S S+ LF SM+AF++G IM SVTPV +TYFR  LGTMIILSFGMD 
Sbjct: 383 IIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDF 442

Query: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501
           SFPA++II SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+ ++ +GK +LKGYR 
Sbjct: 443 SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRG 502

Query: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKER 532
           A+YLGIG+ASLA I+S +YM ER+  D K +
Sbjct: 503 AQYLGIGLASLACIISGLYMVERIIKDHKAK 533

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/528 (58%), Positives = 401/528 (75%), Gaps = 7/528 (1%)

Query: 22  EVSSGWTVENTDSDKLGSGNETSTHVATTDPN-------CKWQDTTYFQNRWQEYIFVGT 74
           E+ +   +E  DS    +     T +  T+          KWQ+  YF+  WQEY+F+ T
Sbjct: 26  EIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFT 85

Query: 75  CMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGL 134
           CM+SQLLNQ+   QTLS+MNIL  SF S+A +++WLMASFPLVSGSFILISGR+GDI+GL
Sbjct: 86  CMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGL 145

Query: 135 KWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNT 194
           K  L+ G +  IIW+LI G T Y+ SDTFFIVSR+FQGLG+AF+LPNV+G +GN+Y   T
Sbjct: 146 KNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205

Query: 195 FRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN 254
           FRKNIVIS IGA AP+GA +G FFAGLIGT NP+ WPW+FYA  I + + L+ ++Y+IPN
Sbjct: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN 265

Query: 255 HIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXY 314
           +IPTNVH FSMDWIGSGL V+GL+LLN VWNQ PI GW +AY                 Y
Sbjct: 266 NIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVY 325

Query: 315 EVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTY 374
           E+H+A SPLLP+ + ++RHM+ I+++LF GWGSFGIF+FYYF F LN+RHY+ +WAGG+Y
Sbjct: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSY 385

Query: 375 FMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMII 434
           FMF IWG++A+++VG SI+++S S+ LFF+M+AF+VG IM SVTPV +TYFRM +GTMII
Sbjct: 386 FMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMII 445

Query: 435 LSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKD 494
           LSFGMD+SFPA++II SD LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE Q++ +GK 
Sbjct: 446 LSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKH 505

Query: 495 LLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           +LKGYR A+YLGIG+ASLA I+S +YM E    D + +  +  + ++S
Sbjct: 506 ILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSMS 553

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/513 (59%), Positives = 393/513 (76%)

Query: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89
           +N   + L +   T +     D N KWQ+  YF+  WQEY+F+ TCM+SQLLNQA   QT
Sbjct: 30  DNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQT 89

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           LS+MNIL+ SF S   +++WLMASFPLVSGSFILISGR+GDIYGLK  L+ G +  IIW+
Sbjct: 90  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 149

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LI G T Y+ SDTFFI+SR+FQGLG+AF+LPNV+G +GNIY   TFRKNIVIS +GA AP
Sbjct: 150 LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 209

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269
           +GA +G  FAGLIGT++P  WPW+FYA +IA+ +  + ++Y+IP+ IPTN+H FSMDWIG
Sbjct: 210 IGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIG 269

Query: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVIT 329
           S L V+GLILLNFVWNQ PI GW +AY                 YE+ +A +PLLPR + 
Sbjct: 270 SVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVI 329

Query: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
           ++RHM+ I++ALF GWGSFGIF+FYYF F LN+R Y+ +WAGGTYFMF IWG++A+++VG
Sbjct: 330 KDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVG 389

Query: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449
            +I+ +S S+ LFFSM+AF+VG IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 390 FTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 449

Query: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509
            SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+Q+N +GK LLKGYR A+YLGIG+
Sbjct: 450 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGL 509

Query: 510 ASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           ASLA ++S +YM E     R+ R  +  +  ++
Sbjct: 510 ASLACMISGLYMVESFIKGRRARAAAEYDCTVA 542

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/509 (60%), Positives = 391/509 (76%)

Query: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89
           +N   + L     T+      + N KWQ+  YF+  WQEY+F+ TCM+SQLLNQA   QT
Sbjct: 33  DNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           LS+MNIL+ SF S   +++WLMASFPLVSGSFILISGR+GDIYGLK  L+ G +  IIW+
Sbjct: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LI G TNY+ SDTFFI+ R+FQGLG+AF+LPNV+G +GNIY   TFRKNIVIS +GA AP
Sbjct: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269
           +GA +G  FAGLIGT+NP+ WPW+FYA +IAS +    ++Y+IPN+IPTN+H FSMDWIG
Sbjct: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272

Query: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVIT 329
           S L V+GLILLNFVWNQ PI GW +AY                 YE+ +A SPLLP  + 
Sbjct: 273 SVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVI 332

Query: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
           ++ HM+ I++ALF GWGSFGIF+FYYF F LN+RHY+ +WAGGTYFMF IWG++A+++VG
Sbjct: 333 KDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVG 392

Query: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449
            +I+ +S S+ LFFSM+AF+VG IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 393 FTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 452

Query: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509
            SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+Q++ +GK LLKGYR A+YLGIG+
Sbjct: 453 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGL 512

Query: 510 ASLAVILSLIYMCERLWIDRKERMESTSE 538
           ASLA ++S +YM E    D K +  + ++
Sbjct: 513 ASLACMISGLYMVESFINDHKAKAATEND 541

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 379/499 (75%)

Query: 29  VENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQ 88
           VE   +    S  E  +    TD +  WQ+ TYF NRWQEY F+ TCM++QLLNQA   Q
Sbjct: 35  VEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQ 94

Query: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148
             + MNIL  +F+S+AK QTWLMASFPLVSGSFIL+SGR+GDIYGLK +L+GG +  +IW
Sbjct: 95  ATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIW 154

Query: 149 ALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACA 208
           +LI GF NYTH+D FFI+ R+FQGLG+AFILPNVMG +GNIYK NT RKN VIS +G CA
Sbjct: 155 SLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA 214

Query: 209 PVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWI 268
           P+GA +G  ++GLI  +NP  WPW FYA AI   + ++ A+YSIP+ +PTN+HGF MDW 
Sbjct: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWT 274

Query: 269 GSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVI 328
           GS + VVG+IL NFVWNQGPIDGW K Y                 YE+ +A SPLLP  +
Sbjct: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEV 334

Query: 329 TQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVV 388
            +NRH+ MIL+A+F+GWGSFGI++FYY+AF LNLRHYS VWAGGT+FMF IWG +A+ +V
Sbjct: 335 IKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLV 394

Query: 389 GLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAI 448
            L+I+++  S++L FSM  F VG IMLSVTPV Q+Y++MNLG  IILSFGMD+SFPA++I
Sbjct: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454

Query: 449 ILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIG 508
           ILSD LP+QYQGMAGSL NTMVNYS SLCLG+GST E+Q+N+NG D LKGYRAA Y+GIG
Sbjct: 455 ILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIG 514

Query: 509 IASLAVILSLIYMCERLWI 527
           + +  ++++  Y+ E LWI
Sbjct: 515 LGACGMLVAFCYLFEVLWI 533

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 384/517 (74%), Gaps = 5/517 (0%)

Query: 21  DEVSSGWTVENTDSDKLGSGNETSTHVATTD----PNCKWQDTTYFQNRWQEYIFVGTCM 76
           D  SS  TV   + DK  S NE   +  +TD     +  WQ+  YF ++++EY F+ TCM
Sbjct: 12  DNFSSS-TVSFPNEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCM 70

Query: 77  MSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKW 136
           ++ LLNQA   Q LS MN++++SFHS++  QTWLMASFPLVSGSFILISGR+GDIYGLK 
Sbjct: 71  VANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKK 130

Query: 137 SLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFR 196
           +++GG IF IIW+L+ GF ++TH+DTFFIV R+FQGLG++FILPNVMG +GNIYK  T R
Sbjct: 131 TMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLR 190

Query: 197 KNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHI 256
           KNIVIS+IG  AP GA MGA + GLI T+N   WPW FYA A+   + L+ ALYS+PN I
Sbjct: 191 KNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCI 250

Query: 257 PTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEV 316
           PTNVH F+MDWIGS + VVGLIL NFVWNQGP+ GW KAY                 YE+
Sbjct: 251 PTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYEL 310

Query: 317 HYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFM 376
            Y  SPLLP  +T+N  ++ IL  LFLGWG+FGI++FYYFAF LNLR YS VW GGTYFM
Sbjct: 311 KYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFM 370

Query: 377 FAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILS 436
           F IWG +A+++V  +I+K+  +I+LFFS + F +G +MLSVTP+ Q Y+RMNLG  IIL 
Sbjct: 371 FIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILC 430

Query: 437 FGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLL 496
           FGMD+SFPA++IILSD LP QYQGMAGSL NT++NY+ SLCLGMG+TVE QIN++G+DLL
Sbjct: 431 FGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLL 490

Query: 497 KGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERM 533
           KGYR+A YL +G+  L   ++ I +C  LW+ R++R+
Sbjct: 491 KGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRL 527

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/510 (59%), Positives = 374/510 (73%), Gaps = 8/510 (1%)

Query: 30  ENTDSD---KLGS----GNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLN 82
           EN D +   KL S    G E         P  + Q+  YF   W+EYIFV + M+SQLLN
Sbjct: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64

Query: 83  QACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGN 142
           QA   QT  L ++L+K  ++    Q WLMASFPLVSGSFIL+SG+VGDIYGLK +L+GG 
Sbjct: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124

Query: 143 IFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVIS 202
           +  +IW+LI G ++Y H+  FF+V+RSFQGLG+AF+LPNVMG VGNIYKPNT  KN+V S
Sbjct: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184

Query: 203 LIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHG 262
           LIGACAP+GA +G  F+GLIG +  D W W+FYA AI + L  L AL+ IPN+IPTNV+ 
Sbjct: 185 LIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243

Query: 263 FSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASP 322
           + MDWIGS + V GLIL NFVWNQ PI GWG AY                 YE+ +A  P
Sbjct: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQP 303

Query: 323 LLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGV 382
           LLP  +  NR ++MIL +LF GWGSFGI++FYY +F+LNLRHYS +WAGGTYFMFAIWG+
Sbjct: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363

Query: 383 VASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMS 442
           VAS++VG +I K   ++ILF SM+AFD G IML+VTPV QTYFRM LG MIILSFGMD+S
Sbjct: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423

Query: 443 FPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAA 502
           FPAA+IILSD LP+QYQGMAGSL +TM++YSMSLCLG+  T E Q+N+NG DLLKGY+AA
Sbjct: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483

Query: 503 EYLGIGIASLAVILSLIYMCERLWIDRKER 532
            Y+GIG+ASL V++S  +M E  W  R++R
Sbjct: 484 LYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/512 (56%), Positives = 379/512 (74%)

Query: 29  VENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQ 88
           +EN +     S  +T +  +  + +  WQ+  YFQ+  +EY F+ TCM + LLNQA   Q
Sbjct: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60

Query: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148
            LS MN++++SFHS+   QTWLMASFPLVSGSFILISGR+GDIYGLK +++GG IF IIW
Sbjct: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120

Query: 149 ALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACA 208
            L+ GF +YTHSDTFFIV R+FQGLG++FILPN+MG VGNIYK  T RKNIVISLIG  A
Sbjct: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180

Query: 209 PVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWI 268
           P GA MGA + GLI T++   WPW FYA A+A+ + L+ A+YS+P ++PTNVH F+MDW+
Sbjct: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240

Query: 269 GSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVI 328
           G+ + VVGLIL NFVWNQGP++GW K Y                 YE+ +  SPLLPR +
Sbjct: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREV 300

Query: 329 TQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVV 388
           T+N  ++ IL  LFLGWGSFGI++FYY+AF LNLR+YS +WAG T+FMF IWG +A+ +V
Sbjct: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360

Query: 389 GLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAI 448
           G +I ++  +++LFFS + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+SFPA++I
Sbjct: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420

Query: 449 ILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIG 508
           ILSD LP QYQGMAGSL NT++NYS SLCLGMG+TVE QIN+ G++LL+GYR+A YL +G
Sbjct: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVG 480

Query: 509 IASLAVILSLIYMCERLWIDRKERMESTSETN 540
           +  L   ++ + +C  LW  RK R++     N
Sbjct: 481 LGGLGACVAFLNLCYDLWRKRKSRLDDIRSLN 512

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/513 (58%), Positives = 381/513 (74%), Gaps = 4/513 (0%)

Query: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89
           E+ D   + S N+ ST V+   P   WQD TYF +  +E +F+ TCM++QLLNQA     
Sbjct: 35  EDEDVTTVASSNK-STQVSNDSP---WQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHA 90

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           L++MN+L+KSF+S +  Q WLMASFPLV+GSFILISGR+GDIYGLK  L+ G +  I+W+
Sbjct: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LI G + Y+++D FFI  R+FQGLG+AFILPNVMG VG++YK  + RKN+VIS IGACAP
Sbjct: 151 LICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAP 210

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269
            G   G  F GLI  ++ + WPW FYA AIA  L ++ A YSIPN+IPTNVHGFSMDW G
Sbjct: 211 AGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTG 270

Query: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVIT 329
           S LAV+GLIL NFVWNQ P  GWG AY                 YEV YA  PLLP  +T
Sbjct: 271 SVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVT 330

Query: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
           +NRHM+MIL+A+FLGWGSFGI++FYY +F LNLRHYS VW GGTYF+F I+G +A+ +V 
Sbjct: 331 KNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVA 390

Query: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449
           LSI+++  + +L F+++AFDVG IM SV PVKQ+++++N G   IL FGMD+SFPA++II
Sbjct: 391 LSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSII 450

Query: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509
           LSD LP +YQGMAGSL NT++NYS SLCLGMG+TVE QIN+NGKDLLKGYR A YLG+G+
Sbjct: 451 LSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGL 510

Query: 510 ASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           ASL V++S  YM E  W +R++R + +  T +S
Sbjct: 511 ASLGVLISFTYMLETFWNNRRDRQKDSVITEMS 543

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/523 (56%), Positives = 382/523 (73%), Gaps = 7/523 (1%)

Query: 21  DEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCK------WQDTTYFQNRWQEYIFVGT 74
            E+    TV+  D   + + +E  T + ++  + +      WQD TYF +  +E +F+ T
Sbjct: 16  SEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIAT 75

Query: 75  CMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGL 134
           CM++QLLNQA     L +MN+L+KSF+S A NQ WLMASFPL +GSFILISGR+GDIYGL
Sbjct: 76  CMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGL 135

Query: 135 KWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNT 194
           K  L+ G +  I+W++ISG + Y++SD FFI SR+FQG+G+AFILPN+MG VG++YK  +
Sbjct: 136 KKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGS 195

Query: 195 FRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN 254
           FRKNIVIS IGACAP G   G  F GLI T++P+ WPW FYA  IA+ L+LL A YSIPN
Sbjct: 196 FRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPN 255

Query: 255 HIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXY 314
           ++PTN+HG SMDW GS LA++GLIL NFVWNQ PI GW K Y                 Y
Sbjct: 256 NVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVY 315

Query: 315 EVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTY 374
           E  YA  PLLPR +T+NRHM+MIL+A+FLGWGSFGI++FYY +F LNLRHYS VW GGTY
Sbjct: 316 ESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTY 375

Query: 375 FMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMII 434
           F+F I+G +A+  V  SI+++  +++L FS++AFD G IM SV PV+Q+Y+++N     I
Sbjct: 376 FVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAI 435

Query: 435 LSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKD 494
           L FGMD+SFPA++IILSD LP QYQGMAGSL NT++NYS SLCLGMG TVE QIN++G D
Sbjct: 436 LCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGND 495

Query: 495 LLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTS 537
           LLKGYRAA YLG+G+ASL V++S+ YM E LW +R  + E  S
Sbjct: 496 LLKGYRAAVYLGVGLASLGVVISVTYMLENLW-NRHRKSEDRS 537

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/510 (58%), Positives = 377/510 (73%), Gaps = 6/510 (1%)

Query: 31  NTDSDKLGSGNET--STHVATTDPNCKW---QDTTYFQNRWQEYIFVGTCMMSQLLNQAC 85
           ++ S +LG+ + T  + H      + KW   QD TYF   W+EY+F+   MMSQLLNQA 
Sbjct: 11  SSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAG 70

Query: 86  IPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFF 145
             QTLSL+NIL+K+F S+   QTWLMASFPLVSGSFIL+SG++GDIYGLK +L+ G +  
Sbjct: 71  TTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVT 130

Query: 146 IIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIG 205
           IIW+LI G T+YT S  FFI+SR+FQGLG+AFILPN+MG VGNIY   T RKN+VISLIG
Sbjct: 131 IIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIG 190

Query: 206 ACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSM 265
           ACAP+GA MG  F+GLIGT + + W W+FYA  I + + +  +++ IPN IPTNV G SM
Sbjct: 191 ACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSM 249

Query: 266 DWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLP 325
           DWIGSG+ ++G+IL NFVWNQGPI GW  AY                 YE  YA  PL+P
Sbjct: 250 DWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIP 309

Query: 326 RVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVAS 385
           R    N  ++M L+A+F GWGSFGI++FYYF F+LNLR Y+ +WAGG+YFMF IWG++A+
Sbjct: 310 RPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAA 369

Query: 386 VVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPA 445
           + VG +I++I  S+ILF SM+AFD G IMLSVTPV QTYFRM LG MIILSFGMD+SFPA
Sbjct: 370 ISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPA 429

Query: 446 AAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYL 505
           ++IILSD LP + QGMAGSL +TM+NYSMS+CLG+  TVE QIN+NG DLLKGYRAA YL
Sbjct: 430 SSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYL 489

Query: 506 GIGIASLAVILSLIYMCERLWIDRKERMES 535
           GIG+ASL V +S ++M E     R+  ++ 
Sbjct: 490 GIGLASLGVFISALFMLENYLRMRRRNVKE 519

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/505 (59%), Positives = 374/505 (74%)

Query: 28  TVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIP 87
           T      D++GS + T++  +  + N  WQ+  YF + ++EYIFV TCM++ LLNQA   
Sbjct: 35  TAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQS 94

Query: 88  QTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFII 147
           Q LS MN+++ SFHS+   QTWLMASFPLVSGSFILISGR+GDIYGLK  ++GG IF II
Sbjct: 95  QVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMII 154

Query: 148 WALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGAC 207
           W+LI GFTNY HSDTFFIV+R+FQGLG++FILPNVMG VGNIYK  T RKN+VISLIG  
Sbjct: 155 WSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIM 214

Query: 208 APVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDW 267
           AP G+  GA + GLI T+NP  WPW FYA A+A+ + L+   Y++P++IPTNV+GF+MDW
Sbjct: 215 APTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDW 274

Query: 268 IGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRV 327
           IGS L V+GLIL NFVWNQGPI GW KAY                 YE+ YA  PLLP+ 
Sbjct: 275 IGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKA 334

Query: 328 ITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVV 387
           +TQN H++ IL  LFLGWGSFGI++FYYFAF LNLR YS VW+GGT+F+F I+G VA+  
Sbjct: 335 VTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATT 394

Query: 388 VGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAA 447
           V L+I+K+  +I+LFFS I F  G I++SVTPV QTY+R   G  IIL FGMD+ FPA++
Sbjct: 395 VALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASS 454

Query: 448 IILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGI 507
           IILSD LP QYQGMA SL NT+VNYS SLCLGMG+TVE QIN++G DLLKGYRAA Y G+
Sbjct: 455 IILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGV 514

Query: 508 GIASLAVILSLIYMCERLWIDRKER 532
           GIA L   ++ + +C  +W  R  +
Sbjct: 515 GIAGLGACIAFLNVCHDIWSKRNAK 539

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/497 (57%), Positives = 366/497 (73%), Gaps = 1/497 (0%)

Query: 41  NETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF 100
           +E        D N KWQ+  YF +  +EY+F+ +C +SQLLNQA   QT  +MNI+  S 
Sbjct: 35  DEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSL 94

Query: 101 HSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHS 160
            S    Q WLMA+FPL+SGSFILISGR+GDIYGLK +L+ G +F I+W+LI G T Y HS
Sbjct: 95  DSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHS 154

Query: 161 DTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAG 220
           D+FFIVSR+FQGLG++ ILPN++G VG+IY   + RKN+VISLIG  AP+GA +GA F+G
Sbjct: 155 DSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSG 214

Query: 221 LIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILL 280
           LIGT++ + WPW+FY+ AI + +  + +++ IPN IPTNVHG  MDWIGSGL VVGLI+L
Sbjct: 215 LIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIML 274

Query: 281 NFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYA-ASPLLPRVITQNRHMVMILM 339
           NFVWNQ PIDGW  AY                 YE+H+   +PLLP+ + ++   +++L 
Sbjct: 275 NFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLF 334

Query: 340 ALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASI 399
           ALF GWGSFGIFSFYYF F LNLRHY+ +WAGGTYFMF IWG+VA++VVG +I+K+  SI
Sbjct: 335 ALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSI 394

Query: 400 ILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQ 459
           ILF SM+AF+ G I++SVTP+ QTYFR +LG MIILSFGMD+SFPA++I+LSD LP QYQ
Sbjct: 395 ILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQ 454

Query: 460 GMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLI 519
           GMAGSL NTMVNYSMS CLG+   VE  +N +GKD+LKGYR A YLGIG+AS+A I+S  
Sbjct: 455 GMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGA 514

Query: 520 YMCERLWIDRKERMEST 536
            M   +   RK   +S 
Sbjct: 515 LMLSEIIQGRKNEKDSA 531

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/511 (56%), Positives = 370/511 (72%), Gaps = 9/511 (1%)

Query: 30  ENTDSDKLGSGNETSTHVATTDPNC--------KWQDTTYFQNRWQEYIFVGTCMMSQLL 81
           E T   K  +G++ S  V     +         + Q+  YF  +W+EY+FV + M+SQLL
Sbjct: 4   EYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLL 63

Query: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141
           NQA   Q   L ++L++   + A  Q WLMASFPLVSGSFIL+SG+VGDIYGLK +L+GG
Sbjct: 64  NQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123

Query: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201
               +IW+LI G ++Y H+  FFIV+RSFQGLG+AF+LPNV G VGNIYKPNT  KN+V 
Sbjct: 124 YAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVF 183

Query: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261
           S+IGACAP+GA +G  F+GLIGT++ + W W+FYA  I + L  L A Y IP++IPTNVH
Sbjct: 184 SMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH 242

Query: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAAS 321
            F MDW+GS L V GLI+ NFVWNQ P DGW  AY                 +E  +A  
Sbjct: 243 KFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKE 302

Query: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381
           PLLPR +  NR ++MIL +LFLGWGSFGI+++YY AF+LNLRHY+ +WAGG+YFMFAI+G
Sbjct: 303 PLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFG 362

Query: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441
            +A+ +VG +I K   +IIL  S+IAFDVG IMLSVTPV QTYFRM+LGTM+ILSFGMD+
Sbjct: 363 TIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDL 422

Query: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501
           SFPA++IILSD LP+QYQGMAGSL NTM+NYSMSLCLG+  T E Q+N++G DLLKGYRA
Sbjct: 423 SFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRA 482

Query: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKER 532
           A Y+GIG+AS+ + +S  Y  E  W  R+ER
Sbjct: 483 ALYVGIGLASVGIFVSGAYAIEDWWTRRRER 513

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/517 (55%), Positives = 384/517 (74%), Gaps = 5/517 (0%)

Query: 28  TVENTDSDKLGSGNETSTHVATTDPN-----CKWQDTTYFQNRWQEYIFVGTCMMSQLLN 82
           +++  D   + +  E +T  +++  N       WQD TYF +  +E +F+GTCM++QLLN
Sbjct: 23  SMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLN 82

Query: 83  QACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGN 142
           QA     L +MN+L+KSF S + NQ WLMASFPL +GSFILISGR+GDIYGLK  L+ G 
Sbjct: 83  QAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGY 142

Query: 143 IFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVIS 202
           +  I+W++ISG + Y+++D+FFI  R+FQG+G+AFILPN+MG VG++YK  + RKN+VIS
Sbjct: 143 VIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVIS 202

Query: 203 LIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHG 262
           +IGAC P GA  G  F GLI T++P+ WPW FYA  IA+ +++L A YSIPN++PTNVHG
Sbjct: 203 VIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHG 262

Query: 263 FSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASP 322
            SMDW GS LAV+GLIL NFVWN+ PI GW KAY                 YE+ YA  P
Sbjct: 263 LSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVP 322

Query: 323 LLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGV 382
           LLP  +T+NRHM+MIL+A+F+GWGSFGI++FYY +F LNLRHYS VW GGTYF+FAI+G 
Sbjct: 323 LLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGT 382

Query: 383 VASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMS 442
           +A+  V  SI+++  +++L F+++AFD G IM SV PV+Q+Y+++N     +L FGMD+S
Sbjct: 383 IAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLS 442

Query: 443 FPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAA 502
           FPA++IILSD LP QYQGMAGSL NT++NYS SLCLGMG+TVE QIN++GK++L+GYRAA
Sbjct: 443 FPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAA 502

Query: 503 EYLGIGIASLAVILSLIYMCERLWIDRKERMESTSET 539
            YLGIG+ASL V++S+ YM E +W +RK+    + E 
Sbjct: 503 VYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLEA 539

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/503 (59%), Positives = 381/503 (75%)

Query: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89
           E+  SD     +             KWQD  YF+N +QEY+FVG+CM +QLLNQA  PQT
Sbjct: 11  EHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           LS+MN+L+ SF+S+  NQTWL+ASFPLV+GSFILISGR+GDIYGLK +L+GG IF IIW+
Sbjct: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LI GFT Y+ SDTF I++R+FQGLG+AF LPNV+G +GNIY   + RKN+VISLI A AP
Sbjct: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAP 190

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269
           VGA +G  FAGLI T++P  WPWSFYA AIA +  LL ++YSIP++IPTNV+GF MDWIG
Sbjct: 191 VGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIG 250

Query: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVIT 329
           S L V GLIL NF WNQGPI GW  AY                 YE+++A SPL+ R IT
Sbjct: 251 SALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREIT 310

Query: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
            +R+M++ +  LFLGWGS+GI+SFYYF+F+LNLRHYS VWAGG+YF+F I+GV+AS  VG
Sbjct: 311 HSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVG 370

Query: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449
           +SI+KI+A +IL FSM+ F VG  +LSV PV Q+YF++ L  M IL  G+D SFPAA II
Sbjct: 371 ISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATII 430

Query: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509
           LSD LP +YQGMAGSLA TMVNYSMSLCLGMG+TVE QIN++G+D+LKGYR+AEYLGIG+
Sbjct: 431 LSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGL 490

Query: 510 ASLAVILSLIYMCERLWIDRKER 532
           + L ++L+ I + ++L    + +
Sbjct: 491 SGLGLLLACILVIDKLVAKYRNK 513

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/515 (57%), Positives = 378/515 (73%), Gaps = 4/515 (0%)

Query: 28  TVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIP 87
           + E+ +   + S NE S  V    P   WQD  YF +  +E +F+ TCM++QLLNQA   
Sbjct: 33  STEDEEVTTVTSSNE-SNQVTNDSP---WQDPIYFSSFGKELMFIATCMLAQLLNQAGQT 88

Query: 88  QTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFII 147
             L +MN+L+KSF+S + NQ WLMASFPL +GSFILISGR+GDIYGLK  L+ G +  II
Sbjct: 89  HALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIII 148

Query: 148 WALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGAC 207
           W++ISG + Y++SD FFI  R+FQGLG+AFILPN+MG VG++YK  + RKN+VIS+IGAC
Sbjct: 149 WSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGAC 208

Query: 208 APVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDW 267
           AP G   G  F GLI T++P+ WPW FYA +IA+ ++LL A YSIPN++PTNVHG SMDW
Sbjct: 209 APAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDW 268

Query: 268 IGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRV 327
            GS LAV+GLIL NFVWNQ PI GWG+AY                 YE+ YA  PLLP  
Sbjct: 269 TGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHA 328

Query: 328 ITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVV 387
           +T+NRHM+MIL+A+FLGWGSFGI++FYY +F LNLRHYS VW GGTYF+F I+G +A+  
Sbjct: 329 VTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFF 388

Query: 388 VGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAA 447
           V  SI+++  +I+L F+++AFD G IM SV PV+Q+Y+++N     IL FGMD+SFPA++
Sbjct: 389 VAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASS 448

Query: 448 IILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGI 507
           IILSD LP QYQGMAGSL NT++NYS SLCLGMG TVE QIN++G++LLKGYRAA YLGI
Sbjct: 449 IILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGI 508

Query: 508 GIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
           G+ASL +++S+ YM E  W   KE  +   E   S
Sbjct: 509 GLASLGLLISVTYMLENFWNKHKESEKKRLEAETS 543

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 371/493 (75%)

Query: 50  TDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTW 109
           +D N  WQ+ +YF +RW+EY+F+ TCM+S LLNQA   Q  S MN++  +F++++ ++TW
Sbjct: 63  SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122

Query: 110 LMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRS 169
           LMASFPLVSGSFIL+SGR+GDIYGLK +++GG I  IIW+LI GF NY+ S TFFI+ R+
Sbjct: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182

Query: 170 FQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDD 229
           FQGLG+AF+LPNVMG VGNIYK  + RKNIVIS IG CAP GA  GAF+AGLI TK    
Sbjct: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242

Query: 230 WPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPI 289
           WPW FYA A A  L L+ A+YSIP+ +P NVHGFSMDW GS + V+GLIL NFVWN+ PI
Sbjct: 243 WPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPI 302

Query: 290 DGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFG 349
            GW KAY                 YE+ +A SPLLP+ +T N +++MIL A+F+GWGSFG
Sbjct: 303 VGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFG 362

Query: 350 IFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFD 409
           I++FYY+AFLLNLR Y+ + AG ++ MF +WG +A+  V  +I+++  S++LF SM+AF 
Sbjct: 363 IWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFT 422

Query: 410 VGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTM 469
           VG IMLS+TPV QTY++M  G  IIL+FGMD+SFPA++IILSD+LP +YQGMAGSL NT+
Sbjct: 423 VGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTI 482

Query: 470 VNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDR 529
           VNYS SLCLGMG+T E Q+N+NG DLLKGYRAA Y+GIG+  + VI++ +++ E L   R
Sbjct: 483 VNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKR 542

Query: 530 KERMESTSETNLS 542
                 T++ ++S
Sbjct: 543 GRTAALTAKKDMS 555

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 364/509 (71%), Gaps = 1/509 (0%)

Query: 32  TDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLS 91
           +  DK+ +  E    V   +P   WQD  YF+ +W E +FV +CMM QLLNQA    TLS
Sbjct: 28  SREDKMLT-TEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLS 86

Query: 92  LMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALI 151
            M +L +   S++   +WLMASFPLVSGSFILISGR+GDIYGLK  L+ G I+  IW+LI
Sbjct: 87  TMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLI 146

Query: 152 SGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVG 211
            G ++++H+DTFFI SR+FQGLG++F+LPN++G VGNIYKP T RKNIVISLIG CAP+G
Sbjct: 147 CGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIG 206

Query: 212 AFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSG 271
           A  G  FAG++  +   DWPW+FYA  IA+ LT + + + IPN IP NV+ F+MDWIGS 
Sbjct: 207 ATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSA 266

Query: 272 LAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQN 331
           L V GL+L NFVWNQ  + GW   Y                 +E+ YA  PLLP+ +T++
Sbjct: 267 LGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTES 326

Query: 332 RHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLS 391
           R ++MIL +L  GWGSFGI+ FYYF F+L LR+YS VWAGGT+FM +I G +A++ VG S
Sbjct: 327 RSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFS 386

Query: 392 IRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILS 451
           I+++  +++LFFSMIAF  G I+LSVTPV +TYFR  LG M+ILSFGMD+SFPAA+IILS
Sbjct: 387 IKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILS 446

Query: 452 DSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIAS 511
           D L  QYQGMAGSL NT+VNYSMSL LG+G T+E QIN++G  LL+G+RAA Y  IG+ S
Sbjct: 447 DELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGS 506

Query: 512 LAVILSLIYMCERLWIDRKERMESTSETN 540
           L +++S +++ ++  +  K R E+  E N
Sbjct: 507 LGILISGVFVLQKELMRSKSRKENELEYN 535

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 357/509 (70%)

Query: 32  TDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLS 91
           +DS K    + T   V++   N KWQD TYF++ WQEY F+GTCM++ LLNQA   QTLS
Sbjct: 37  SDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLS 96

Query: 92  LMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALI 151
            MN+L  S +S+   +TWLMASF L SGSFIL+SGR+GDIYGLK + +GGNI F IW+++
Sbjct: 97  TMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSIL 156

Query: 152 SGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVG 211
            G + YT + TFFI+ R+FQGLGVAF+LPNVMG VGNIY   + RKNIVIS IG  APVG
Sbjct: 157 CGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVG 216

Query: 212 AFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSG 271
              G  + GLI   N D WPW F+A AIA  + L+  +YSIPNH+PTN++   MDWIGS 
Sbjct: 217 QTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSL 276

Query: 272 LAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQN 331
           L V+GLIL+NFVWNQ PI GW KAY                 YE+  A SPLLP  +T+N
Sbjct: 277 LGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKN 336

Query: 332 RHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLS 391
           RH+V I+++LFLGWG+FGI++FYY+AF LNLRH+S +WAG T+F+F I+G + ++ V  +
Sbjct: 337 RHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT 396

Query: 392 IRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILS 451
           I K+  S++   S I F  G I+ SVT   QTY+R +LG  IIL+ GMD+SFP ++IILS
Sbjct: 397 INKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILS 456

Query: 452 DSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIAS 511
           D LP QYQGM+GSL NT+ NY+ SLCLGMG+T E Q N  GKD+LKGYRAA Y+ IG+ +
Sbjct: 457 DLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGA 516

Query: 512 LAVILSLIYMCERLWIDRKERMESTSETN 540
           L    S  YM E LWI  ++R ++  + +
Sbjct: 517 LGFAFSFSYMAEDLWIRYRKRRQNEKKED 545

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/520 (57%), Positives = 378/520 (72%), Gaps = 10/520 (1%)

Query: 30  ENTDSDKLGSGNE----TSTHVATTDPNCK-----WQDTTYFQNRWQEYIFVGTCMMSQL 80
           E + SD+  S ++    TS     +  +C      +Q+  YF+  ++E +F+ +CM++QL
Sbjct: 38  ECSSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQL 97

Query: 81  LNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVG 140
           LNQA   Q+LS MN+L   F SN+  Q WLMASFPLVSGSFILISGR+GDIYGLK +L  
Sbjct: 98  LNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSV 157

Query: 141 GNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIV 200
           G I   +W++I G   YT+SD FFIV RSFQGLG+AFILPN+MG VGNIYK  T RKNIV
Sbjct: 158 GYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIV 217

Query: 201 ISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNV 260
           IS IG  AP GA +GA F GLI T++ + WPW FYA  IAS + +L ALYSIPN++PTN+
Sbjct: 218 ISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNL 277

Query: 261 HGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAA 320
           +  +MDWIGS L V GL+LLN VWNQ PI GWG+AY                 YE+ YA 
Sbjct: 278 NNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT 337

Query: 321 SPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIW 380
           SPLLP  + +N+ ++MIL ALF GWGSFGI+++YY+AF LNLR Y+ +WAGGT+FMF IW
Sbjct: 338 SPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIW 397

Query: 381 GVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMD 440
           G VA+ VV L+I+K+  +++L FSM+AFD G IMLSVTPV QTY+RMN+G  IILSFGMD
Sbjct: 398 GTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMD 457

Query: 441 MSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYR 500
           +SFPA++IILSD LP QYQGMAGSL NT+VNYS SLCLGMG+TVE Q N +G DLLKGYR
Sbjct: 458 LSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR 517

Query: 501 AAEYLGIGIASLAVILSLIYMCERLWIDR-KERMESTSET 539
           +A YL IG+AS  V +SL+++   +   R ++R+ES  E+
Sbjct: 518 SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECES 557

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 366/517 (70%), Gaps = 3/517 (0%)

Query: 22  EVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLL 81
           EVSS +  E T        N+ S  +   + + +  D  YF +  QEY F+ +CM+SQLL
Sbjct: 11  EVSS-YIAEETIRSDCSDANDESPSMELKNSSLRNPD--YFNSTTQEYAFIFSCMLSQLL 67

Query: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141
           N A   QTLS+MN+LT+  HS+   + WL+ASFPLVSGSFIL+SGR+GDIYGLK  L+ G
Sbjct: 68  NLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILG 127

Query: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201
            +  +IW+LI+G + Y+HS  FFI++R+FQGLG++ +LPNV+G +G IYKP T +KN+VI
Sbjct: 128 YVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVI 187

Query: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261
           S++GA +P+GA +G  F+GL+ T++   WPW+FYA  +A+ +    + YSIPN+IPTNV+
Sbjct: 188 SIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVN 247

Query: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAAS 321
             SMDWIGS   V+GLIL NFVWNQ P DGW  AY                 YE+ YA +
Sbjct: 248 RLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAEN 307

Query: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381
           PLLP  I +NR ++MIL A+  GWGSFGI++FYYF+F+LNLR+YS +WAGG+YF+F I G
Sbjct: 308 PLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISG 367

Query: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441
            + ++  G  ++KI  +++L FSM+ F++G I+ SVTPV QTYFR  LGTMIIL  GMD+
Sbjct: 368 TITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDL 427

Query: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501
           SFPA++IILSD+LPNQ+QGMAGSL NT++NYS SL LG+  TVE   N+NG DLL+GYR 
Sbjct: 428 SFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRG 487

Query: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSE 538
           A Y GI  + +AV+++ +YM E ++   K+R E   E
Sbjct: 488 ALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/518 (52%), Positives = 360/518 (69%), Gaps = 3/518 (0%)

Query: 28  TVENTDSDKLGSGNET---STHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQA 84
           +++N DS    + + T   ST  A  D +  +Q+  YF+N++QE+ F+ + M+ QLL+QA
Sbjct: 31  SLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQA 90

Query: 85  CIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIF 144
            + QTLS+MN+L K   S +  Q WLM+SFPL  GSFIL+SGR+GDIYGLK  L+GG I 
Sbjct: 91  GLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYII 150

Query: 145 FIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLI 204
             +W++I G ++Y H+D FFI +R+FQGLG+AF LPN++G +G IY+P  FRKN++IS+I
Sbjct: 151 TTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISII 210

Query: 205 GACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFS 264
           GA +P GA +G  FAGL    +  +WPWSFYA  + S + L+ + Y IPN IPTN+HG  
Sbjct: 211 GAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLK 270

Query: 265 MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLL 324
           MDW+GS L V GLI+LNFV+NQ PI GW  AY                 YEV YA +PL+
Sbjct: 271 MDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLI 330

Query: 325 PRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVA 384
           P+ I+ NR M+MIL +LF GWGSFGI++FYYF+F LNLRHYS +WAG +YF+F I G   
Sbjct: 331 PKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTV 390

Query: 385 SVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFP 444
           ++V GL+I+KI  S++   SM+ F  G I+ + TPV QT+FR  LG M +L  GMD SFP
Sbjct: 391 AIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFP 450

Query: 445 AAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEY 504
           A++IILSDSLP QYQGMAGSL NT++NYS S+CLGM  TVE + N +GKDLL GYRAA Y
Sbjct: 451 ASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIY 510

Query: 505 LGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542
             IG+A LAV +S  YM E LW DR   +E   +T++ 
Sbjct: 511 FAIGLAGLAVCVSGGYMIECLWKDRVLSLEENKQTDIE 548

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/486 (53%), Positives = 340/486 (69%)

Query: 57  QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPL 116
           Q   YF ++  E+ F+ TC+M QLLNQA   Q++S+MNI+ + F S    Q WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 117 VSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVA 176
           VSGSFIL+ GR GDIYGLK  L+ G     IW++I G T+YTHSD FFIV+++FQGLGV+
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 177 FILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYA 236
           FILPN++G VG IY+P + +KNI IS IGA AP+GA  G  F+G++  K+  +WPW+FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 237 MAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAY 296
            AI S L  +   + +P+++PTN +   MDWIGS + VVGL+L +FVWNQ P+DGW KAY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 297 XXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYF 356
                            YE++YA  PLLP+ IT NRH++MIL+A+F+GWG+FGI+SFYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 357 AFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLS 416
           +F LNLRH+S VW GG YF F + G   +  VG  I+ I  SIIL  S+  F +G ++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 417 VTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSL 476
           VTP  QTY+R   G M++L  GMD+SFPA++IILSD LP +YQGMAGSL NTMVNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 477 CLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMEST 536
           CLG+ +TVE QIN +G DLLKGYRAA Y G+GI +L + ++ +YM E  W D KE+ +  
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 537 SETNLS 542
           ++   S
Sbjct: 546 NDIESS 551

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  521 bits (1341), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 249/498 (50%), Positives = 346/498 (69%), Gaps = 1/498 (0%)

Query: 41  NETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF 100
           N++  +        K     YF+NR  EY+F+ +CM+SQ ++QA + Q LS+MNIL +  
Sbjct: 71  NDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEEL 130

Query: 101 HSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHS 160
           ++    Q WLMASF L  GSFIL+SGR+GDIYGLK  L+GG     IW+LI GF++Y+H+
Sbjct: 131 NAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHN 190

Query: 161 DTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAG 220
           D FFI SR+FQGLG+AF+LPN +G +G IY+P + +KN++I  +GA +P+GA +G  FAG
Sbjct: 191 DAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAG 250

Query: 221 LIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILL 280
           +IGTK+P  WPWSFY+  I S   ++ + YSIPN+IPTN++  SMDWIG+ L + GL++L
Sbjct: 251 IIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLIL 310

Query: 281 NFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMA 340
           NFV+NQ PI GW  AY                 YEV YA +PL+P+ I+ NR M+MIL A
Sbjct: 311 NFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFA 370

Query: 341 LFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASII 400
           LF GWG+FG ++FYYF+F+LN+R Y+  WAGG+YF+F + G   + + G  ++K+  S+I
Sbjct: 371 LFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVI 430

Query: 401 LFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQG 460
           L+ SMI F  G +ML+VTP+ Q+YF+  LG M +L  G+D+SFPAA+IILSD+LP QYQG
Sbjct: 431 LYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQG 490

Query: 461 MAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIY 520
           MAGSL  T+ NYS S+CLGM  +VE+  N NG+++LKGYR A      +A L +I+S IY
Sbjct: 491 MAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIY 550

Query: 521 MCERLWIDRKERMESTSE 538
           M   L I  +E  +ST++
Sbjct: 551 MVINL-ITIRENSKSTNK 567

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  456 bits (1172), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/492 (45%), Positives = 315/492 (64%), Gaps = 2/492 (0%)

Query: 49  TTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQT 108
           T   N +  D   F+NR+QE+ FV   ++ Q L+Q  + Q LS MNIL +  H+    Q 
Sbjct: 105 TESQNLRRPDI--FKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQP 162

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WLMA+FPL  G  ILISGR+GDI+GLK  L+ G I   IW LI GF++Y HSD  FIVSR
Sbjct: 163 WLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSR 222

Query: 169 SFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPD 228
           +FQGLG+A  LPN+   +G IYKP+ F+KN++  +IGA +P+GA +G  FAGL    N  
Sbjct: 223 TFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIK 282

Query: 229 DWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGP 288
           +WPWSFY+ AI + L  + A + IPN I  N  G  MDWIGS L + GL++LNFV+NQ P
Sbjct: 283 NWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTP 342

Query: 289 IDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSF 348
           IDGW  AY                 YE+  A  PL+P+ I  N  +++IL+ LF GWG F
Sbjct: 343 IDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGF 402

Query: 349 GIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAF 408
            I++FYYFAF LNLRHYS +WA  + F+  I G + +++  L+++++   I+LFFSM+ F
Sbjct: 403 AIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGF 462

Query: 409 DVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANT 468
             G I+ +VTP+ QT+FR   G+M +   GM  SFP+A+++ +++LP  Y+ MAGSL N 
Sbjct: 463 LGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNV 522

Query: 469 MVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWID 528
            +NY+ S+C+GM  +     N +G+DLL G+RAA YL IG++  +V LS +YM   +W D
Sbjct: 523 AINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTD 582

Query: 529 RKERMESTSETN 540
           R ++M+     N
Sbjct: 583 RNQKMKENKLIN 594

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/506 (37%), Positives = 290/506 (57%), Gaps = 19/506 (3%)

Query: 42  ETSTHVATTDPNC-----KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNIL 96
           ETS     TD        + QD T     W E  FVG    +QL+ QA + Q+++ ++I+
Sbjct: 13  ETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIAPLHII 71

Query: 97  TKSFHSNAKNQ-TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
             SF +    Q +W  +S+ L  G+FILI+GR+GDI+G +   + G  ++ +W+L++GF+
Sbjct: 72  GDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

Query: 156 NYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMG 215
            Y++   FF   R+FQG+G AF+LPN +  +G  YKP   RKN+V SL GA AP G  +G
Sbjct: 132 VYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPGGFVLG 189

Query: 216 AFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN-HIPT-NVHGFSM----DWIG 269
           A F+ ++G      WPW+++ M IA  L  +   + IP+  +P+ +   F+M    D+ G
Sbjct: 190 AVFSSMLGQL--AWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAG 247

Query: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVIT 329
           S   V+GLIL NF WNQGP+ GW   Y                  E   AA PLLP    
Sbjct: 248 SVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLP-FAA 305

Query: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
            +     +L  +  GW SFGI+ FY + F+   R  S + +   +   AI G  A+V  G
Sbjct: 306 LSSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTG 365

Query: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449
             +    AS ++ F+M AF VGII+++  PV QTY+     ++I++ +GMDMSFPAA I+
Sbjct: 366 FLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIM 425

Query: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509
           LS+S+P+++QG+A SL NT+VNYS+S+ LG+  T+ESQ+N  G + LKGYR + Y+GIG+
Sbjct: 426 LSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGL 485

Query: 510 ASLAVILSLIYMCERLWIDRKERMES 535
           + L + ++ +Y        +K+  E 
Sbjct: 486 SGLGIFVAAVYASSTFLKSKKKASEK 511

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/491 (37%), Positives = 281/491 (57%), Gaps = 18/491 (3%)

Query: 57  QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQ-TWLMASFP 115
           QD T     W E  FVG    +QL+ QA + Q+L+ ++I+ KSF +    Q +W  +++ 
Sbjct: 33  QDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYS 91

Query: 116 LVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGV 175
           L  G+FILI+GR+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G 
Sbjct: 92  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGP 150

Query: 176 AFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
           AF+LPN +  +G  YK    RKN+V SL GACAP G  +GA F+ L+G      WPW+++
Sbjct: 151 AFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYW 207

Query: 236 AMAIASTLTLLGALYSIPNHIPTNVHGFS------MDWIGSGLAVVGLILLNFVWNQGPI 289
            M IA     +   + IP+    + H  S      +D+ GS   V+GLIL NF WNQGP+
Sbjct: 208 IMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPV 267

Query: 290 DGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFG 349
            GW   Y                  E   AA PLLP     +     +L  +  GW SFG
Sbjct: 268 VGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPLLP-FAALSSDTAFVLSCIAAGWASFG 325

Query: 350 IFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFD 409
           I+ FY + F+ + R  + + +   +   A+ G  A++  G  + +   S ++ F+M AF 
Sbjct: 326 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFT 385

Query: 410 VGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTM 469
            G I+++  PV QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+
Sbjct: 386 AGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 445

Query: 470 VNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDR 529
           VNYS+S+ LG+  T+ES +N  G   LKGYR + Y+GIG++ L + ++ IY     W   
Sbjct: 446 VNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYA----WSTF 501

Query: 530 KERMESTSETN 540
           K+  + TSE  
Sbjct: 502 KKSKKRTSEKQ 512

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/476 (38%), Positives = 276/476 (57%), Gaps = 15/476 (3%)

Query: 68  EYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF-HSNAKNQTWLMASFPLVSGSFILISG 126
           E  FVG    +QL+ QA + Q+L+ ++I+  SF  +N    +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 127 RVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCV 186
           R+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G AF+LPN +  +
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 187 GNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL 246
           G  YKP   RKN+V SL GA AP G  +GA F+ ++G      WPW+++ M IA  L  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAV 218

Query: 247 GALYSIPNHIP---TNVHGFSM----DWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXX 299
              Y IP H P    +V  F +    D+ GS   VVGLIL NF WNQGP+ GW   Y   
Sbjct: 219 AGYYLIP-HTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 277

Query: 300 XXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFL 359
                          E   AA PLLP     +     +L  +  GW SFGI+ FY + F+
Sbjct: 278 LLIVGTVFLIIFAFIESR-AAFPLLP-FAALSSDTAFVLSCIAAGWASFGIWIFYTWQFM 335

Query: 360 LNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTP 419
            + R  + + +   +   AI G  A+++ G  +     S ++FF+M AF VG I+++  P
Sbjct: 336 EDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAP 395

Query: 420 VKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLG 479
           V QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+VNYS+S+ LG
Sbjct: 396 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 455

Query: 480 MGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535
           +  T+ES +N  G ++LKGYR + YLGIG++   + ++  Y        +K   E 
Sbjct: 456 IAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/476 (38%), Positives = 274/476 (57%), Gaps = 15/476 (3%)

Query: 68  EYIFVGTCMMSQLLNQACIPQTLSLMNILTKSF-HSNAKNQTWLMASFPLVSGSFILISG 126
           E  FVG    +QL+ QA + Q+L+ ++I+  SF  +NA   +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 127 RVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCV 186
           R+GDI+G K   V G  ++ +W+L++GF+ Y++   FF   R+FQG+G AF+LPN +  +
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 187 GNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL 246
           G  YKP   RKN+V SL GA AP G F+GA F+ ++G      WPW+++ M IA  +  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAV 217

Query: 247 GALYSIPNHIPTNVHGFS-------MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXX 299
              + IP H P      S       +D+ GS   VVGLIL NF WNQGP+ GW   Y   
Sbjct: 218 AGYFVIP-HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 276

Query: 300 XXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFL 359
                          E   AA PLLP     +     +L  +  GW SFGI+ FY + F+
Sbjct: 277 LLIVGTFFLVIFAYIESR-AAFPLLP-FAALSSDTAFVLSCIAAGWASFGIWIFYTWQFM 334

Query: 360 LNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTP 419
            + R  + + +   +   AI G  A+V  G  +     S ++ F+M AF VG I+++  P
Sbjct: 335 EDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAP 394

Query: 420 VKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLG 479
           V QTY+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL NT+VNYS+S+ LG
Sbjct: 395 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 454

Query: 480 MGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535
           +  T+ES++N  G   LKGYR + Y+GIG++ L + ++  Y        +K   E 
Sbjct: 455 IAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEK 510

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  315 bits (806), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 280/474 (59%), Gaps = 14/474 (2%)

Query: 68  EYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQ-TWLMASFPLVSGSFILISG 126
           E  FVG    +QL+ QA + Q+++ ++I+  SF +    Q +W  A++ L  G+FILI+G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 127 RVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCV 186
           R+GD+YG K   + G  ++ +W+L++GF+ Y++   FF   R+FQG+G A +LPN +  +
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGIGPALLLPNAIAIL 163

Query: 187 GNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL 246
           G  Y P   RK +++SL GA AP G  +GA F+ + G      WPW+++AM I      +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAV 220

Query: 247 GALYSIPN----HIPTNVHGFS-MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXX 301
             +  IP      + T+V  +  +D  GS   V+GL+LLNF WNQGP+ GW   Y     
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 302 XXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLN 361
                        E   A  PLLP +   +     +L  +  GW SFGI+ +Y++ FL  
Sbjct: 281 IVSAVFLCVFAFIESR-APHPLLP-LSALSSDAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 362 LRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVK 421
           LR +S +     +   AI G+ A++  G  I ++ AS+++ F+M AF VG I+++  PVK
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 422 QTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMG 481
           Q Y+     ++I++ +GMDMSFPAA I+LSDS+P+++QG+A SL N +VNYS+S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 482 STVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMES 535
            TVE ++N  G +LLKGYR A Y+GIG++   ++++ +Y  E     + ++M S
Sbjct: 459 GTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMY--EYHTFKKSKKMPS 510

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  303 bits (775), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/484 (34%), Positives = 280/484 (57%), Gaps = 12/484 (2%)

Query: 63  QNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFH-SNAKNQTWLMASFPLVSGSF 121
           Q+  +E +FVG    +QL+ QA + Q+++ + I+  SF  SN    +W  A++ L  G+F
Sbjct: 34  QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTF 93

Query: 122 ILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPN 181
           ILI+GR+GD++G K   V G +++ +W+L++GF+ Y++   FF   R+ QG+G AF+LPN
Sbjct: 94  ILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPN 152

Query: 182 VMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIAS 241
            +  +G  Y P   RK +V S+ GA AP G  +G+ F+ +        WPW+++AM  A 
Sbjct: 153 SIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTAC 209

Query: 242 TLTLLGALYSIPNHIPTNVHGFS-----MDWIGSGLAVVGLILLNFVWNQGPIDGWGKAY 296
            +  +  +  IP   P  +   +     +D  G+   ++GL L+NF WNQGP+ GW   Y
Sbjct: 210 LVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPY 269

Query: 297 XXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYF 356
                             E   A  PLLP     +  +  +L  +  GW SFGI+ FY++
Sbjct: 270 TYALLIVGFVFLLVFSLIESR-ARFPLLP-FAALSTDLAYVLGCIAAGWSSFGIWIFYFW 327

Query: 357 AFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLS 416
            FL + R  S +     +   AI G+ A++  G  +  + A  ++  +MIAF VG ++++
Sbjct: 328 QFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVA 387

Query: 417 VTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSL 476
             P+ QTY+     ++II+ +GMDMSFPAA I++S+++P+++QG+A SL NT+VNYS+SL
Sbjct: 388 TAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISL 447

Query: 477 CLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMEST 536
            LG   T+E+++N  G + L+GYR A Y+GIG++ L V+++++Y    L   ++E++   
Sbjct: 448 ALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSEK 507

Query: 537 SETN 540
           S  N
Sbjct: 508 SSNN 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  290 bits (742), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 172/462 (37%), Positives = 260/462 (56%), Gaps = 20/462 (4%)

Query: 57  QDTTYFQN--RWQEYIFVGTCMM----SQLLNQACIPQTLSLMNILTKSFH-SNAKNQTW 109
           QD+   QN   W   +  G  +M    +QL+ QA + Q++  + I+  SF   N    +W
Sbjct: 12  QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSW 71

Query: 110 LMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRS 169
             ++F L  G+FILI+GR+GD +G K   V G +++ +W++++GF+ Y++   FF   R+
Sbjct: 72  FASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRA 130

Query: 170 FQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDD 229
           FQG+G AF LPN +  +   Y+P   ++N++ SL GACAP G  +GA F+ L+       
Sbjct: 131 FQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAW 187

Query: 230 WPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGF-----SMDWIGSGLAVVGLILLNFVW 284
           WPW+++ M I   L  +     IP+H P +          +D  GS   VVGLIL NF W
Sbjct: 188 WPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAW 247

Query: 285 NQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLP-RVITQNRHMVMILMALFL 343
           NQGP+ GW  +Y                  E   A  PLLP R ++ +   VM  +A   
Sbjct: 248 NQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA-- 304

Query: 344 GWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFF 403
           GW SFGI+ +Y +  + NLR    + +   +   AI G+ A++     + + S S ++  
Sbjct: 305 GWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMII 364

Query: 404 SMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAG 463
           +MIAF VG I+++  PV QTY+     ++I++ +GMDMSFPAA IILS ++P  +QG+A 
Sbjct: 365 AMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAA 424

Query: 464 SLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYL 505
           SL NT++NYS+S+ LG   T+ESQI+    DLLKGYR A Y+
Sbjct: 425 SLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  285 bits (729), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 280/487 (57%), Gaps = 19/487 (3%)

Query: 34  SDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLM 93
           +++  S N+ S+  A     C W  ++ F    +EY FV T +M+Q  NQA     L L+
Sbjct: 18  TERSISCNQESSKEAY--DRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLV 75

Query: 94  NILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG 153
           N+L+ SFH       +L+ S+P+V GSF+LI GR+G+++G K +L+GG I  I+ +L+ G
Sbjct: 76  NVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGG 130

Query: 154 FTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYK--PNTFRKNIVISLIGACAPVG 211
            + Y+ S  F+++ R+FQG+G+A ILPN        Y+      RK I+ ++IG  A  G
Sbjct: 131 LSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTG 190

Query: 212 AFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTN----VHGFSMDW 267
           AF+G F +G+  T++  +W W++Y   IA+TLTL  + YS+P++I       ++G  + W
Sbjct: 191 AFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNG--LGW 248

Query: 268 IGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRV 327
             +     GL++LN   N   +     ++                 +E+ ++  P+  + 
Sbjct: 249 FSN--RSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKE 306

Query: 328 ITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVV 387
           +  N  + ++L ++F GWG++GI+S Y+F FLLNLR+YS + AG TY    I G VA + 
Sbjct: 307 LFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIG 366

Query: 388 VGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAA 447
           + + +++    + L FS + F   II+LSVTP+ Q+YFR  LG+MI L+ G+D SFP++A
Sbjct: 367 ISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSA 426

Query: 448 IILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGI 507
           IIL + LP++Y  M   L N + NY++S   G+ ++    ++    +L+K YR   Y  I
Sbjct: 427 IILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYRYVYYFAI 484

Query: 508 GIASLAV 514
           G++++ +
Sbjct: 485 GLSAIGL 491

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  211 bits (538), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 145/508 (28%), Positives = 252/508 (49%), Gaps = 22/508 (4%)

Query: 24  SSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQ 83
            S  T  ++D D +   N+++      DP C  ++ T   +   E IFV     SQ+L  
Sbjct: 35  DSSKTRRDSD-DNVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGL 93

Query: 84  ACIPQTLSLMNILTKSFH-SNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGN 142
           A   Q +  M+++ + F  ++  +  W    +    GSF+LI+G++GD+ G K   + G 
Sbjct: 94  AGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGY 153

Query: 143 IFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVIS 202
            +  +W+L++GF+ Y  S  FF   R+ QG+G AF   + +  +G  Y P   RKN + S
Sbjct: 154 AWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCK-RKNFIFS 212

Query: 203 LIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIP-----NHIP 257
             GAC   G  +G  F+ L        W W++++MAIA  + ++ +++ IP      H  
Sbjct: 213 FFGACGSFGVVLGMVFSALF--TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHET 270

Query: 258 TNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVH 317
           +NV  F  D++G+ L V GL+L +  WNQ P  G+G+ Y                  E  
Sbjct: 271 SNV--FYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK 328

Query: 318 YAASPLLP-RVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFM 376
               PLLP   I+ N   + +L+A+F  + SF +++ Y F F L  +  + + A      
Sbjct: 329 -VDDPLLPWTHISANT--LKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTP 385

Query: 377 FAIWGVVASVVVGLSIR-KISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIIL 435
            A+ GV A++   L +   +   I +  S++AF V  I+++     QTY+     T I++
Sbjct: 386 MAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVI 445

Query: 436 SFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTV-----ESQINQ 490
           SFG+D+SFP+A ++LS+ +P++++G+  SL   ++NY+ +L     ++V        +  
Sbjct: 446 SFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAH 505

Query: 491 NGKDLLKGYRAAEYLGIGIASLAVILSL 518
            G    K      Y+GIG A L  ++++
Sbjct: 506 KGNAFTKTINIIGYVGIGTAGLGTLVAI 533

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  164 bits (415), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 125/472 (26%), Positives = 237/472 (50%), Gaps = 23/472 (4%)

Query: 86  IPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFF 145
           IPQ  S+ +  +     N +   W  A++   + +F++I+G++GDI G K   + G  + 
Sbjct: 70  IPQMASIASTFSLRPDQNLE-LGWCNAAYATTATTFVIIAGKLGDINGHKNMFIFGYAWL 128

Query: 146 IIWALISGFTNYTHSD-TFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLI 204
            +W+L++GF+ Y  ++  FF   R  QG+G AF+ P  +  +G  Y P   RKN V S  
Sbjct: 129 TLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCK-RKNYVFSFY 187

Query: 205 GACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIAS-TLTLLGALYSIPNHIPTNVHG- 262
           GAC P G   G+ F+ L        W W++++MA+    +T+L  ++   ++ P      
Sbjct: 188 GACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTCLIITILSYIFIPKDNTPKRERSA 245

Query: 263 -FSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAAS 321
            +S D++G    + G+IL + VWNQ P+  +   Y                  +      
Sbjct: 246 FYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMALIIDSR-VKD 304

Query: 322 PLLP-RVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIW 380
           PL+P + +  N  ++  L+ +F G+  F I+ FY + F L  ++ S + A   +    I 
Sbjct: 305 PLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAAAKFIPLGIS 362

Query: 381 GVVASVV-VGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGM 439
           G+ A+   V L  +K+   + L  ++ AF +  I++S   +++TY+       +I++ G+
Sbjct: 363 GIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFVATVIIAIGL 422

Query: 440 DMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTV-----ESQINQNGKD 494
           D++FP+A ++LS+ + N+ QG+A +LA T +NY  +L  G+ + +     +  + ++   
Sbjct: 423 DVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCDDCLARSDGR 482

Query: 495 LLKGYRAAEYLGIGIASLAVILSLI-----YMCERLWIDRKERMESTSETNL 541
            +     A Y+ IG A +AV++++      Y  ER+   R+++   +SE  +
Sbjct: 483 FVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDLREKKRPISSEQTV 534

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  153 bits (387), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 114/190 (60%), Gaps = 34/190 (17%)

Query: 76  MMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLK 135
           MMSQLLNQ    QTL L+N+L++ F S+   QT L+AS PLVSGSFIL+SG+VGDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 136 WSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTF 195
            +L+ G    I+W+ I G T Y  S  FF+++R+FQGLG+AF+LPNVMG V N+Y   + 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 196 RKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNH 255
           RKN+V                                  YA  +A +L +   ++++P +
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 256 IPTNVHGFSM 265
           IPTNV G +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 6/44 (13%)

Query: 453 SLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLL 496
           ++P   +G A      M+ YSM +CLG+  TVE ++++ G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 136/530 (25%), Positives = 237/530 (44%), Gaps = 55/530 (10%)

Query: 31  NTDSDKLGSGNETSTHVATTDPNC------KWQDTTYFQN------RWQEYIFVGTCMMS 78
           NTD     +   +S H   T   C      + QD     N      R +E +F+     S
Sbjct: 22  NTDHYLPSNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASS 81

Query: 79  QLLNQACIPQTLSLMNILTKSFHSNAKNQT---WLMASFPLVSGSFILISGRVGDIYGLK 135
           Q ++ A   Q +  M+ +T  F   A       W  A+F +  G+FI+ +G++ D+ G K
Sbjct: 82  QFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSK 141

Query: 136 WSLVGGNIFFIIWALISGFTNYTHS--DTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPN 193
              + G  ++ +W+L+ G + Y      TFF   R  QG+G A + P+ +  +G  Y P+
Sbjct: 142 TVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPS 201

Query: 194 TFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTL-TLLGALYSI 252
             +KNIV SL G C P+G  +G  F+ +        W W++++MAI S   TL+   Y  
Sbjct: 202 C-KKNIVFSLYGFCVPLGVVVGGVFSAIF--TQLAHWSWNYWSMAIVSAFFTLISCFYIP 258

Query: 253 PNHIPTN---------VHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYXXXXXXX 303
           P+ I  +          H    D++G+ L V  L+L    WNQ     +           
Sbjct: 259 PDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIV 318

Query: 304 XXXXXXXXXXYEVHYAASPLLP-RVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNL 362
                      E  Y   P++P R I  +   +  L+ +F  + SF I+ FY + +   +
Sbjct: 319 SLVCFVAMVIVE-FYVDDPIIPARKI--HPQTIKALLVVFFSYLSFTIWLFYLWKYFTVV 375

Query: 363 RHYSTVWAGGTYFMFAIWGVVA--------SVVVGLSIRKISASIILFFSMIAFDVGIIM 414
           R+ + +     +   +I G +A        S  V + IR ++ +     + I F    I 
Sbjct: 376 RNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILF----IT 431

Query: 415 LSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSM 474
           LS T   ++Y+     T+II+S G+D+SFP+A ++LS+ +P + +G++ +L  T +NY  
Sbjct: 432 LSRT---ESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGT 488

Query: 475 SLCLGMGSTV------ESQINQNGKDLLKGYRAAEYLGIGIASLAVILSL 518
            +   +  T+      +   + +    +K    A  +GIG + +AV++ L
Sbjct: 489 GIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVVGL 538

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  139 bits (351), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 110/398 (27%), Positives = 194/398 (48%), Gaps = 13/398 (3%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSD-TFFIVS 167
           W  AS+ L S   +LI+G++GD+ G K  +V G I+  IW+LI+GF+ Y   +  F+  +
Sbjct: 82  WANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTA 141

Query: 168 RSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNP 227
           R+ QG+G  FI+PN +  +G  Y     +K I+ S+ G     G  +G  F+ L      
Sbjct: 142 RALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT- 200

Query: 228 DDWPWSFYAMAIASTLTLLGALYSIPN----HIPTNVHGFS-MDWIGSGLAVVGLILLNF 282
             W W+++A+A    L  +GA+  IP     H P +   +   D++G+   V GL+L + 
Sbjct: 201 -KWAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDV 259

Query: 283 VWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALF 342
            + Q    GW   +                  +      PL+P +      +V+IL+ ++
Sbjct: 260 AFTQASALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVP-LQHLRADVVVILICVY 317

Query: 343 LGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIR-KISASIIL 401
            G+ SF I++ +++ F   + + S +         AI  + A++     ++  I A  ++
Sbjct: 318 FGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMM 377

Query: 402 FFSMIAFDV-GIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQG 460
             SM+ F V  I+M +VTP   TY+     + II  F +D++ P A ++ SDS+  + QG
Sbjct: 378 VISMVCFLVPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQG 436

Query: 461 MAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKG 498
           +A SL  T+++Y++S+     + V   +   G D   G
Sbjct: 437 IAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 120/550 (21%), Positives = 241/550 (43%), Gaps = 80/550 (14%)

Query: 41  NETSTHVATTDPNCKWQDTTYFQNRW-QEYIFVGTCMMSQLLNQACIPQTLSLMNILTKS 99
            +  +H  T     + Q      N +  + IF+     SQ +  A   Q +  M+ L+  
Sbjct: 43  QDQQSHKVTHSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVW 102

Query: 100 FH---SNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTN 156
           F    ++     W+ ASF +  G+FI+++G++ DI   +   + G ++F +W LI+GF +
Sbjct: 103 FKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFAS 162

Query: 157 YTHSDTFFI-VSRSFQGLGVAFILPNVMGCVGNIYK-PNTF------------------- 195
           Y   +  F+ + R  QG+G A + P+ +  +   Y  P                      
Sbjct: 163 YVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHD 222

Query: 196 --------------------------RKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDD 229
                                      K+I  SL GACAP+G  +G  F+ +        
Sbjct: 223 IEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLAT 280

Query: 230 WPWSFYAMAIASTL-TLLGALYSIPNHIPTNVHGF-----------SMDWIGSGLAVVGL 277
           WPW++++M+I +TL ++L   Y +   +P  V              + D++G  L +  L
Sbjct: 281 WPWNYWSMSIVTTLLSILSYFYVV---VPIPVEKLDSNPNSLKNWKNFDFLGVILGISAL 337

Query: 278 ILLNFVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQ-NRHMVM 336
           IL    W+Q  +  +   +                 +E +Y  +P++P  I Q +   + 
Sbjct: 338 ILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWE-YYFNNPIIP--IRQIHPGTIK 394

Query: 337 ILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVV-ASVVVGLSIRKI 395
            L+ +F  + SF  + FY +     ++  S +     +   ++ G++ A+  + L ++++
Sbjct: 395 ALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRV 454

Query: 396 SASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLP 455
              I L     +F +  I+L    +  +Y+     ++I +S G+D+SFP+A ++L++ +P
Sbjct: 455 PVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIP 514

Query: 456 NQYQGMAGSLANTMVNYSMSLCLGMGSTV-----ESQIN--QNGKDLLKGYRAAEYLGIG 508
            + QG+  +L  +++NY  ++   +  T+     ES ++   + K  LKG   A  +G+G
Sbjct: 515 PEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVG 574

Query: 509 IASLAVILSL 518
            + +AV++ +
Sbjct: 575 CSGIAVLIGI 584

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 111/513 (21%), Positives = 202/513 (39%), Gaps = 64/513 (12%)

Query: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114
           K Q + Y  N     IF+G      LLN A     +SL++ L K ++ +    +W + S+
Sbjct: 19  KCQKSPYQLNVNVGLIFLGCTF--DLLNVA---SMISLIDDLAKKYNISYTTASWSLTSY 73

Query: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFII----WALISGFTNYTHSDTFFIVSRSF 170
            +    FI   GR+GDI       VG ++ F I    +A++S       +   F V R+ 
Sbjct: 74  AVTFAGFIACMGRLGDI-------VGNSVLFTISCSCFAILSLLCAVMPNFPAFAVFRAI 126

Query: 171 QGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFM---GAFFAGLIGTKNP 227
           QG+  A ++P     +  +      +K   I   G  + +G  +   GAF A  IG +  
Sbjct: 127 QGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYRGI 186

Query: 228 DDWPWSFYAMAIASTLTLLGALYSI------PNHIPTNVHGFSMDWIGSGLAVVGLILLN 281
             +  +F  M++ S +      Y++      P  I       S+D+IGS + V G IL+ 
Sbjct: 187 --FYLTFAVMSLISVIAFFFT-YNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIV 243

Query: 282 FVWNQGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYA-------------------ASP 322
               +G  + W +                   +   YA                      
Sbjct: 244 VGLTEGG-ESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQL 302

Query: 323 LLPRVITQNRHMVMILMALFLGWGSFGIFSFYYF--AFLLNLRHYSTVWAGGTYFMFAIW 380
           L+P  +   ++ + I++A  L      +FS  Y    +       S + AG       I 
Sbjct: 303 LIPVDVLFMKNFIPIVLAFALNNAC--LFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIIC 360

Query: 381 GVVASVVVGLSIRKIS--ASIILFFSMIAFDVGIIMLSVTPVKQTYF-RMNLGTMIILSF 437
            VV + +      K+     + L FS+ A    II++ +  +K   F ++   +  ++ F
Sbjct: 361 MVVGNALCAFESTKLKPRVGVALGFSL-ALAGSIILIQLHLIKDNVFWKIFFSSQALVGF 419

Query: 438 GMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQ-NGKD-- 494
           G+ + +P A  I     P+Q +G+A  +A T     + +   + ++V   IN+  GK+  
Sbjct: 420 GVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDA 479

Query: 495 ---LLKGYRAAEYLGIGIASLAVILSLIYMCER 524
                 G++   Y  + + +L  +++ I  C R
Sbjct: 480 IQNFRTGFQNCSYFTVAVGALGFLVTAI--CIR 510

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 98/472 (20%), Positives = 188/472 (39%), Gaps = 49/472 (10%)

Query: 62  FQN-RWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGS 120
           FQN  +  YI +   M+S   +   +   LS    +  ++       +W + ++ +    
Sbjct: 16  FQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAG 75

Query: 121 FILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILP 180
           FI   GRVGDI G     V     F I +LI    N   +   F V R+ QG+  A I+P
Sbjct: 76  FIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIVP 132

Query: 181 NVMGCVGNIYKPNTFRKNIVISLIGACAPVG-AFM--GAFFAGLIGTKNPDDWPWSFYAM 237
           +    +  +   +  +    I   G     G  F+  GAF    IG K    +  +F  M
Sbjct: 133 SGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRIGYKGI--FYLTFAVM 190

Query: 238 AIASTLTLLGALYSIPNHIPTNV---------HGFSMDWIGSGLAVVGLILLNFVWNQGP 288
            + S ++   ++ +  N  P               S+D+IGS + +   IL+     +G 
Sbjct: 191 LVISIISYF-SIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG 249

Query: 289 IDGWGKAYXXXXXXXXXXXXXXXXXYEVHY---------AASP-----------LLPRVI 328
            + W K                   + + Y         A++P           L+P+ +
Sbjct: 250 -ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDV 308

Query: 329 TQNRHMVMILMALFLGWGSFGIFSFYYFA--FLLNLRHYSTVWAGGTYFMFAIWGVVASV 386
              ++ + I +A+F  +G   +FS  Y    +   +   S + A        +  ++ +V
Sbjct: 309 LMMKNFIPITVAVFANYGC--LFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNV 366

Query: 387 VVGLSIRKIS---ASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSF 443
           V+ +    IS   A ++ FF M    + +I L +      Y+++   +  +++FG  + F
Sbjct: 367 VIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLI-TDNLYWKIFFCSQSLIAFGAAIFF 425

Query: 444 PAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQ-NGKD 494
           P +  IL    P++Y+G+A  +  T   + + +   + +++   IN+ +GK 
Sbjct: 426 PYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKS 477

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 104/503 (20%), Positives = 197/503 (39%), Gaps = 54/503 (10%)

Query: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114
           + Q +TY  N     IF+G      LLN A +   +SL++ L + +  +    +W + S+
Sbjct: 19  RCQKSTYQLNVNVALIFLGCTF--DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSY 73

Query: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG-FTNYTHSDTFFIVSRSFQGL 173
            +    FI   GR+GDI G          FF I +L+     N+      F V R+ QG+
Sbjct: 74  AVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPA----FAVFRAIQGI 129

Query: 174 GVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFM---GAFFAGLIGTKNPDDW 230
             A ++P     +  +      +K   I   G  + +G  +   GAF A  IG K    +
Sbjct: 130 SAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGI--F 187

Query: 231 PWSFYAMAIASTLTL-----LGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWN 285
             +F  M + S +       +  L   P          S+D+IGS + V G IL+     
Sbjct: 188 YLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLT 247

Query: 286 QGPIDGWGKAYXXXXXXXXXXXXXXXXXYEVHYA-------------------ASPLLPR 326
           +G  + W +                   +   YA                      L+P 
Sbjct: 248 EGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFEKVQLLIPV 306

Query: 327 VITQNRHMVMILMALFLGWGSFGIFSFYYF--AFLLNLRHYSTVWAGGTYFMFAIWGVVA 384
            +   ++ + I++A  L      +FS  Y    +       S ++AG       I  V+ 
Sbjct: 307 DVLFMKNFIPIVLAFALNNAC--LFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIG 364

Query: 385 SVVVGLSIRKISAS--IILFFSMIAFDVGIIMLSVTPVKQTYF-RMNLGTMIILSFGMDM 441
           + +      K+     ++L FS+ A    II+  +  +K+  F ++   +  ++ FG+ +
Sbjct: 365 NGLCAFESTKLKPKVGVVLGFSL-ALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAI 423

Query: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQIN----QNG--KDL 495
            +P A  I     P++ +G+A  +A T     + +   + ++V   I+    ++G  +  
Sbjct: 424 FYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKF 483

Query: 496 LKGYRAAEYLGIGIASLAVILSL 518
             G++   Y  + + +L  +++L
Sbjct: 484 RTGFQNCTYFTVAVGALGFLVTL 506

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 99/505 (19%), Positives = 196/505 (38%), Gaps = 59/505 (11%)

Query: 63  QNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFI 122
           ++R+Q  + VG   +    +   +   +SL++ L K+++ +    +W + S+ +    FI
Sbjct: 22  KSRYQLNVNVGLIFLGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFI 81

Query: 123 LISGRVGDIYGLKWSLVGGNIFFII----WALISGFTNYTHSDTFFIVSRSFQGLGVAFI 178
              GR+GDI       +G ++ F I    +A++S       +   F V R+ QG+  A +
Sbjct: 82  ACMGRLGDI-------IGNSVLFTISCSCFAVLSLLCAVMPNFPAFAVFRAIQGICAAGL 134

Query: 179 LPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFM---GAFFAGLIGTKNPDDWPWSFY 235
           +P     +  +      +K   I   G  + +G  +   GAF    IG +    +  +F 
Sbjct: 135 VPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFATTKIGYRGI--FYLTFA 192

Query: 236 AMAIASTLTL-----LGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPID 290
            M + S +       +  L   P     +    S+D+IGS + V G IL+     +G  +
Sbjct: 193 VMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGG-E 251

Query: 291 GWGKAYXXXXXXXXXXXXXXXXXYEVHYA-------------------ASPLLPRVITQN 331
            W +                   +   Y                       L+P  +   
Sbjct: 252 SWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFM 311

Query: 332 RHMVMILMALFLGWGSFGIFSFYYF--AFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389
           ++ + I++A  L      +FS  Y    +       S + AG       I  V+ + +  
Sbjct: 312 KNFIPIVLAFALNNAC--LFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCA 369

Query: 390 LSIRKISASI---ILFFSMIAFDVGIIMLSVTPVKQTYF-RMNLGTMIILSFGMDMSFPA 445
               K+   +   I FF  +A    II++ +  VK+  F ++      ++ FG+ + +P 
Sbjct: 370 FESTKLRPRVGVAIGFF--LALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPY 427

Query: 446 AAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQ-NGK-----DLLKGY 499
           A  I     P++ +G+A  +A T     + +   + ++V   IN+  GK         G+
Sbjct: 428 ALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGF 487

Query: 500 RAAEYLGIGIASLAVILSLIYMCER 524
           +   Y  + + +L  +++ I  C R
Sbjct: 488 QNCSYFTVAVGALGFLVTAI--CIR 510

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 104/223 (46%), Gaps = 29/223 (13%)

Query: 81  LNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYG-----LK 135
           L+ A +   + L+  +   F+ +     W + S+ +    FI   GRVGDI G       
Sbjct: 34  LDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCV 93

Query: 136 WSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYK-PNT 194
           +S++ G IF ++ A++  F  +T       V R+FQG+  A I+P     V  +++ PN 
Sbjct: 94  FSVIFG-IFSLLCAVVPNFIAFT-------VFRAFQGMAGAGIVPCAYALVNKMFQGPNL 145

Query: 195 FRK-NIVISLIGACAPVGAFM-GAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSI 252
            R  +I+ S+I A A VG  + GAF    +G K+   + +  +A ++A T  ++  L   
Sbjct: 146 QRYFSILSSVISAMAGVGFIIGGAFGETALGYKS---FFYFLFAASLA-TAAVICVLIGY 201

Query: 253 PNHIPTNVHG--------FSMDWIGSGLAVVGLILLNFVWNQG 287
           P  +  N H         + +D IG  L + G ILL     QG
Sbjct: 202 PELL-LNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGLTQG 243

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L + + + F+  A N  WLMA + L +  F+L+ GR+  + GLK SL+   + F   +
Sbjct: 28  ITLYDTIGQEFNDYA-NVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           L++G  N   S    I +R   G G + I   V G   +I +     +  VI+++G    
Sbjct: 87  LMAGAAN---SMGMLIGARVISGFGGSGIESLVYGVGTSIVEEK--HRARVITVLGIAYM 141

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFY 235
           +    G F  G  G      W W FY
Sbjct: 142 LAEGAGPFVGG--GLAEHVSWRWCFY 165

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + FH + K Q W+  SF L + +F  + GR  DI G K +L+    FF++  L
Sbjct: 66  NIMNKIAEEFHESDKKQ-WMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL 124

Query: 151 ISGFTN 156
           ++ F  
Sbjct: 125 LTCFAR 130

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 91/212 (42%), Gaps = 24/212 (11%)

Query: 34  SDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVG----TCMMSQLLNQACIPQT 89
           +++ G+  E S HV    PN    ++ Y +N   E +  G    TC  S  L        
Sbjct: 39  NEESGTDAEVSNHV-EKKPNF---NSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALD 94

Query: 90  L----SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFF 145
           +    +++  + K F + +K   W+ A + L +    L+ GR+  I G K  ++   I F
Sbjct: 95  IMIVSTIIEDVAKKFGAYSKTG-WIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 146 IIWALISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGCVGNIYKPNTFRKNIVISL 203
            I +LISG  N   S    I  R   G+G + I  L  V+G   N+      R+ ++I+ 
Sbjct: 154 EIGSLISGVAN---SMNMLIGGRVIAGVGGSGIQSLAFVIG--SNLVDER--RRGLIIAC 206

Query: 204 IGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
           + +   V + +G F  G   T     W W FY
Sbjct: 207 MSSAFAVASVIGPFLGGAFTTH--ATWRWCFY 236

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 89/213 (41%), Gaps = 21/213 (9%)

Query: 29  VENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQ 88
           +E+  S +L +  E+ST     + N K          +  Y  +G+  ++  L+   I  
Sbjct: 4   LEDNSSKELCTQAESSTS-EVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILI 62

Query: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148
             +++  +++ F+  +K+  WL+  + L +    L+ GR   I G K S++   I F + 
Sbjct: 63  VSTIIETVSRDFNEYSKSG-WLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVG 121

Query: 149 ALISGFTNYTHSDTFFIVSRSFQGLG------VAFILPNVMGCVGNIYKPNTFRKNIVIS 202
           +L+S   N   S    I  R   G+G      + F++ + +         N   + + IS
Sbjct: 122 SLVSALAN---SMNMLIGGRVISGVGGSGLQTLCFLIISTL--------VNERSRGMAIS 170

Query: 203 LIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
           ++     V + +G F  G   T     W W FY
Sbjct: 171 VLSCSFAVASIVGPFLGGAFTTH--VTWRWCFY 201

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 49/84 (58%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W+  S+ L + +F  + G++ D+ G K++++  + FF +  L
Sbjct: 59  NIMNRVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCL 117

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
           ++ F N   S T F ++R+  G+G
Sbjct: 118 LTCFAN---SVTQFAIARAICGVG 138

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 93  MNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALIS 152
           + ++ + F   +K+  W+++ + L      L+ GR   I G K SL+   + F   +LIS
Sbjct: 142 IEVIAEQFKDYSKSG-WIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 153 GFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGA 212
             +N   S    I  R   G+G + I  ++   + +   P+  R  I+IS++     V A
Sbjct: 201 AISN---SMNMLIGGRVVAGIGGSGI-QSLCFVIASTLTPDRSRV-IIISVLSCSYAVAA 255

Query: 213 FMGAFFAGLIGTKNPDDWPWSFY 235
            +G F  G + T     W W FY
Sbjct: 256 VVGPFLGGALTTHV--TWRWCFY 276

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  +++ Q W+  SF L + +F  + G++ DI G K +L+  + FF I  L
Sbjct: 58  NIMNRVAEEFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCL 116

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
           ++ F     + T F ++R+  G+G
Sbjct: 117 LTCF---ARNVTEFSIARAICGIG 137

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W++ SF L + +F  + G++ D+ G K +L+  + FF++  L
Sbjct: 62  NIMNKVAEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCL 120

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPN 193
              FT  + +   F ++R+  G+G   I       V +I  P 
Sbjct: 121 ---FTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPK 160

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W+  SF L + +F  + G++ DI G K++++  + FF +  L
Sbjct: 65  NIMNRVAEEFAESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCL 123

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPV 210
           ++ F     + T F ++R+  G+G   I  N M  +       T  + I          +
Sbjct: 124 LTCF---AQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGM 178

Query: 211 GAFMGAFFAGL 221
           G  +GA   GL
Sbjct: 179 GQVLGAPLGGL 189

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  ++K Q W+  SF L + +F  + G++ DI G K +L+    FF +  L
Sbjct: 58  NIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCL 116

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
           ++ F     + T F ++R+  G+G
Sbjct: 117 LTCF---ARNVTEFSIARAICGIG 137

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 98/247 (39%), Gaps = 40/247 (16%)

Query: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114
           K Q++ Y        IF G      LLN A +   +S++  L +++       +W + S+
Sbjct: 18  KCQNSRYQLGINITLIFFGCTF--DLLNVAGV---ISVIEDLGETYKLGYTGASWALTSY 72

Query: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFII----WALISGFTNYTHSDTFFIVSRSF 170
            +    FI   GR+GDI       VG ++ F I    + L S           F V R+ 
Sbjct: 73  AITFAGFIAFMGRLGDI-------VGNSVLFTISCFLFTLFSLLCAVVRDFPTFAVFRAL 125

Query: 171 QGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFM---GAF---------- 217
           QG+  A I+P     +  + +P   +K   I   G  + +G  +   GAF          
Sbjct: 126 QGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGI 185

Query: 218 ----FAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLA 273
               FAG++          SFY   I     L   +  IP+  P      S+D++GS + 
Sbjct: 186 FYLSFAGMLVV----SIAASFYTYRIEERKFLEVKVEDIPHDHPKVA---SLDFVGSLIF 238

Query: 274 VVGLILL 280
           V G +L+
Sbjct: 239 VSGSVLI 245

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W+  SF L + +F  + G++ DI G K++L+  + FF +  L
Sbjct: 73  NIMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCL 131

Query: 151 ISGF 154
           ++ F
Sbjct: 132 LTCF 135

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 12/119 (10%)

Query: 144 FFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNT--FRKNIVI 201
           + I W L+   T+   S   FI++R+  G+  + I P ++  +   YK +   FR +I+I
Sbjct: 177 YIIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQFFRTSILI 236

Query: 202 SLIGACAPVGAFMGA------FFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN 254
               AC  VG  +GA      +   L GT + D W   F  + + + +T L  L+ IP+
Sbjct: 237 ----ACNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPD 291

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  ++K Q W+  SF L + +F  + G++ DI G + +L+    FF +  L
Sbjct: 58  NIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCL 116

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
           ++ F     + T F ++R+  G+G
Sbjct: 117 MTCF---ARNVTEFSIARAVCGIG 137

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W+  SF L + +F  + G++ DI G K++++  + FF    L
Sbjct: 62  NIMNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFF---GL 117

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
               T +  + T F ++R+  G+G
Sbjct: 118 GCFLTCFAQNITQFSIARAICGIG 141

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 94/242 (38%), Gaps = 12/242 (4%)

Query: 28  TVENTDSDKLGSGN-ETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACI 86
           T+  T + ++   + E++  V T   + ++       +  Q++I VG   M    +    
Sbjct: 60  TLSRTQTREVEESDLESADDVKTIKDSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGS 119

Query: 87  PQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFI 146
           P     +  L K F  +       +  + L  G    + G + DIYG +  ++ G + +I
Sbjct: 120 PIYYPALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYI 179

Query: 147 IWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGA 206
           + ++     N   S    I  R  Q  G++ I+    GCVG+ +     R   V ++ G 
Sbjct: 180 VASIALACAN---SYGVIIFLRCLQSCGISPIIAISSGCVGD-FTMKAERGTFVGAVSGL 235

Query: 207 CAPVGAFMGAFFAGLIGTKNPDDWPWS--FYAMAIASTLTLLGALYSIPNHIPTNVHGFS 264
                  +G  F  LIG      W W   F+ +AI +   L   +  +P    T V   S
Sbjct: 236 -----VLLGQAFGSLIGAALAAAWDWRAIFWFLAIGAGCCLFVGILVLPETKRTIVGNMS 290

Query: 265 MD 266
           + 
Sbjct: 291 IK 292

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  +++ Q W+  SF L + +F  + G++ DI G K +L+    FF +  L
Sbjct: 58  NIMNRVAEDFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGLGCL 116

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLG 174
           ++ F     + T F ++R+  G+G
Sbjct: 117 LTCF---ARNVTEFSIARAICGIG 137

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN + + F  + K Q W+  SF L + +F  + G++ DI G +++L+  + FF +  L
Sbjct: 55  NIMNRVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCL 113

Query: 151 ISGFTN 156
           ++ F  
Sbjct: 114 LTCFAQ 119

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           W+ A + L S    LI GR+  + G K S++   I F + +L++   N   S    I  R
Sbjct: 94  WIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALAN---SMDMLIGGR 150

Query: 169 SFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPD 228
              GLG + I       +  + + +  ++ ++I+ +G+   + + +G F  G   T    
Sbjct: 151 VIAGLGGSGIQTLCFVIISTLVEES--KRGLLIACMGSAFGIASVVGPFLGGAFTTHVT- 207

Query: 229 DWPWSFY 235
            W W F+
Sbjct: 208 -WRWCFW 213

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++++ + KSF    K+  W++  + L +  F L+ GR+    G + S+V   + F   +L
Sbjct: 65  TIIDTVCKSFGDYTKSG-WIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSL 123

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGC--VGNIYKPNTFRKNIVISLIGA 206
           IS       S    I  R   G+G + +  L  V+GC  V    +P      +V+SL+  
Sbjct: 124 ISAL---ARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRP------LVLSLLNC 174

Query: 207 CAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
              + + +G F  G   T     W W FY
Sbjct: 175 TFAIASIIGPFIGGAFTTH--VTWRWCFY 201

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 90/420 (21%), Positives = 157/420 (37%), Gaps = 70/420 (16%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++++++ + F + +K   WL+  + L +    LI GR   I G + SL+   + F   +L
Sbjct: 59  TIIDVVAEQFGNYSKTG-WLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGC--VGNIYKPNTFRKNIVISLIGA 206
           I+   +   S    I  R   G+G + +  L  V+GC  VG   +P      +VIS++  
Sbjct: 118 IAALAS---SMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRP------LVISILSC 168

Query: 207 CAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLL-----------GALYSIPNH 255
              V A +G    G   T     W W FY       L ++           G L  I + 
Sbjct: 169 AFAVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDA 226

Query: 256 IPT-------------------NVHGFSMDWIGSGLAVVGLILL---------NFVWNQG 287
           I T                   N   F  D+ G  L   GL+L           + WN G
Sbjct: 227 IGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSG 286

Query: 288 PIDGW---GKAYXXXXXXXXXXXXXXXXXYEVHYAASPLLPRVITQNRHMVMILMALFL- 343
            +  +   G                       + +  PLL R +     ++++ M  FL 
Sbjct: 287 QVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLL 346

Query: 344 --GWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFM-FAIWGVVASVVVGLSIRKIS-ASI 399
             G+    I+S  +F     L   S+ W  G + +   I  V+A++  G+  +K+     
Sbjct: 347 CTGYNGQMIYSVQFF----QLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKP 402

Query: 400 ILFFSMIAFDVG---IIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPN 456
           +L F  +   +G   + +++ T  K T   + L     L F +  S  +A + ++   P 
Sbjct: 403 LLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPE 462

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 12/147 (8%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++++ +  SF    K+  W++  + L +  F L+ GR+  + G + S++   I F   +L
Sbjct: 66  TIIDTVCTSFGDYTKSG-WIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 151 ISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGCVGNIYKPNTFRKNIVISLIGACA 208
           IS       S    I  R   G+G + +  L  V+GC       N   + +V+SL+    
Sbjct: 125 ISALAK---SMNMLISGRVIAGVGGSGLQTLSLVIGC----QLVNEKSRPLVLSLLNCTF 177

Query: 209 PVGAFMGAFFAGLIGTKNPDDWPWSFY 235
            V + +G F  G   T     W W FY
Sbjct: 178 AVASIVGPFLGGAFTTHV--TWRWCFY 202

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 12/148 (8%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L + +   FH +  N  WL+  + L +  F+L+ GR+ +I G K  L+   I F I +
Sbjct: 29  VTLYDTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGS 87

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGCVGNIYKPNTFRKNIVISLIGAC 207
           LIS  +N   S    I  R   G G + I  L  V+G   +I + N   + I+I+ +   
Sbjct: 88  LISALSN---SMATLISGRVVAGFGGSGIESLAFVVGT--SIVREN--HRGIMITALAIS 140

Query: 208 APVGAFMGAFFAGLIGTKNPDDWPWSFY 235
             +   +G F  G         W W FY
Sbjct: 141 YVIAEGVGPFIGG--AFNEHLSWRWCFY 166

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVS 167
           +W+  S+ L S +F  + G+V DI+G K  LV  N+ F+I  L+ G +    S  + +++
Sbjct: 149 SWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSK---SFWWLVIA 205

Query: 168 RSFQGLG 174
           R   G+G
Sbjct: 206 RFVAGVG 212

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 78/175 (44%), Gaps = 17/175 (9%)

Query: 96  LTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
           L K F+ +       +  + L  G    +SG + D++G +  ++GG + +++ A I    
Sbjct: 128 LEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVV-ASIGLAC 186

Query: 156 NYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNI---YKPNTFRKNIVISLIGACAPVGA 212
             ++    F+  R  Q +G++  +    G VG+    ++  TF        +GA + +  
Sbjct: 187 APSYGVICFL--RCIQSIGISPTIAISSGVVGDFTLKHERGTF--------VGATSGL-V 235

Query: 213 FMGAFFAGLIGTKNPDDWPWS--FYAMAIASTLTLLGALYSIPNHIPTNVHGFSM 265
            +G  F  LIG      W W   F+ +AI S + L+ A +++P    T V   S+
Sbjct: 236 LLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 8/146 (5%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++++N +   F++ +K   WL+  + L +  F L+ GR   I+G K +L+   I F I +
Sbjct: 41  VTILNTIADKFNAYSK-IGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           L+   +N   S    I  R   G G + I   V     ++   +T  +  +++L+     
Sbjct: 100 LVIAVSN---SMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYA 154

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFY 235
           V + +G +  G +       W W FY
Sbjct: 155 VASALGPYIGGAL--TEYVTWRWCFY 178

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 67/167 (40%), Gaps = 6/167 (3%)

Query: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148
           TL++  I +  F    K  TW +    ++     ++ G +GD YG K S +    F ++ 
Sbjct: 95  TLNVKKI-SHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVL 153

Query: 149 ALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACA 208
            +I+GF    H+  +F+++R+F G+ +  I  N      +   P     + +        
Sbjct: 154 EIITGFIK--HNFKYFLIARAFFGVVLGGIFGNSAAQCFDDCPPEA--HSFISGFFQQGY 209

Query: 209 PVGAFMGAFFAGLIGTKNPDDWPWSF-YAMAIASTLTLLGALYSIPN 254
            +G  +   F   +     D W   F +A  I   L +  AL    N
Sbjct: 210 TLGYLLAVIFTRALADTTKDRWRSCFWFAAGITFLLIIFRALLPETN 256

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTN 156
           +W+  ++ L S +F  + G++ DI+G +  ++  N+FFI+  LI G + 
Sbjct: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 81/202 (40%), Gaps = 8/202 (3%)

Query: 34  SDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLM 93
           +D  G  +  ST     +P         F    + +  +G+ ++   L    +    +++
Sbjct: 8   ADTRGDASSVSTGSVKEEPVRTNAFGQRFPTGVELWAPLGSLVLCLFLAALDVMTVSTII 67

Query: 94  NILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG 153
             +++ F   +K   WL   + L +   +LI GR+  + G K S +   + F + +L+S 
Sbjct: 68  EEVSQKFGDYSK-VGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSA 126

Query: 154 FTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAF 213
             N   S    I  R   G+G + +   V      + +     + ++I+++ +   + + 
Sbjct: 127 LAN---SMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERN--RGLIIAVMSSSFGIASV 181

Query: 214 MGAFFAGLIGTKNPDDWPWSFY 235
           +G F  G   T     W W FY
Sbjct: 182 VGPFLGGAFTTHV--TWRWCFY 201

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
           +W+  ++ L S +F  I G++ DI+G K  L+  NI F + +LI G +
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 91  SLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWAL 150
           ++MN +   F  + K Q W+  S+ L + +F  + G++ DI G K +++  + FF +  L
Sbjct: 64  NIMNSIAAEFAESDKKQ-WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCL 122

Query: 151 ISGFTN 156
           ++ F  
Sbjct: 123 LTCFAQ 128

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 87/215 (40%), Gaps = 22/215 (10%)

Query: 21  DEVSSGWTVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQL 80
           D  S G  VE    D+  + +E+S HV    P           + ++ Y  +G+  +   
Sbjct: 7   DIESMGVIVE----DRSSAQDESSGHVGDPQP----------LSGFKLYANMGSLTLVLF 52

Query: 81  LNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVG 140
           L    I    + + ++++ F+  +K+  W+++ + L      L+ GR   I+G K SL+ 
Sbjct: 53  LAALDILIMSASIEVISEQFNDYSKSG-WIVSGYSLPEALLTLLWGRFATIFGFKLSLLL 111

Query: 141 GNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIV 200
             + F   +LIS  +N   S    I  R   G+G + I          +    +  + + 
Sbjct: 112 SILIFETGSLISAVSN---SMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERS--RGVA 166

Query: 201 ISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
           IS++     V A  G F  G   T     W W FY
Sbjct: 167 ISVLSCAYAVAAVAGPFMGGAFTTHVT--WRWCFY 199

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 92/242 (38%), Gaps = 53/242 (21%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L + +   FH +  N  WL+  + L +  F+L+ GR+ +I G    L+   I F + +
Sbjct: 29  VTLYDTIGIKFH-DFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGS 87

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGA--- 206
           LIS  +N   S    I  R   G G + I  ++   VG        R  ++ +L  +   
Sbjct: 88  LISALSN---SMGTLISGRLIAGFGGSGI-ESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 207 CAPVGAFMGAFFAGLIGTKNPDDWPWSFY-----------AMAIAST-------LTLLGA 248
              VG F+G  F           W W FY            +A  +T       ++LL  
Sbjct: 144 AEGVGPFIGGAF------NEHLSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSK 197

Query: 249 LYSIPNHIPTNVHG------------FSMDWIGSGLAVVGLILL---------NFVWNQG 287
           + SI ++    V              F +D IG  L+  G  LL         NF WN  
Sbjct: 198 IKSIMSYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSS 257

Query: 288 PI 289
            I
Sbjct: 258 TI 259

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 8/122 (6%)

Query: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114
           K Q +T   N     IF+G  +   L+N   +   +SL++ L+  +  +    +W + S+
Sbjct: 19  KCQTSTVNLNVNVALIFLGCSI--DLIN---VSSMISLIDELSTKYSISYTTASWSLTSY 73

Query: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLG 174
            +    FI   GR+GDI G           F I +L+ G      +   F V R+ QG+ 
Sbjct: 74  AVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMPNFEA---FAVMRALQGIA 130

Query: 175 VA 176
            A
Sbjct: 131 AA 132

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTN 156
           +W+  ++ L S +F  + G++ DI+G +  LV  N+ F + ALI G + 
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 123 LISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFI 178
           L+ GR+G+ +G + ++  G++ F+I  L  GF +        I+ R+  GLGV  +
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFADKM---MHLIIGRTISGLGVGLL 215

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
           +W+  ++ L S +F  + G++ DI+G K  L+  N+ F +  LI G +
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 8/146 (5%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L   + + F   A+   WL+  + L +  F L+ GR+  I GLK SL    + F I +
Sbjct: 28  ITLYETIGEKFKDYAR-IGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGS 86

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LI   +N   S    I  R   G G + I   V     ++ +     + +VI+++G    
Sbjct: 87  LIVAVSN---SMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEER--NRGMVITVLGLAFA 141

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFY 235
           V   +G    G   T+N   W W FY
Sbjct: 142 VAFAVGPVIGGAF-TENV-SWRWCFY 165

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 126 GRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFI 178
           G++GDIYG +W L+   I F+I  LI   T+      +FI  R   G+G+  I
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIE-ITSVDKWYQYFI-GRIIAGIGMGLI 184

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
           +W+  ++ L S +F  + G++ DI+G K  L+  NI F++  L+ G T
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 10/127 (7%)

Query: 55  KWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASF 114
           + Q++ Y        IF+G      LLN A +   +S++  L +++       +W + S+
Sbjct: 22  RCQNSKYQLIINMALIFLGCTF--DLLNVAGV---ISVIEDLGETYGLEYTTASWALTSY 76

Query: 115 PLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG-FTNYTHSDTFFIVSRSFQGL 173
            +     I   GR+GDI G          FF ++ L+    TN+      F V R+ QG+
Sbjct: 77  AITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA----FAVLRALQGI 132

Query: 174 GVAFILP 180
             A ++P
Sbjct: 133 AAAGLVP 139

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 168 RSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNP 227
           R FQ +G + ++P  +G V ++  P    K +   ++G    +G  +G  F GLI   N 
Sbjct: 208 RVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLG--PNMGPILGPIFGGLI-LMNG 264

Query: 228 DDWPWSFYAMAIASTLTLLGALYSIPN 254
           + W W F   +I + + L+  +  +P 
Sbjct: 265 NQWRWLFGFTSITTGVGLILIVTFLPE 291

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 83/194 (42%), Gaps = 17/194 (8%)

Query: 64  NRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFIL 123
            +W     +  C +S   N +  P  LSL   ++K FH +++        F +  G    
Sbjct: 78  KKWSIVTVIFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQMIFKVAYGFGCE 134

Query: 124 ISGRVGDIYGLKWSLVGGNIFFI-IWALISGFTNYTHSDTF--FIVSRSFQGLGVAFILP 180
           +     + YG + +++  ++FF  IW ++ G      +  F   IV+R   G+  A    
Sbjct: 135 LWAPWSEEYGRR-NIMQLSLFFTNIWQILGG-----KAPNFGTIIVARFLGGISQAG-GS 187

Query: 181 NVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIA 240
             +G V ++++P        ++ +   + +GA +G  F GL+  +    W W+F+   I 
Sbjct: 188 VTLGVVADMWQPQD--HGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIF 243

Query: 241 STLTLLGALYSIPN 254
             +T L   + +P 
Sbjct: 244 GGVTQLLHFFLVPE 257

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 80/195 (41%), Gaps = 19/195 (9%)

Query: 64  NRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAK----NQTWLMASFPLVSG 119
            +W     +G C +S   N +  P  +SL   +++ FH + +    +Q   + ++     
Sbjct: 114 RKWSVIAVIGVCQLSMNFNTSVYPHAISL---ISEDFHISKQAANTSQMIFLVAYAFGCE 170

Query: 120 SFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFIL 179
            +   S   G    ++ SL   N++ I+  L   F +        IV+R   G+ +A   
Sbjct: 171 LWAPWSEEYGRWIVMQCSLFSSNVWQILGGLAPNFGS-------IIVARFLGGISLAG-G 222

Query: 180 PNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAI 239
              +G   +++ P        ++ +  C+  G  +G  F GL+  +    W W+F+   I
Sbjct: 223 SVTLGVAADMWDPAD--HGYAVAFVVLCSVGGTVIGPIFGGLM--EEHLSWHWNFWIQLI 278

Query: 240 ASTLTLLGALYSIPN 254
            + +T +   + +P 
Sbjct: 279 FNGVTQVLHFFIVPE 293

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTN 156
           W+  S+ L S  F  + G++ DI+G K  L+  N+ F    +I G +N
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSN 483

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 62/149 (41%), Gaps = 14/149 (9%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L + + K F+  A N  WLM  + L +   +L+ GR+  + GLK SLV   + F   +
Sbjct: 28  ITLYDTIGKVFNDYA-NVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGS 86

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGA--- 206
           L++       S    I  R   G G + I   ++  VG        R  +V  L  A   
Sbjct: 87  LLAALAT---SMGMLIGGRVIAGFGGSGI-ETLVFAVGTRMVDEKHRARVVTILGIAYML 142

Query: 207 CAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
               G F+G  FA  +       W W F+
Sbjct: 143 AEGAGPFIGGAFAEHV------SWRWCFF 165

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 11/129 (8%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WL   + L +    LI GR+    G K +++   + F + +LIS   N   S    I  R
Sbjct: 115 WLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISALAN---SMNVLIGGR 171

Query: 169 SFQGLGVAFI--LPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKN 226
              G+G   I  L  V+G   N+ + +   + ++I+++     + + +G F  G+  ++ 
Sbjct: 172 VIAGVGGCGIQSLSFVIG--SNLVEES--NRGVLIAILSCSFAIASVVGPFLGGVFTSR- 226

Query: 227 PDDWPWSFY 235
              W W FY
Sbjct: 227 -VTWRWCFY 234

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 67/175 (38%), Gaps = 5/175 (2%)

Query: 96  LTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFT 155
           L K+FH+N       +++F  V     +  G   D+ G KW  +   I   +  L+    
Sbjct: 137 LQKAFHTNTTVINATVSAFMGVFAVGPIFWGVYADVCGRKWLYLCSLILVTVINLLLAVL 196

Query: 156 NYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMG 215
               +  F  V R FQ  G + ++    G V +I       K I   ++G    +G  +G
Sbjct: 197 PANLASLF--VLRVFQAFGSSSVITLGSGTVTDITPMKHRGKAIAYFMLGP--NMGPILG 252

Query: 216 AFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGS 270
              AGLI   N D W W F    I S +  L  L  +P  +   V      W  S
Sbjct: 253 PIIAGLI-LINGDYWRWLFGFTCIMSAIGFLLVLIFLPETLRCIVGNGDPRWRNS 306

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 8/146 (5%)

Query: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149
           ++L + +   FH +  N  WL+  + L +  F+L+ GR+ +I G    L+   + F I +
Sbjct: 29  VTLYDTIGIKFH-DFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGS 87

Query: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209
           LIS  +N   +    I  R   G G + I  ++   VG       +R  I+I+ +     
Sbjct: 88  LISALSNTMGT---LIGGRVIAGFGGSGI-ESLAFVVGTSIVQENYR-GIMITALAVSYV 142

Query: 210 VGAFMGAFFAGLIGTKNPDDWPWSFY 235
           +   +G F  G         W W FY
Sbjct: 143 IAEGVGPFIGG--AFNEHLSWRWCFY 166

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WL   + L +    LI GR+    G K +++   + F I +LIS   N   S +  I  R
Sbjct: 106 WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALAN---SMSMLIGGR 162

Query: 169 SFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPD 228
              G+G   I  ++   +G+     + ++ I+I+++     + + +G F  G+    +  
Sbjct: 163 VIAGVGGCGI-QSLSFVIGSTLVEES-QRGILIAVLSCSFAIASVVGPFLGGVF--TSSV 218

Query: 229 DWPWSFY 235
            W W FY
Sbjct: 219 TWRWCFY 225

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 230 WPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGS--GLAVVGLILLNFV--WN 285
           W W+ + +   + +T+  +L  I N +P NV+G S  W  S   L + GLI+L+F+  W 
Sbjct: 212 WAWAEH-VPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWG 270

Query: 286 QGP 288
            GP
Sbjct: 271 GGP 273

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 108 TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG 153
           +W+  ++ L S +F  + G++ DI+G K  L   N+ F I  LI G
Sbjct: 133 SWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICG 178

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WL   + L +   +LI GR+    G K +++   + F I +LIS   +   S    I  R
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALAS---SMNMLIGGR 156

Query: 169 SFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPD 228
              G+G   I  ++   +G+     + ++ ++I+++ +   + + +G F  G+  +    
Sbjct: 157 VIAGIGGCGI-QSLSFVIGSTLVEES-KRGMLIAILSSSFAIASVVGPFLGGVFTSS--V 212

Query: 229 DWPWSFY 235
            W W FY
Sbjct: 213 TWRWCFY 219

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 33/201 (16%)

Query: 314 YEVHYAASPLLPRVITQNRHMVMILMALFL----GWGSFGIFSFYYFAFLLNLRHYSTVW 369
           +EV +A  PLLP+ +  NR  +  ++  F+    G+ S   F+ Y F  +LNL + + V+
Sbjct: 353 FEVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFV-VLNLSYKNWVY 411

Query: 370 AGGTY-----FMFAIWGVVASV--------VVGLSIRKISASIILFFSMIAFDVGIIMLS 416
              T      F   +WGV+           VVG++I+ I   + +  S      GI ++ 
Sbjct: 412 LSNTTTMGLCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLI- 470

Query: 417 VTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSL 476
                       +  +I+ +FG   +     +    ++P  +Q MA +++   +  S+  
Sbjct: 471 ------------VAALIVTNFGDAANVMGTQVAAQAAVP--HQDMAATISVLSLYSSIGA 516

Query: 477 CLGMGSTVESQINQNGKDLLK 497
            +G   T     N+    LLK
Sbjct: 517 AVGTAITSAVWTNELPGALLK 537

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 20/150 (13%)

Query: 103 NAKNQ-TWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSD 161
           +A NQ +W+  S+ L   +F  + G++ D++G K  L+  N+ F    ++ G   +T S 
Sbjct: 64  DASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSL 122

Query: 162 TFFIVSRSFQGLGVAFILPNVMGCVGN-----IYKPNTFR--KNIVISLIGACAPVGAFM 214
               + R   G+G   +  N +  +       + +   ++   NIV +L   CA  G+ +
Sbjct: 123 WMLCIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGVYQGMGNIVFAL--GCAS-GSLI 177

Query: 215 GAFFAGLIGTKNPDDWPWSFYAMAIASTLT 244
           GAF    IG      W W+F      S L+
Sbjct: 178 GAFLQQRIG------WRWAFLCQVPLSLLS 201

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 92  LMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALI 151
           +MN + + F+++ + Q W+  S+ L + +F  + GR+ DI G K++ +    FF + + +
Sbjct: 89  IMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 152 SGFTN 156
           + F+ 
Sbjct: 148 TTFSK 152

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 50/127 (39%), Gaps = 7/127 (5%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WL+  + L +    L+ GR G + G K S++   + F + +LI+       S T  I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGR 170

Query: 169 SFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPD 228
              G+G + I          +    T  +   IS++     V +  G F  G   T    
Sbjct: 171 VISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAVASVAGPFLGGAFATH--V 226

Query: 229 DWPWSFY 235
            W W FY
Sbjct: 227 TWRWCFY 233

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 78/167 (46%), Gaps = 16/167 (9%)

Query: 75  CMMSQLLNQACIPQTLSLMN----ILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGD 130
           C+ + +L Q  +   + ++N    +++K+    AK+  WL+  + L +    LI GR   
Sbjct: 77  CLFALVLAQLIVALDVFIVNTVIDVVSKNLGGYAKSG-WLITGYSLPNSLLSLIWGRATS 135

Query: 131 IYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFI--LPNVMGCVGN 188
           + G + S++     F + +++S      ++    +V R   G+G + +  +  ++GC   
Sbjct: 136 LLGFQSSMLISIFIFEVGSIVSATATSMNN---LVVGRVVAGIGGSGLQTVSMIIGC-SL 191

Query: 189 IYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFY 235
           + + N   + IVI++I +   V + +G F  G   T     W W F+
Sbjct: 192 VEERN---RTIVIAVIMSAFAVSSLIGPFIGGAFTTH--ATWRWCFW 233

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 11/129 (8%)

Query: 109 WLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSR 168
           WL+A + L +  F LI GR   + G + S+      F + +++S   + T  D   IV R
Sbjct: 97  WLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSA--SATSMDN-LIVGR 153

Query: 169 SFQGLGVAFI--LPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKN 226
              G+G + +  L  V+G      K      +IV+S   A + +G F+G  F   +    
Sbjct: 154 VIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHV---- 209

Query: 227 PDDWPWSFY 235
              W W F+
Sbjct: 210 --IWRWCFW 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,472,908
Number of extensions: 2097631
Number of successful extensions: 7157
Number of sequences better than 10.0: 169
Number of HSP's gapped: 7247
Number of HSP's successfully gapped: 177
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)