Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034208.842ON51151126150.0
YML115C (VAN1)8.842ON53543118530.0
Suva_13.288.842ON53043218500.0
Smik_13.198.842ON53641918220.0
KAFR0A028308.842ON50748918180.0
NDAI0E002908.842ON52248917960.0
NCAS0B003008.842ON52350817920.0
ZYRO0G14234g8.842ON50948517850.0
Skud_13.268.842ON53942017870.0
TDEL0B005608.842ON50943116910.0
SAKL0D01430g8.842ON44742916830.0
Kpol_541.158.842ON49842916620.0
TBLA0B032708.842ON52042916150.0
KLTH0C03828g8.842ON40440516010.0
KLLA0D01529g8.842ON50144115870.0
CAGL0B02321g8.842ON51242515640.0
TPHA0C047808.842ON52546815580.0
Ecym_46138.842ON52443515150.0
ABL124W8.842ON48542314890.0
Kwal_27.102468.842ON33934013820.0
CAGL0L01331g1.479ON4473659611e-125
SAKL0D11792g1.479ON4833669481e-123
KLTH0C03432g1.479ON4893669491e-123
Ecym_35731.479ON4473659421e-122
Kwal_27.101571.479ON4763659431e-122
NCAS0G041101.479ON4943659431e-122
KAFR0I027701.479ON4553659351e-121
TBLA0B021701.479ON5723659421e-120
Smik_5.571.479ON4913569291e-120
YEL036C (ANP1)1.479ON5003579281e-119
NDAI0B012501.479ON4463659221e-119
KNAG0I003001.479ON4573679201e-119
Suva_5.331.479ON4953569231e-119
Skud_5.541.479ON4913569231e-119
AFR357W1.479ON4343669161e-118
Kpol_370.51.479ON6453569341e-118
NDAI0G003401.479ON5043569221e-118
TPHA0O004301.479ON5483569141e-117
KLLA0E22155g1.479ON4503658961e-115
TDEL0C026001.479ON4623658891e-114
ZYRO0F05170g1.479ON6083579011e-114
KLTH0E11616g8.500ON3943804629e-52
KNAG0A021508.500ON3963554592e-51
Suva_16.2658.500ON3953524514e-50
CAGL0L12804g8.500ON3933524489e-50
Kwal_27.118648.500ON4533494529e-50
SAKL0H11110g8.500ON3933524471e-49
NDAI0E030208.500ON3963494471e-49
Skud_16.2328.500ON3953524462e-49
Smik_16.1868.500ON3953524452e-49
NCAS0C023308.500ON3933524434e-49
YPL050C (MNN9)8.500ON3953524418e-49
TBLA0H033408.500ON3933524365e-48
KLLA0E12849g8.500ON3923524341e-47
Kpol_1031.788.500ON3923524331e-47
TPHA0L013708.500ON3923524331e-47
KAFR0H013908.500ON3983514322e-47
ZYRO0F08492g8.500ON3963494295e-47
TDEL0B013708.500ON3963524252e-46
Ecym_25508.500ON3903484121e-44
NCAS0B024408.500ON4003463929e-42
AGL259C8.500ON3893503892e-41
NDAI0C052508.500ON4023443482e-35
KNAG0A039908.500ON3571782154e-18
SAKL0H20438gsingletonON5652081421e-08
Skud_12.915.197ON54287751.3
ZYRO0G12540g3.295ON95063751.5
YLR023C (IZH3)5.197ON54389741.8
TPHA0B008404.237ON111957742.2
SAKL0G06094g5.576ON3261111723.7
TPHA0J003306.20ON1107126698.1
Kwal_47.176214.136ON144661699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03420
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...  1011   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   718   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   717   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   706   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   704   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   696   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   694   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   692   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   692   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   655   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   652   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   644   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   626   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   621   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   615   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   607   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   604   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   588   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   578   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   536   0.0  
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   374   e-125
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   369   e-123
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   370   e-123
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   367   e-122
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   367   e-122
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    367   e-122
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   364   e-121
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   367   e-120
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   362   e-120
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   362   e-119
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   359   e-119
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   358   e-119
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   360   e-119
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   360   e-119
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   357   e-118
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   364   e-118
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   359   e-118
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   356   e-117
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   349   e-115
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   347   e-114
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   351   e-114
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   182   9e-52
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   181   2e-51
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   178   4e-50
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   177   9e-50
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   178   9e-50
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   176   1e-49
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   176   1e-49
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   176   2e-49
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   176   2e-49
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   175   4e-49
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   174   8e-49
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   172   5e-48
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   171   1e-47
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   171   1e-47
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   171   1e-47
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   171   2e-47
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   169   5e-47
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   168   2e-46
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   163   1e-44
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   155   9e-42
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   154   2e-41
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   138   2e-35
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    87   4e-18
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    59   1e-08
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    33   1.3  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    33   1.5  
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    33   1.8  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    33   2.2  
SAKL0G06094g Chr7 (498322..508107) [9786 bp, 3261 aa] {ON} simil...    32   3.7  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...    31   8.1  
Kwal_47.17621 s47 (486476..490816) [4341 bp, 1446 aa] {ON} YLR32...    31   9.4  

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/511 (95%), Positives = 488/511 (95%)

Query: 1   MSLLNWRRRAASQSRELPTYMGTKDNKTAKFVPKRKRQTXXXXXXXXXXVVFVAVSTVSL 60
           MSLLNWRRRAASQSRELPTYMGTKDNKTAKFVPKRKRQT          VVFVAVSTVSL
Sbjct: 1   MSLLNWRRRAASQSRELPTYMGTKDNKTAKFVPKRKRQTLLRLISLLGLVVFVAVSTVSL 60

Query: 61  SRYLRGPASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLIS 120
           SRYLRGPASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLIS
Sbjct: 61  SRYLRGPASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLIS 120

Query: 121 EFGNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEV 180
           EFGNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEV
Sbjct: 121 EFGNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEV 180

Query: 181 LPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVT 240
           LPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVT
Sbjct: 181 LPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVT 240

Query: 241 DYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGF 300
           DYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGF
Sbjct: 241 DYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGF 300

Query: 301 SDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDV 360
           SDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDV
Sbjct: 301 SDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDV 360

Query: 361 LVPNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYI 420
           LVPNVWRPLPEFLNGEQPYDLNSWMESP             VIVEGYAEYPTWRVHLAYI
Sbjct: 361 LVPNVWRPLPEFLNGEQPYDLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYI 420

Query: 421 RDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVG 480
           RDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVG
Sbjct: 421 RDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVG 480

Query: 481 GLPHYTLWHIYEPSDDDLREIANKEREKRRE 511
           GLPHYTLWHIYEPSDDDLREIANKEREKRRE
Sbjct: 481 GLPHYTLWHIYEPSDDDLREIANKEREKRRE 511

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/431 (75%), Positives = 381/431 (88%), Gaps = 3/431 (0%)

Query: 81  NHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVK 140
           + NYKT++L++ EYY+YDFE +DP VI KFD GVQHYLIS+FG++VLTPKD E+Y+ E+ 
Sbjct: 106 SENYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELN 165

Query: 141 QLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDV 200
            LFDSTV+ YDL+ F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID+
Sbjct: 166 MLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDL 225

Query: 201 AFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQ 260
           AFLVSDCS+ D TL+ALIAYSR LQNGTLSQIF E+DAV D   ++ +  +KLYLKYM +
Sbjct: 226 AFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVID---SQTKGTDKLYLKYMDE 282

Query: 261 EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR 320
            Y+N+V +AF+PP+HENYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+R
Sbjct: 283 GYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 342

Query: 321 NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD 380
           NWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLP FL  EQPYD
Sbjct: 343 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYD 402

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
           LNSWMES              VIVEGYAEYPTWRVHLAYIRD EGDP+E VDLDGVGGVS
Sbjct: 403 LNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVS 462

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE 500
           ILA+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+E
Sbjct: 463 ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE 522

Query: 501 IANKEREKRRE 511
           IA++EREKRR+
Sbjct: 523 IASREREKRRQ 533

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/432 (74%), Positives = 382/432 (88%), Gaps = 3/432 (0%)

Query: 80  GNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEV 139
           G+ NYKT++L++ EYYNYDFE +DP V+ KFD GVQHYLI++FG++VLTP D E+Y+ E+
Sbjct: 101 GSENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEM 160

Query: 140 KQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELID 199
             L DSTV++YDL  F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID
Sbjct: 161 SMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 220

Query: 200 VAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMK 259
           +AFLVSDCS+ D TL+ALIAYSRQLQNGTLS+IF E+DAV D   ++ +  +KLYLKYM 
Sbjct: 221 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVID---SQTKGTDKLYLKYMD 277

Query: 260 QEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRS 319
           ++Y+N+V +AF+PP+H+NYDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+
Sbjct: 278 EDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRA 337

Query: 320 RNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPY 379
           RNWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLP FLN EQPY
Sbjct: 338 RNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPY 397

Query: 380 DLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGV 439
           DLNSWMES              VIVEGYAEYPTWRVHLAYIRD  GDP+EVVDLDGVGGV
Sbjct: 398 DLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGV 457

Query: 440 SILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLR 499
           SILA+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+
Sbjct: 458 SILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLK 517

Query: 500 EIANKEREKRRE 511
           EIA +EREKRR+
Sbjct: 518 EIATREREKRRQ 529

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/419 (75%), Positives = 373/419 (89%), Gaps = 3/419 (0%)

Query: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142
           NYKT++L++ EYY+YDFE +DP V+ KFD GV+HYLIS+FG+DVLTPKD E+Y++E+  L
Sbjct: 108 NYKTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSML 167

Query: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202
            DSTV++YDL+ F G+ +G   RDH+L+CVPLR+A +VLPLMFKHLMNLTYPHELID+AF
Sbjct: 168 LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEY 262
           LVSDCS+DD TL+ALIAYSRQLQNGTLSQIF E+DAV D   ++ +  +KLYL+YM Q Y
Sbjct: 228 LVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVID---SQTKGTDKLYLQYMDQNY 284

Query: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322
           +N+V +AF+PP+HENYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNW
Sbjct: 285 INRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344

Query: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382
           LTANALKPYHSWVYWRDAD+ELCPGS+IQD+M+K+YDV+VPNVWRPLP FL  EQPYDLN
Sbjct: 345 LTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLN 404

Query: 383 SWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442
           SWMES              VIVEGYAEYPTWRVHLAYIRD EGDP+EV+DLDGVGGVSIL
Sbjct: 405 SWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSIL 464

Query: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREI 501
           A+AKLFRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+EI
Sbjct: 465 AKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/489 (68%), Positives = 393/489 (80%), Gaps = 11/489 (2%)

Query: 23  TKDNKTAKFVPK-RKRQTXXXXXXXXXXVVFVAVSTVSLSRYLRGPASINKILKKLESGN 81
           T   K   F PK RKR+           V F+ +    +  +    + +NK +  +    
Sbjct: 29  TDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFLIL--FLMLNFEFNASKLNKTIIDIAQ-- 84

Query: 82  HNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQ 141
              KT+NL + EYYN+DFE +DP VI KFDQG QHYLIS+FG DVLTP+DQE YE E+  
Sbjct: 85  ---KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNM 141

Query: 142 LFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVA 201
           L+DST++ YDL +F G+P+G  NRDHVL+C+PLRDA  VLPLMF+HLMNLTYPHELID+A
Sbjct: 142 LYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLA 201

Query: 202 FLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQE 261
           FLVSDCS++DNTL+ALI +S+ LQNGTLSQ+  E+DA T     +    + L+LKYM  E
Sbjct: 202 FLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT---KEETSTKSNLHLKYMDPE 258

Query: 262 YLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRN 321
           YL +V+KAF+PP+HE+YDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGR+RN
Sbjct: 259 YLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 318

Query: 322 WLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDL 381
           WLTANALKPYHSWVYWRDADIELCPGSVI+D+MAKDYDV+VPNVWRPLP FL+GEQPYDL
Sbjct: 319 WLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDL 378

Query: 382 NSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSI 441
           NSW ES              VIVEGYAEYPTWRVHLAYIRD +G+P EVVD+DGVGGVSI
Sbjct: 379 NSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSI 438

Query: 442 LARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREI 501
           LA+AKLFR+GVQFPAFTFENHAETEAFGKMA+K+G++VGGLPHYTLWHIYEPSDDDL+E+
Sbjct: 439 LAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498

Query: 502 ANKEREKRR 510
           ANKERE+RR
Sbjct: 499 ANKEREERR 507

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/489 (67%), Positives = 384/489 (78%), Gaps = 5/489 (1%)

Query: 27  KTAKFVPKRKRQTXXXXXXXXXXVVFVAVSTVSLSRYLRGPASINKI---LKKLESGNHN 83
           K  +F+PK+K              +  A+     S +      + KI     K    + +
Sbjct: 34  KKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTS 93

Query: 84  YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLF 143
           YKT  L + EYYNYDFE ++  V+GKF+ GVQHYLISEFG DVLTPKD+E+YE E+  L 
Sbjct: 94  YKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLL 153

Query: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203
           D++V++YDL +F GS +G  NRDH+L+CVPLRDAE VLPLMFKHLMN+TYPHELID+AFL
Sbjct: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213

Query: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNK-LYLKYMKQEY 262
           VSDCSD DNTLEAL+ YSR LQNGTLSQ+F +MD    Y ++ D +  K L+LKYM QEY
Sbjct: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQ-YEHSDDTRGTKNLHLKYMNQEY 272

Query: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322
           L  VE AF  P HENYDKPFRSVQIF K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNW
Sbjct: 273 LKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 332

Query: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382
           L ANALKPYHSWVYWRDADIELCPG++++DMMA DYDVLVPNVWRPLPEFL+ EQPYDLN
Sbjct: 333 LMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLN 392

Query: 383 SWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442
           SW+ES              VIVEGYAEYPTWRVHLAYIR+ +GDP+ VVDLDGVGGVSIL
Sbjct: 393 SWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSIL 452

Query: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           A+AKLFR+GV FPAFTFENHAETE FGKMA+++G+RVGGLPHYT+WHIYEPSDDDL+EIA
Sbjct: 453 AKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512

Query: 503 NKEREKRRE 511
           NKER+ R +
Sbjct: 513 NKERQSRHK 521

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/508 (64%), Positives = 391/508 (76%), Gaps = 8/508 (1%)

Query: 11  ASQSRELPTY-----MGTKDNKTAKFVPKRKRQTXXXXXXXXXXVVFVAVSTV---SLSR 62
           A Q   LPT       G ++ K   FVPKR++            ++ + V      SL+ 
Sbjct: 15  AQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTE 74

Query: 63  YLRGPASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEF 122
                 S+  +     +   +YKT  L ENEYY++DFE ++P V+ KFD GVQHYLIS++
Sbjct: 75  MTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQY 134

Query: 123 GNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLP 182
           G DVLTP D E Y  E++ + D++V++YDL+ FTGS +G TNRDH+L+CVPLRDAE VLP
Sbjct: 135 GTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLP 194

Query: 183 LMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDY 242
           LMFKHLMNLTYPHELID+AFLVSDCS+ D TL+AL+AYS+ LQNGTLSQ+F EMD     
Sbjct: 195 LMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMD 254

Query: 243 LNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSD 302
            + K +    L+LKYM  +YL  V+ +F    H NYDKPFRS+Q+F+K+FGQIIGQGFSD
Sbjct: 255 HSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSD 314

Query: 303 RHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLV 362
           RHAVKVQGIRRKLMGR+RNWL ANALKPYH+WVYWRDADIELCPGSVI+D+M+KDYDV+V
Sbjct: 315 RHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIV 374

Query: 363 PNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRD 422
           PNVWRPLPEFL+GEQPYDLNSW+ES              VIVEGYAEYPTWRVHLAYIRD
Sbjct: 375 PNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 434

Query: 423 EEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGL 482
             GDP+EVVDLDGVGGVSILA+AK+FR+GVQFPAFTFENHAETEAFGKMARK+GFRVGGL
Sbjct: 435 AAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGL 494

Query: 483 PHYTLWHIYEPSDDDLREIANKEREKRR 510
           PHYT+WHIYEPSDDDL EIANKER+ +R
Sbjct: 495 PHYTIWHIYEPSDDDLMEIANKERQNKR 522

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/485 (67%), Positives = 386/485 (79%), Gaps = 5/485 (1%)

Query: 29  AKFVPKRKRQTXXXXXXXXXXVVFVAVSTV--SLSRYLRGPASINKILKKLESGNHNYKT 86
           +K  PK KR +          ++ V V  +  + S  +RG   + K +    S N     
Sbjct: 28  SKLSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQV- 86

Query: 87  VNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDST 146
             L+E+ YY+YDFE +DP VI KFD GVQHYLI++FGNDVLTP+D E +E E K L  ST
Sbjct: 87  --LEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSST 144

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL+ F GS +G  N +HVL+CVPLRDAE+VLPLMFKHLMNLTYPHELID+AFLVSD
Sbjct: 145 VESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSD 204

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
           C++DD TL+ALIAYSRQLQ+GTLSQ+F +MD          +   KLYLKYM  +YL  V
Sbjct: 205 CTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETV 264

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
           +++F+PP+HENYDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNWLTAN
Sbjct: 265 KESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 324

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRDAD+ELCPGSVI+D+M+KDYDV VPNVWRPLP+FL+GEQPYDLNSWME
Sbjct: 325 ALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWME 384

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGYAEYPT+RVHLAYIRD   DP+E++DLDGVGGVSILA+A+
Sbjct: 385 SGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAE 444

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           LFR G+QFPAFTFENHAETE FGKMA+K+G+RVGGLPHYTLWHIYEPSDDDLREIANKER
Sbjct: 445 LFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKER 504

Query: 507 EKRRE 511
           E RRE
Sbjct: 505 ESRRE 509

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/420 (74%), Positives = 373/420 (88%), Gaps = 3/420 (0%)

Query: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142
           NYKT++L++ EYYNYDFE +DP VI KFD G QHYLIS+FG++VL P+++E Y+ E+  L
Sbjct: 108 NYKTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNML 167

Query: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202
            DSTV++YDL++F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID+AF
Sbjct: 168 LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEY 262
           LVSDCS+ D TL+ALIAYSRQLQNGTLSQIF ++DA+ D   ++ +  +KLYLKYM ++Y
Sbjct: 228 LVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIID---SQTKGTDKLYLKYMDEDY 284

Query: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322
           +N+V +AF+PP+H+NYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNW
Sbjct: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344

Query: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382
           LTANALKPYHSWVYWRDAD+ELCPGSVI+D+M+K+YDV+VPNVWRPLP FLN EQ YDLN
Sbjct: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLN 404

Query: 383 SWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442
           SWMES              VIVEGYAEYPTWRVHLAYIRD EG+P+EVVDLDGVGGVSIL
Sbjct: 405 SWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSIL 464

Query: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           A+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+EIA
Sbjct: 465 AKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/431 (70%), Positives = 363/431 (84%), Gaps = 7/431 (1%)

Query: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142
           +Y T+ L +  YY+YDFE +DP VI KFD GV +Y I++FG + +T ++  ++E EV  L
Sbjct: 84  SYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSML 143

Query: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202
            DSTV++YD+ +F G+ +   N++HVL+CVPLRDAE VLPLMFKHLMN+TYPHELID+AF
Sbjct: 144 LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF 203

Query: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNN--KLYLKYMKQ 260
           LVSDCS+ D+TL+ALIAYSRQLQNGTLSQ+F E++     ++ K+RK     LYL+YM Q
Sbjct: 204 LVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVE-----MSEKERKKGGENLYLQYMDQ 258

Query: 261 EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR 320
           +YL +V+ +F+PP+HENYDK FRSVQIF+K+FGQ IGQGFSDRHAVKVQG+RRKLM R+R
Sbjct: 259 DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR 318

Query: 321 NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD 380
           NWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+MAKDYDV+VPNVWRPLP FL+G+QPYD
Sbjct: 319 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD 378

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
           LNSW+ES              VIVEGYAEYPTWR HLAY RD  GDP+EVV+LDGVGGVS
Sbjct: 379 LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS 438

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE 500
           ILARA+LFR G+ FPAFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL+E
Sbjct: 439 ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE 498

Query: 501 IANKEREKRRE 511
           I NKEREKRRE
Sbjct: 499 IGNKEREKRRE 509

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/429 (70%), Positives = 362/429 (84%), Gaps = 2/429 (0%)

Query: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142
           NYKT +L+++EYYNYDF+ +D  +I K+D+G +H+LIS+ G +VLTP+D ERYE EV+ L
Sbjct: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80

Query: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202
             +TV  YDL+++ GS +G  NRDHVL+CVPLR+A  VLPLMFKHLMNLTYPHELID+AF
Sbjct: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140

Query: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEY 262
           LVSDCS+DD+TL+ALIAYS++LQNGTLS++F E D +     A  + +  LYLKYM Q+Y
Sbjct: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRR--KASIKGSPDLYLKYMNQDY 198

Query: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322
           LN VE AF PP+H++YDKPFRSVQ+F+K+FGQ+IGQGFSDRHAV VQGIRRKLMGR+RNW
Sbjct: 199 LNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNW 258

Query: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382
           LTANALKPYHSWVYWRD DIELCPGSVI+D+M+ + DV VPNVWRPLPEFL GEQ YDLN
Sbjct: 259 LTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLN 318

Query: 383 SWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442
           SW+ES              VIVEGYAEYPTWRVHL YIR+ + +P E++DLDGVGGVSIL
Sbjct: 319 SWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSIL 378

Query: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           A+AKLFR GV FPAFTFENHAETEAFGKMA+K+ +RVGGLPHYT+WHIYEPSDDDL+EIA
Sbjct: 379 AKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIA 438

Query: 503 NKEREKRRE 511
            KEREKRR+
Sbjct: 439 KKEREKRRD 447

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/429 (67%), Positives = 365/429 (85%), Gaps = 5/429 (1%)

Query: 82  HNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQ 141
           H  +   L++NEYY+YDF+  D  ++ KFD G +HYLIS++G++VLTP+D+ RYE E+++
Sbjct: 74  HTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQE 133

Query: 142 LFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVA 201
           L  +TVQ YDL++++G+ +G  NR+HVL+CVPLRDAE+VLPLMFK++MNLTYPHELID+A
Sbjct: 134 LLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLA 193

Query: 202 FLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQE 261
           FLVSDC++ D+TLE+LIAYSR LQ+GTL+ +F EMD      +   + + KLYLKYM ++
Sbjct: 194 FLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDK-----DDSKKDSEKLYLKYMNKD 248

Query: 262 YLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRN 321
           YL  VE A++PP+H +Y+KPFRSVQIF+K+FGQ +GQGF++RH+VKVQGIRRKLMGR+RN
Sbjct: 249 YLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARN 308

Query: 322 WLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDL 381
           WL  NALKPYH+WVYWRDAD+ELCPG+VI+D+M+K++DV+VPNVWRPLPEFLN EQPYDL
Sbjct: 309 WLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDL 368

Query: 382 NSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSI 441
           NSWMES              VIVEGYAEYPTWRVHLAYIR++ G+P++VVDLDGVGGVSI
Sbjct: 369 NSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSI 428

Query: 442 LARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREI 501
           L +AKLFR+G+ FPAFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL EI
Sbjct: 429 LVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEI 488

Query: 502 ANKEREKRR 510
           A+KERE  R
Sbjct: 489 ASKERENNR 497

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/429 (67%), Positives = 346/429 (80%), Gaps = 1/429 (0%)

Query: 79  SGNHNYKTVN-LQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEA 137
           S N NYK    L++ EYY+YDF ++D      FDQG QHYLI+++G DV+T KD+ERY  
Sbjct: 86  SSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQ 145

Query: 138 EVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHEL 197
           E++ L  S+V +YDL++F G+ +G  NR+H+L   PLRDAE VLP+MFKHLMNLTYPHEL
Sbjct: 146 EMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHEL 205

Query: 198 IDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKY 257
           ID+AFLVSDCS+ D TL+ LI ++R LQ+GTL  IF +MDA       K+   NK YLK+
Sbjct: 206 IDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKF 265

Query: 258 MKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMG 317
           M Q Y+   + +F  P+H  Y+KPFRSVQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMG
Sbjct: 266 MDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMG 325

Query: 318 RSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ 377
           R+RNWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLPEFLN EQ
Sbjct: 326 RARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ 385

Query: 378 PYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVG 437
           PYDLNSWMES              VIVEGYAEYPTWRVHLAY+RD  GDP++ +D+DGVG
Sbjct: 386 PYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVG 445

Query: 438 GVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDD 497
           GVSILA+AKLFR+GV FPAFTFENHAETEAFGKMA+K+G+ VGGLP+Y LWHIYEPSDDD
Sbjct: 446 GVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDD 505

Query: 498 LREIANKER 506
           L+++A  ER
Sbjct: 506 LKDMAAIER 514

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/405 (70%), Positives = 341/405 (84%), Gaps = 2/405 (0%)

Query: 106 VIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNR 165
           ++ KFD G +HYLIS+ G ++L   D+ERYE EVK L DSTV+ YDL +F GS  GE NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 166 DHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQ 225
           +HVL+ VPLR+AE+VLPLMFK+LMNLTYPHELID+AFLVSDCS+DD TLEAL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 226 NGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSV 285
           +GTLS +F    +  + +  K++  + L+LKYM+  YL  V+ A++PP+H+ YDKPFRSV
Sbjct: 121 SGTLSDVFAAHSSDEELI--KEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178

Query: 286 QIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELC 345
           QIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGR+RNWLTANALKPYHSWVYWRDAD+ELC
Sbjct: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238

Query: 346 PGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVE 405
           PGSVIQD+M+ D+DV VPNVWRPLPEFL GEQPYDLNSW+ES              VIVE
Sbjct: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298

Query: 406 GYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAET 465
           GYAEYPTWRVHLAY+RD + +P ++++LDGVGGVSILA+AKLFRNGV FPAFTFENHAET
Sbjct: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358

Query: 466 EAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREKRR 510
           EAFGKMA+K+G+RV GLPHYTLWHIYEPSDDDL +IA +EREK+R
Sbjct: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/441 (64%), Positives = 349/441 (79%), Gaps = 7/441 (1%)

Query: 73  ILKKLESGNHN---YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTP 129
           +L KL  GN N   Y   +L E EYY+YDF+ LD   I K+D+GV HY+IS+ G + L+ 
Sbjct: 62  LLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSS 121

Query: 130 KDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLM 189
           +D+E +E E   L  ST   YDL+++ G+ +G  NRDHVL+CVPLRDA  +LP++FK+LM
Sbjct: 122 EDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLM 181

Query: 190 NLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRK 249
           NLTYPHELID+AFLVSDC+D+  T+ +L+ +S++LQNGTLS+   + +A  D  N+ +  
Sbjct: 182 NLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDKGNSAE-- 239

Query: 250 NNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQ 309
             +LYLKYM ++YL  V+ AF PP+H++YDKPFRS+QIFEK+FGQ IGQGFSDRHAVKVQ
Sbjct: 240 --QLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQ 297

Query: 310 GIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPL 369
           G+RRKLMGR+RNWLTANALKPYHSWVYWRD D+ELCPG+VI+D+M  DYDV+VPNVWRPL
Sbjct: 298 GVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPL 357

Query: 370 PEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSE 429
           P FL G Q YDLNSW+ES              VIVEGYAEYPTWRVHL Y+R + G+P +
Sbjct: 358 PTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDD 417

Query: 430 VVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWH 489
           ++DLDGVGGVSILARA+LFR G+ FPAFTFENHAETEAFGKMA+K+GF+VGGL HYTLWH
Sbjct: 418 LLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWH 477

Query: 490 IYEPSDDDLREIANKEREKRR 510
           IYEPSDDDLREIA  ERE RR
Sbjct: 478 IYEPSDDDLREIAKLERESRR 498

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/425 (66%), Positives = 338/425 (79%), Gaps = 5/425 (1%)

Query: 84  YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLF 143
           Y     ++  Y+++DFE +D  ++ KFDQG+ +YLISE+G +  +  D   Y   ++ L 
Sbjct: 93  YLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLL 152

Query: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203
           DSTV++YDL  F GS DG   ++H+L+CVPLRDAEEVLPLMFK+LMNLTYPHELID+AFL
Sbjct: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212

Query: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYL 263
           VSDCS+ D TLEAL  YS+ LQ G L  I  +MD        K + N  ++LKYM+ +YL
Sbjct: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYN-----KGKSNESIHLKYMEPDYL 267

Query: 264 NKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWL 323
            +V+ A+ PP+H NY KPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNWL
Sbjct: 268 KRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 327

Query: 324 TANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNS 383
            +NALKPYHSWVYWRDAD+ELCPGSVI+D+M +DYDV+VPNVWRPLP+FLN  QPYDLNS
Sbjct: 328 MSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNS 387

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           WMES              VIVEGYAEYPT+RVHLAYIR+E+GDP++VVDLDGVGGVSILA
Sbjct: 388 WMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILA 447

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIAN 503
           RA++FR GV F AFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL  +A 
Sbjct: 448 RARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAK 507

Query: 504 KEREK 508
            E+ K
Sbjct: 508 LEKGK 512

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/468 (62%), Positives = 369/468 (78%), Gaps = 12/468 (2%)

Query: 53  VAVSTVSLSRYLRGPASINKILKKLESGNH-------NYKTVNLQENEYYNYDFETLDPH 105
           VA+S + L  ++    S+N  + K  S  H        + T  L   EYYNYDF   +  
Sbjct: 56  VALSVILLCIFIAKTISVNVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLD 115

Query: 106 VIGKFDQGVQHYLISEFGND---VLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGE 162
            I K+D+GV+ YL+  +  D    L+ + +E Y+AE+ +L  S+V  YD+ +F+G+  G 
Sbjct: 116 TISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGV 175

Query: 163 TNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSR 222
           ++R+HVL+C+PLRDAE+VLPLMFK+LMNLTYPHELIDVAFLVSDCS++D+TLE+L+ Y+R
Sbjct: 176 SSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTR 235

Query: 223 QLQNGTLSQIFGEMDAVTDYLN--AKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDK 280
            LQNGTL  +F EMD + +  +   ++  ++KLYLKYMK+EYL +V++AF  P+HENYDK
Sbjct: 236 FLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDK 295

Query: 281 PFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDA 340
           PFRS+QI++K+FGQ +GQ FSDRH VKVQGIRRKLMGR+RNWL  NALKPYHSWVYWRDA
Sbjct: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355

Query: 341 DIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXX 400
           D+ELCPG+VI+D+M+KD+DV+VPNVWRPLPEF+N EQPYDLNSWMES             
Sbjct: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415

Query: 401 XVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFE 460
            VIVEGYAEYPTWRVHLAY+R+++GDP++VVD+DGVGGVSILARA+LFR GV FPAFTFE
Sbjct: 416 EVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFE 475

Query: 461 NHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREK 508
           NHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL  IA KE+E+
Sbjct: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/435 (63%), Positives = 338/435 (77%), Gaps = 3/435 (0%)

Query: 77  LESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYE 136
           L S + +Y T  L+E+EYYN+++  LD   + ++D G +H LI + G   L    +E +E
Sbjct: 91  LLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFE 148

Query: 137 AEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHE 196
             +  L  +TV+ YDL+++ G+ +G  NR+HVLICVPLR+AE VLPLMF+HLMNLTYPHE
Sbjct: 149 EHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHE 208

Query: 197 LIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDR-KNNKLYL 255
           LID+AFLVSDCS DD+T+++LI+Y+ +LQ GTLS+     DA   +  +K + K   L+L
Sbjct: 209 LIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHL 268

Query: 256 KYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKL 315
           KYM ++YLN VE A   P+H+NYDKPFRSVQIF+K+FGQIIGQGFSDRH VKVQG RRKL
Sbjct: 269 KYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKL 328

Query: 316 MGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNG 375
           MG++RNWLTANALKPYHSWVYWRDAD+ELCPGSVI+D+M+  YDV+VPNVWRPLPEFL  
Sbjct: 329 MGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGS 388

Query: 376 EQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDG 435
           EQ YDLNSW+ES              VIVEGYAEY TWR HLA  RD +G+  +V+DLDG
Sbjct: 389 EQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448

Query: 436 VGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSD 495
           VGGVSILA+AKLFRNGV F AF FENHAETEAFGKMA+K+G+RVGGL HYTLWHIYEPS+
Sbjct: 449 VGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSN 508

Query: 496 DDLREIANKEREKRR 510
           DDL EIA KER  RR
Sbjct: 509 DDLMEIARKERSSRR 523

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/423 (63%), Positives = 327/423 (77%), Gaps = 4/423 (0%)

Query: 89  LQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDSTVQ 148
           L + EYY+Y+F       + K+D+G +HY ++  G      +D   +E ++++L  +TV+
Sbjct: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121

Query: 149 RYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCS 208
           +YDL  + G+P+G  NR+HVLIC+PLR+A  VLP+MFKHLMNLTYPHELIDVAFLVSDCS
Sbjct: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181

Query: 209 DDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAK-DRKNNKLYLKYMKQEYLNKVE 267
           ++D TL++L+ Y+  LQ GTL+ +    +A    L AK       LYLKYM QEYL  V 
Sbjct: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241

Query: 268 KAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANA 327
            AF+PPYHENY+KPFRSVQ+F+K+FGQ IGQGFSDRH VKVQGIRR+LMGR+RNWLTANA
Sbjct: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301

Query: 328 LKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMES 387
           LKPYHSWVYWRD D+ELCPGSVI+D+M+  YDV+VPNVWRPLPEFL G+Q YDLNSW+ES
Sbjct: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361

Query: 388 PXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKL 447
                         VIVEGYAEY TWR HL   R+ +G+P EV+DLDGVGGVSILA+AKL
Sbjct: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421

Query: 448 FRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKERE 507
           FR G  F AF FENHAETEAFGKMA+K+G++VGGLPHYTLWHIYEPSDDD+ +IA +ERE
Sbjct: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481

Query: 508 KRR 510
            RR
Sbjct: 482 NRR 484

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/340 (72%), Positives = 290/340 (85%), Gaps = 2/340 (0%)

Query: 172 VPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQ 231
           VPLR+A++VLPLMFK+LMNLTYPHELID+AFLVSDCS+DD T EAL+ Y+++LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 232 IFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKN 291
           +F   ++  + L  ++  ++ L+LKYM+  YL  V+ AFTPP+H+NYDKPFRSVQIF+KN
Sbjct: 62  VFASHNSGENVL--REEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119

Query: 292 FGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQ 351
           FGQ+IGQ FSDRHAVKVQG RRKLMGR+RNWLTANALKPYHSWVYWRDAD+ELCPGSVI+
Sbjct: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179

Query: 352 DMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYP 411
           D+MA  YDV VPNVWRPLPEFL+GEQ YDLNSW+ES              VIVEGYAEYP
Sbjct: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239

Query: 412 TWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKM 471
           TWRVHL YIR+E+GDP   +DLDGVGGVSILA+A+LFRNGV FPAFTFENHAETEAFGKM
Sbjct: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299

Query: 472 ARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREKRRE 511
           A+K+G+ V GLPHYTLWHIYEPSDDDL ++  +ERE +R+
Sbjct: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  374 bits (961), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 237/365 (64%), Gaps = 52/365 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDLN++TG PDG    D +L CVPLRDA E LP+ F HL  +TYPH LID++FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SD  NT+  L+ + +Q Q                    KD+                  
Sbjct: 114 SSD--NTMGVLMHHLQQAQ--------------------KDK------------------ 133

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                       +K F +++IFEK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 134 ------------NKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 181

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           A+KPYHSWVYWRD D+E+ P S+++D+M  D DV+VPNVWRPLP++L   QPYDLNSW+E
Sbjct: 182 AIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVE 241

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + + LDG+GGVSIL++A+
Sbjct: 242 SEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKAR 301

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           +FR G  FPAF+F+ HAETEAFGK++R++GF V GLPHY +WHIYEPS DDL+ +A    
Sbjct: 302 VFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAE 361

Query: 507 EKRRE 511
           E++R+
Sbjct: 362 EEKRK 366

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 232/366 (63%), Gaps = 52/366 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDLN + G+ DG    D VL CVPLRDA E LP+ FKH+  ++YPH LID++FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 207 CSDDDNTLEALIAYSRQLQ-NGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNK 265
            SDD  T+  L++  ++ Q N   SQ FG                               
Sbjct: 142 SSDD--TMGVLLSSLKKAQSNQDKSQRFG------------------------------- 168

Query: 266 VEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTA 325
                             +++IFEK+FGQ+IGQ FSDRH    QG RRKLM R+RNWL +
Sbjct: 169 ------------------NIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 210

Query: 326 NALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWM 385
            ALKPYHSWVYWRD D+E  P ++++D+M  + DV+VPNVWRPLP++L   QPYDLNSW 
Sbjct: 211 VALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWK 270

Query: 386 ESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           ES              VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL++A
Sbjct: 271 ESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKA 330

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKE 505
           K+FR G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WH+YEPS DDL+ +A   
Sbjct: 331 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 390

Query: 506 REKRRE 511
            E++R+
Sbjct: 391 EEEKRK 396

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  370 bits (949), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 230/366 (62%), Gaps = 50/366 (13%)

Query: 146 TVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVS 205
            VQ YDL  + G  DG    DHVL  VPLRDA E LP+ F H+  ++YPH LID++FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 206 DCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNK 265
           D SDD  T+  L+ Y ++ Q+                    DR                 
Sbjct: 112 DSSDD--TMGVLLEYLQKAQS------------------KPDRTQR-------------- 137

Query: 266 VEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTA 325
                           F +++I+EK+FGQ IGQ FSDRH    QG RRKLMGR+RNWL +
Sbjct: 138 ----------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 326 NALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWM 385
            ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 386 ESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           ES              VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL++A
Sbjct: 242 ESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKA 301

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKE 505
           K+FR G  FPAF+FE HAETEAFGK++R+LG+ V GLPHY +WHIYEPS DDL+ +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 506 REKRRE 511
            E++R+
Sbjct: 362 EEEKRK 367

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 231/365 (63%), Gaps = 50/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V  YDL+ + G+ DG    D VL CVPLRDA   LP+ FKHL ++TYPH LID++FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +DD  T+  L+     LQ    SQ  G                                
Sbjct: 110 STDD--TMGVLLNSLHDLQ----SQADGT------------------------------- 132

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        K F  ++IF+K+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 133 -------------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSA 179

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           A+KPYHSWVYWRD D+E  P ++++D+M  D D++VPNVWRPLP++LN  QPYDLNSW+E
Sbjct: 180 AIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVE 239

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL++AK
Sbjct: 240 SEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAK 299

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           +FR G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WH+YEPS DDL+ +A    
Sbjct: 300 VFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAE 359

Query: 507 EKRRE 511
           E++R+
Sbjct: 360 EEQRK 364

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  367 bits (943), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 233/365 (63%), Gaps = 50/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D VL  VPLRDA E LP+ F H+  ++YPH LID++FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+  L+ + ++ Q+ T                  DRK                 
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKT------------------DRK----------------- 135

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        K F +++IFEK+FGQ IGQ FSDRH    QG RRKLMGR+RNWL + 
Sbjct: 136 -------------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSV 182

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 183 ALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQE 242

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL++AK
Sbjct: 243 SEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAK 302

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           +FR G  FPAF+FE HAETEAFGK++R+LG+ V GLPHY +WHIYEPS DDL+ +A    
Sbjct: 303 VFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAE 362

Query: 507 EKRRE 511
           E++R+
Sbjct: 363 EEKRK 367

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  367 bits (943), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 233/365 (63%), Gaps = 50/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  +TYPH LID++FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SD  NT+  L++    LQN    Q               DR                  
Sbjct: 142 SSD--NTMGVLLS---NLQNAQSQQ---------------DRS----------------- 164

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        K F +++IFEK+FGQIIGQ FSDRH  K QG RRKLM R+RNWL + 
Sbjct: 165 -------------KRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSV 211

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           A+KPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 212 AIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 271

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++L+G+GGVSIL++AK
Sbjct: 272 SEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAK 331

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           +FR+G  FPAF+FE HAETEAFGK++R++ F V GLPHY +WHIYEPS +DL+ +A    
Sbjct: 332 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAE 391

Query: 507 EKRRE 511
           E++R+
Sbjct: 392 EEKRK 396

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 232/365 (63%), Gaps = 51/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F+HL  +TYPH  ID++FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+  L+++ +  Q+        +MD                             
Sbjct: 122 SSDD--TMGVLLSHLQSAQS--------QMDK---------------------------- 143

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 144 ------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 191

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 251

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL++AK
Sbjct: 252 SEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAK 311

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA-NKE 505
           +FR G  FPAF+FE HAETEAFG+++R++ + V GLPHY +WHIYEPS +DL+ +A   E
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAE 371

Query: 506 REKRR 510
            EKRR
Sbjct: 372 EEKRR 376

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  367 bits (942), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 227/365 (62%), Gaps = 50/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V  YDLN + G+ DG    D +L CVPLRDA + LP  F HL  +TYPH LID++FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
             DD                         M  +  +L     + NKL             
Sbjct: 132 SKDD------------------------TMGVLLSHLQTAQSQQNKL------------- 154

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 155 -------------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 201

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E CP ++++D+M    DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 202 ALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQE 261

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL++AK
Sbjct: 262 SEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAK 321

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKER 506
           +FR+G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WHIYEPS +DL+ +A    
Sbjct: 322 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAE 381

Query: 507 EKRRE 511
           E++R+
Sbjct: 382 EEKRK 386

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  362 bits (929), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 225/356 (63%), Gaps = 50/356 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  +TYPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SD  NT+  L++   + Q+                                        
Sbjct: 122 SSD--NTMGVLLSNLHKAQS---------------------------------------- 139

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                    ++  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 140 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA+AK
Sbjct: 252 SEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           +FR G  FPAF+FE HAETEAFG+++R++ + V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  362 bits (928), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 226/357 (63%), Gaps = 50/357 (14%)

Query: 146 TVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVS 205
           +V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  +TYPH LID++FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 206 DCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNK 265
           D SD  NT+  L++  +  Q+                                       
Sbjct: 121 DSSD--NTMGVLLSNLQMAQS--------------------------------------- 139

Query: 266 VEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTA 325
                     ++  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL +
Sbjct: 140 ---------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 326 NALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWM 385
            ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 386 ESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           ES              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA+A
Sbjct: 251 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           K+FR G  FPAF+FE HAETEAFG+++R++ + V GLPHY +WHIYEPS DDL+ +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  359 bits (922), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 232/365 (63%), Gaps = 52/365 (14%)

Query: 146 TVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVS 205
           +V+ YD++ + G  DG    + +LICVPL+DA   LPL FK L  +TYPHELID++FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 206 DCSDDDNTLEALIAYSRQLQ-NGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLN 264
           D SD  NT+  L+   ++LQ +G  S  FG                              
Sbjct: 114 DSSD--NTMYNLLNMLKRLQIDGGTSGKFG------------------------------ 141

Query: 265 KVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLT 324
                              +++I+EK+FGQ+IGQGFSDRH    QG RRKLMG++RNWL 
Sbjct: 142 -------------------NIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLN 182

Query: 325 ANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSW 384
             A+KPYHSWVYWRD D+E+ P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW
Sbjct: 183 TVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSW 242

Query: 385 MESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILAR 444
            ES              VIVEGY EY TWR HLAY+RD  GDP   ++LDGVGGVSIL++
Sbjct: 243 KESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSK 302

Query: 445 AKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANK 504
           A +FR+G  FPAF+F+ HAETEAFGK+++ + F V GLP+Y +WHIYEPS +DL+ +A  
Sbjct: 303 ANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKL 362

Query: 505 EREKR 509
           E ++R
Sbjct: 363 EEKER 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  358 bits (920), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 230/367 (62%), Gaps = 50/367 (13%)

Query: 145 STVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLV 204
           +  + YDL  + G+ +G    D +L CVPLRDA E LP+ FKHL  +TYPH L+D++FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 205 SDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLN 264
           SD  DD  T+  L++  +  Q+                   KDR                
Sbjct: 125 SDSKDD--TMGVLLSNLQTAQS------------------QKDRS--------------- 149

Query: 265 KVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLT 324
                          K F +++ FEK+FGQIIGQ FSDRH    QG RRKLM R+RNWL 
Sbjct: 150 ---------------KRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLG 194

Query: 325 ANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSW 384
           + A+KPYHSWVYWRD D+E  P ++++D+M    DV+VPNVWRPLPE+L   QPYDLNSW
Sbjct: 195 SVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSW 254

Query: 385 MESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILAR 444
            ES              VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL++
Sbjct: 255 QESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSK 314

Query: 445 AKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANK 504
           A++FR+G  FPAF+FE HAETEAFGK++R++G+ V GLPHY +WHIYEPS +DL+ +A  
Sbjct: 315 ARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWM 374

Query: 505 EREKRRE 511
             E++R+
Sbjct: 375 AEEEQRK 381

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 228/356 (64%), Gaps = 50/356 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  ++YPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SD  NT+  L++   +LQ                                M Q   +K 
Sbjct: 122 SSD--NTMGVLLS---KLQ--------------------------------MAQSQQDKT 144

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
           ++             F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 145 KR-------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA+AK
Sbjct: 252 SEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           +FR G  FPAF+FE HAETEAFG+++R++ + V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/356 (48%), Positives = 225/356 (63%), Gaps = 50/356 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  ++YPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SD  NT+  L++  +  Q+                                        
Sbjct: 122 SSD--NTMGVLLSSLQTAQS---------------------------------------- 139

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                    ++  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 140 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D++  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA+AK
Sbjct: 252 SEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           +FR G  FPAF+FE HAETEAFG+++R++ + V GLPHY +WHIYEPS DDL+ +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  357 bits (916), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 231/366 (63%), Gaps = 52/366 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ +DL+   G  DG    D VL CVPLRDA E LP+ FKHL  +TYPH L+D++FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
             D+  T+  L  + R+LQ+                     + +N               
Sbjct: 102 SKDE--TMSVLRQHVRELQS---------------------QPDNA-------------- 124

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        + F +++IF+K+FGQ IGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 125 -------------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 171

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD D+E  P ++I+D+M  D DV+VPNVWRPLP++L   QPYDLNSW+E
Sbjct: 172 ALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVE 231

Query: 387 SPXXXXXXXXX-XXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           S               VIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL+RA
Sbjct: 232 SEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRA 291

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA-NK 504
           ++FR+G  FPAF+F+ HAETE FGK++R +G+ V GLPHY +WHIYEPS DDL+ +A   
Sbjct: 292 RVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 351

Query: 505 EREKRR 510
           E E+RR
Sbjct: 352 EEEQRR 357

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  364 bits (934), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 229/356 (64%), Gaps = 50/356 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL+ + G+ DG    D +L C+PLRDA + LP+ F H+  +TYPH L+D++FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+  L+++ + +Q+                                        
Sbjct: 126 SSDD--TMGVLLSHLQTVQS---------------------------------------- 143

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                    ++  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM ++RNWL + 
Sbjct: 144 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSV 195

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHSWVYWRD DIE  P ++++D+M  D D++VPNVWRPLP++L   QPYDLNSW E
Sbjct: 196 ALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQE 255

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL++AK
Sbjct: 256 SEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAK 315

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           +FR+G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WHIYEPS +DL+ +A
Sbjct: 316 VFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  359 bits (922), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 177/356 (49%), Positives = 224/356 (62%), Gaps = 50/356 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ DG    D +L CVPLRDA E LP+ F HL  ++YPH  ID++FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+  L++    LQN    Q                                   
Sbjct: 147 SSDD--TMGVLLS---NLQNAQSQQ----------------------------------- 166

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                     +  K F +++IFEK+FGQ+IGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 167 ----------DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 216

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           A+KPYHSWVYWRD D+E  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 217 AIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 276

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S              VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILA+AK
Sbjct: 277 SEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 336

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           +FR G  FPAF+FE HAETEAFGK++RK+ + V GLPHY +WHIYEPS +DL+ +A
Sbjct: 337 VFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  356 bits (914), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/356 (48%), Positives = 222/356 (62%), Gaps = 50/356 (14%)

Query: 146 TVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVS 205
            V+ YDL  + G+ DG    D ++ CVPLRDA + LP  F HL  ++YPH LID++FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 206 DCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNK 265
           D SDD  T+  L++    LQ                                        
Sbjct: 124 DSSDD--TMGVLLS---NLQ---------------------------------------- 138

Query: 266 VEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTA 325
                T     +  K F +++I+EK+FGQ+IGQ FSDRH    QG RRKLM R+RNWL +
Sbjct: 139 -----TAQSQRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGS 193

Query: 326 NALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWM 385
            ALKPYHSWVYWRD DIE  P ++++D+M  D D++VPNVWRPLP++L   QPYDLNSW 
Sbjct: 194 VALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQ 253

Query: 386 ESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           ES              VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL++A
Sbjct: 254 ESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKA 313

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREI 501
            +FR+G  FPAF+FE HAETEAFGK++R++G+ V GLPHY +WHIYEPS +DL+ +
Sbjct: 314 NVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 174/365 (47%), Positives = 228/365 (62%), Gaps = 51/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G+ +G    D V+ CVPLRDA   L + F  L  LTYPH LID++FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T++ L+++ R+ Q+                                        
Sbjct: 117 SSDD--TMKTLLSHLRRAQS---------------------------------------- 134

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                   +++  + F +++IFEK+FGQ +GQ FSDRH    QG RRK M R+RNWL + 
Sbjct: 135 --------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSA 186

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALKPYHS+VYWRD D++  P ++++D+M  D DV+VPNVWRPLP++L   QPYDLNSW+E
Sbjct: 187 ALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVE 246

Query: 387 SPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAK 446
           S               IVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL++AK
Sbjct: 247 SEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAK 306

Query: 447 LFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA-NKE 505
           +FR G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WHIYEPS DDL+ +A   E
Sbjct: 307 VFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAE 366

Query: 506 REKRR 510
            EKRR
Sbjct: 367 EEKRR 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  347 bits (889), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 227/365 (62%), Gaps = 51/365 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G  DG    + +L  VPLRDA + LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+  L+ + +  Q+                   KDR                  
Sbjct: 117 SSDD--TMGELLHHLQIAQS------------------QKDR------------------ 138

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                       +K F +++IFEK+FGQ IGQ FSDRH    QG RRKLM R+RNWL + 
Sbjct: 139 ------------NKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 186

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
            LKPYHSWVYWRD D+E+ P S+++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 187 TLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKE 246

Query: 387 SPX-XXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           S               VIVEGY E+ TWR HLAY+RD  G+P + ++LDG+GGVSILA+A
Sbjct: 247 SEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKA 306

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKE 505
           K+FR G  FPAF+FE HAETEAFGK++R++ + V GLPHY +WHIYEPS +DL+ +A   
Sbjct: 307 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMA 366

Query: 506 REKRR 510
            E++R
Sbjct: 367 EEEKR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  351 bits (901), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 224/357 (62%), Gaps = 51/357 (14%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V+ YDL  + G PDG    + +L  VPLRDA E LP  F H+  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            SDD  T+ AL+++  + Q+                   KD+                  
Sbjct: 123 SSDD--TMGALLSHLEKAQSN------------------KDKT----------------- 145

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                        + F +++I+EK+FGQ IGQ FSDRH    QG RRKLM R+RNWL   
Sbjct: 146 -------------RRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTV 192

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWME 386
           ALK YHSWVYWRD D+ELCP S+++D+M  D DV+VPNVWRPLP++L   QPYDLNSW E
Sbjct: 193 ALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKE 252

Query: 387 SPXXXXXXXXX-XXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARA 445
           S               VIVEGY +Y TWR HLAY+RD  G+P + ++LDG+GGVSIL++ 
Sbjct: 253 SEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKG 312

Query: 446 KLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502
           K+FR G  FPAF+FE HAETEAFGK++R++G+ V GLPHY +WHIYEPS +DL+ +A
Sbjct: 313 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  182 bits (462), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 189/380 (49%), Gaps = 72/380 (18%)

Query: 128 TPKDQERYEAEVKQLFDSTVQ---------RYDLNEFTGSPDGETNRDHVLICVPLRDAE 178
           TPK    Y+ +   LF  TV+          YDLN+ T +     N++ VLI  P++   
Sbjct: 70  TPK--YSYKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFH 127

Query: 179 EVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDA 238
           +     + +L+ LTYP +LI++ F++   +  D  L  L A  ++ Q             
Sbjct: 128 DQY---WDNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQ------------- 171

Query: 239 VTDYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQ 298
               L  KD++ +K+ +  ++Q+                  + F S+Q  EK        
Sbjct: 172 ----LGKKDQRFSKITI--LRQD-----------------SQSFDSLQ--EK-------- 198

Query: 299 GFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDY 358
              +RHA+KVQ  RR  M  +RN L  + + P+ SW+ W DADI   P S+IQDM A + 
Sbjct: 199 ---ERHALKVQKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNK 255

Query: 359 DVLVPNVWRPLPEFLN------GEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPT 412
            VL  NV++   +++N       E+PYD N+W +S              V+ EGYAE PT
Sbjct: 256 PVLAANVYQ---KYMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPT 312

Query: 413 WRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMA 472
           +R  +A++ D  G  +  + LDGVGG   L +A++ R+G  FP+F F +  ETE F KMA
Sbjct: 313 YRTLMAHMYDASGSQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMA 372

Query: 473 RKLGFRVGGLPHYTLWHIYE 492
           R+L + + GLP+Y ++HI E
Sbjct: 373 RRLEYEIFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  181 bits (459), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 172/355 (48%), Gaps = 61/355 (17%)

Query: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203
           ++ +  YDLN+   +     N++ VLI  P++   E     + +++++TYP ELI++ F+
Sbjct: 94  ENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFI 150

Query: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYL 263
                  D  L+ L A  +++Q+G  ++ F ++                + L+   Q + 
Sbjct: 151 APRTPTGDAALKKLEAAIKKIQSGKKNERFAKI----------------IILRQESQSFD 194

Query: 264 NKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWL 323
              EK                                 DRHA+ VQ  RR  M  +RN L
Sbjct: 195 MLAEK---------------------------------DRHALAVQKQRRSAMALARNEL 221

Query: 324 TANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE------Q 377
             + L P+ SWV W DADI   P +VIQD+ A D  VL  NV++    F N E      +
Sbjct: 222 LFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIR 278

Query: 378 PYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVG 437
           PYD N+W ES              +IVEGYAE  T+R  +A+  DE    SE + LDGVG
Sbjct: 279 PYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVG 338

Query: 438 GVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           G   L +A++ R+G  FP F F +  ETE F KMA++LG+ V GLP+Y ++HI E
Sbjct: 339 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  178 bits (451), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 173/352 (49%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   +PD   N++H+LI  P++   +     + +L+ L YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D+ L+ L +  +++Q    +Q F ++  +        R+N++ + K M++E     
Sbjct: 153 TATGDSALKKLESAIKKVQTDKKTQRFSKITIL--------RQNSQSFDKLMEKE----- 199

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA++VQ  RR  M  +RN L  +
Sbjct: 200 ------------------------------------RHALEVQKERRAAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SWV W DADI   P S+IQDM   +  VL  N+++    F + E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+  D     +E + LDGVGG  
Sbjct: 281 FNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  177 bits (448), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 175/352 (49%), Gaps = 55/352 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           V +YDLN+   + D   N++ VLI  P++   +     + +L+ LTYP +L+++ F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D  L+ L A  ++ Q                     D+KNN+    + K   L + 
Sbjct: 151 SASGDAALKQLEAAVKRAQT--------------------DKKNNR----FGKVTILRQD 186

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
            K F               ++ EK           +RHA+ VQ  RR  M  +RN L  +
Sbjct: 187 SKGFD--------------KLQEK-----------ERHALAVQKERRSAMALARNELLFS 221

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVW-RPLPEFLNGE--QPYDLNS 383
            + P+ SWV W DADI     S+IQDM A +  VL  NV+ R   E  N    +PYD N+
Sbjct: 222 TIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPYDFNN 281

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W +S              +IVEGYAE  T+R  +A+    +G P+E++ LDGVGG   L 
Sbjct: 282 WADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLV 341

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSD 495
           +A++ R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E +D
Sbjct: 342 KAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  178 bits (452), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 173/349 (49%), Gaps = 55/349 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+ T + +   N++ VLI  P++   E     + +L+ LTYP EL+++ F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  DN L  L A  ++ Q                 L+ KD++       ++K   L + 
Sbjct: 212 TTSGDNALRKLEAAVKKTQ-----------------LSKKDQR-------FLKITILRQD 247

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
            ++F                + EK           DRHA++VQ  RR  M  +RN L  +
Sbjct: 248 SQSFD--------------LLKEK-----------DRHALEVQKKRRSAMALARNELLFS 282

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ---PYDLNS 383
            + PY SWV W DADI   P ++IQDM A D  VL  NV++   +   G++   PYD N+
Sbjct: 283 TIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNN 342

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W +S              V+ EGY E  T+R  +A+   E   PS  + LDGVGG   L 
Sbjct: 343 WADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLV 402

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           +A++ R+G  FP+F F +  ETE F KMA++L + + GLP+Y ++HI E
Sbjct: 403 KAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  176 bits (447), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 173/352 (49%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+ T + +   N++ VLI  P+++  +     + +L+ LTYP ELI++ F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               +  LE L A  +++Q G     FG++  +        R+ ++ + K +++E     
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITIL--------RQASQSFDKLLEKE----- 198

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA++VQ  RR  M  +RN L  +
Sbjct: 199 ------------------------------------RHALEVQKERRAAMALARNELLFS 222

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + PY SW+ W DADI   P SVI+DM A +  VL  NV++    + + EQ      PYD
Sbjct: 223 TIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYD 279

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              ++VEGY E  T+R  +A+  ++    +  ++LDGVGG  
Sbjct: 280 YNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGC 339

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A + R+G  FP F F +  ETE F KMA++LG+ V GLP+Y ++HI E
Sbjct: 340 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  176 bits (447), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 165/349 (47%), Gaps = 55/349 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  +DLN+   + D   N++ VLI  PL+   +     +++++ L+YP ELI++ F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPR 153

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  L++L     + Q                     D+KN +              
Sbjct: 154 TQTGDLALQSLEKAVEKTQT--------------------DKKNQR-------------- 179

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                          F  V I  ++          +RHA+ VQ  RR  M  +RN L  +
Sbjct: 180 ---------------FAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFS 224

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPL---PEFLNGEQPYDLNS 383
            + P+ SWV W DADI   P ++IQDM A D  VL  NV++      +  +  +PYD N+
Sbjct: 225 TIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNN 284

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W ES              +IVEGY+E  T+R  +AY  D     SE + LDGVGG   L 
Sbjct: 285 WQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLV 344

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           +A++ R+G  FP+F F +  ETE F KMA++LG+ + GLP+Y ++HI E
Sbjct: 345 KAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  176 bits (446), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 172/352 (48%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + D   N++HVLI  P++   +     + +L+ L+YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D  L+ L    +++Q    +Q F ++  +        R+N++ + K M++E     
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKITIL--------RQNSQSFDKLMEKE----- 199

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA+ VQ  RR  M  +RN L  +
Sbjct: 200 ------------------------------------RHALDVQKERRAAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SW+ W DADI   P S+IQDM   D  VL  N+++    F + E+      PYD
Sbjct: 224 TIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+  + +G P+E + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A + R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 341 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 171/352 (48%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   +PD   N++HVLI  P++   +     + +L+ LTYP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D  L+ L    +++Q    +Q F ++  +        R+N++ + K M++E     
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSKITIM--------RQNSQSFDKLMEKE----- 199

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA+ VQ  RR  M  +RN L  +
Sbjct: 200 ------------------------------------RHALDVQKERRAAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SWV W DADI   P ++IQDM   +  VL  N+++    F + E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+       PS+ + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  175 bits (443), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 167/352 (47%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + D   N++ +LI  P++   +     +++L+ LTYP ELI++ F+   
Sbjct: 94  IAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPR 150

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  L AL A   ++Q+                    D+KN +              
Sbjct: 151 TPTGDQALAALEAAVDKVQS--------------------DKKNQR-------------- 176

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                          F  V I  ++          +RHA++VQ  RR  M  +RN L  +
Sbjct: 177 ---------------FSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALARNELLFS 221

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SWV W DADI   P S+IQDM A D  VL  NV++    + + E+      PYD
Sbjct: 222 TIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQKAIRPYD 278

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +AY  D +   +E + LDGVGG  
Sbjct: 279 FNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGC 338

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 339 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  174 bits (441), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 109/352 (30%), Positives = 170/352 (48%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + +   N++H+LI  P++   +     + +L+ L YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D  L+ L    +++Q    +Q F ++  +        R+N++ + K M++E     
Sbjct: 153 TATGDLALKKLENAIKKVQTDKKTQRFSKITIL--------RQNSQSFDKLMEKE----- 199

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA+ VQ  RR  M  +RN L  +
Sbjct: 200 ------------------------------------RHALDVQKERRAAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SWV W DADI   P S+IQDM   +  +L  N+++    F + E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+  D  G P E + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  172 bits (436), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 169/352 (48%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + D   N++ VLI  P++   +     +++L+ LTYP ELI++ F++  
Sbjct: 94  IAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPR 150

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  L+AL A  +++Q                     D+KN +              
Sbjct: 151 SDSGDAALKALEAAVKKVQT--------------------DKKNQR-------------- 176

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKN---FGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWL 323
                          F  + I  ++   FGQ++ +   +RHA+ VQ  RR  M  +RN L
Sbjct: 177 ---------------FSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNEL 218

Query: 324 TANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ---PYD 380
             + + P+ SWV W DADI   P +VIQDM A D  VL  NV++   +    E+    YD
Sbjct: 219 LFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAYD 278

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGY+E  T+R  +A+  D     +  + LDGVGG  
Sbjct: 279 FNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGC 338

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A + R+G  FP F F +  ETE F KMA++L + V GLP+Y ++H+ E
Sbjct: 339 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  171 bits (434), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 166/352 (47%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + +   N++ VLI  P++   +     + +L++LTYP  LI++ F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            +  D  L+                                                 K+
Sbjct: 153 TASGDAALQ-------------------------------------------------KL 163

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
           E A         DK F  + I  +        G  DRHA++VQ  RR  M  +RN L  +
Sbjct: 164 ESAVREVQTGKQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
            + P+ SW+ W DADI   P +VIQD+ + +  VL  NV++   +F + +Q      PYD
Sbjct: 224 TIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGY+E  T+R  +A+  D  G  + +++LDGVGG  
Sbjct: 281 FNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  F  F F +  ETEAF KMA++LG+ V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  171 bits (433), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 175/352 (49%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + D  ++++HVL+  P++   E     +++L+ L+YP ELI++ F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLY-LKYMKQEYLNK 265
               D  L+ L    + +Q+                    D+KNN+   +  ++QE    
Sbjct: 153 SDAGDAALKKLETAVKNVQS--------------------DKKNNRFSKITILRQE---- 188

Query: 266 VEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTA 325
                     +++DK      + EK           +RH++ VQ  RR  M  +RN L  
Sbjct: 189 ---------SQSFDK------LEEK-----------ERHSLAVQKERRAAMALARNELLF 222

Query: 326 NALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ-----PYD 380
           + L P+ SWV W D+DI   P +VI+ M   D  VL  NV++    F N +Q     PYD
Sbjct: 223 STLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDNDKQQDSIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+  +  GD  E + LDGVGG  
Sbjct: 281 FNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + V GLP++ ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  171 bits (433), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 165/352 (46%), Gaps = 61/352 (17%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + D    ++HVLI  P++   +     + +L+ ++YP  L+++ F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D TL+ L A  + +Q G +                +DR                  
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKV----------------EDR------------------ 178

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                          F  + I  ++       G  +RH++ VQ  RR  M  +RN L  +
Sbjct: 179 ---------------FAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFS 223

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ------PYD 380
           ++ P  SWV W DADI   P +VIQDM   +  VL  NV++    F + E+      PYD
Sbjct: 224 SIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNENSIRPYD 280

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440
            N+W ES              +IVEGYAE  T+R  +A+  D+ G    ++ LDGVGG  
Sbjct: 281 FNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGC 340

Query: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
            L +A++ R+G  FP F F +  ETE F KMA++L + + GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  171 bits (432), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/351 (31%), Positives = 174/351 (49%), Gaps = 59/351 (16%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   +     N++ VLI  P++   +     +++L+ LTYP ELI++ F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPR 155

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               +N L+ L    +++Q+                    D+KN +    + K   L + 
Sbjct: 156 TKTGENALKELEIAIKKVQS--------------------DKKNQR----FAKITILRQD 191

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
            ++F               Q+ EK           DRH++ VQ  RR  M  +RN L  +
Sbjct: 192 SQSFD--------------QLAEK-----------DRHSILVQKERRAAMALARNELLFS 226

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ-----PYDL 381
            L P+ +WV W DADI   P +VIQDM + D  VL  NV++    F N E+     PYD 
Sbjct: 227 TLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIRPYDF 284

Query: 382 NSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSI 441
           N+W ES              +IVEGY+E  T+R  +A+  + +G  ++ ++LDGVGG   
Sbjct: 285 NNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCT 344

Query: 442 LARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           L +A + R+G  FP F F +  ETE F KMA++L + V GLP+Y ++HI E
Sbjct: 345 LVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  169 bits (429), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 168/349 (48%), Gaps = 55/349 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   + +   N++HVLI  P++   +     + +L+ LTYP E  ++ F++  
Sbjct: 97  IAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTELGFILPR 153

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
            S  D  L  L A  +++Q    +Q F ++  +        R+N+  + K M++E     
Sbjct: 154 TSSGDIALSKLEAAVKKVQTDKKNQRFSKITIL--------RQNSAGFDKLMEKE----- 200

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
                                               RHA++VQ  RR  M  +RN L  +
Sbjct: 201 ------------------------------------RHALEVQKERRSAMASARNELLFS 224

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE---QPYDLNS 383
           +L P  SWV W DADI   P ++IQDM + +  VL  NV++   +    +   +PYD N+
Sbjct: 225 SLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNN 284

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W ES              ++VEGY +  T+R  +AY  D  G  +  ++LDGVGG   L 
Sbjct: 285 WQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLV 344

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           +A + R+G  FP F F +  ETE F KMA++L + + GLP+Y ++HI E
Sbjct: 345 KADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  168 bits (425), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 167/352 (47%), Gaps = 55/352 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   +     N++ VLI  P++   E     + +L+ LTYP ELI++ F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPR 153

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  L  L    +++Q                     D+KN +    ++K   L + 
Sbjct: 154 TQSGDVALAKLEEAVKKVQT--------------------DKKNQR----FVKVTILRQD 189

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
            K+F               ++ EK           +RHA+ VQ  RR  M  +RN L  +
Sbjct: 190 SKSFD--------------KLQEK-----------ERHALAVQKERRAAMALARNELLFS 224

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE---QPYDLNS 383
            + P+ SWV W DADI   P ++IQDM A +  VL  NV++   +    E   + YD N+
Sbjct: 225 TIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNN 284

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W ES              +IVEGY+E  T+R  +AY  D  G P   + LDGVGG   L 
Sbjct: 285 WAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLV 344

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSD 495
           +A + R+G  FP F F +  ETE F KMA++L   V GLP+Y ++HI E +D
Sbjct: 345 QADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  163 bits (412), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 166/348 (47%), Gaps = 54/348 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           + +YD+N  T +     N++ VLI  P++   +     +++L++LTYP +L  + F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  ++ L    +++Q+G  +Q                        +++K   L + 
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQ------------------------RFLKITILRQD 187

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
            ++F               ++ EK           +RHA  VQ  RR  M  +RN L  +
Sbjct: 188 SQSFN--------------KLDEK-----------ERHAFNVQKERRAAMALARNELVFS 222

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE--QPYDLNSW 384
            + P  SW+ W DADI   P +VIQDM A D  +L  NV++   +  N E  +PYD N+W
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNW 282

Query: 385 MESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILAR 444
            ES              +IVE Y E  T+R  +A + D  G PS  + LDGVGG   L +
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 445 AKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYE 492
           A++ R+G  FP F F +  ETE F  MA++L + V GLP+Y ++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  155 bits (392), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 97/346 (28%), Positives = 167/346 (48%), Gaps = 54/346 (15%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   S +   N++HVLI  PL+  E+     + +L+ L+YP + I++ F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D++L+ L +  +++Q       F ++  +        R+N+K +    +++ ++++
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKITIL--------RQNSKGFETVPEKKEVSEI 211

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
           E          Y+K  R+                               M  +RN L A+
Sbjct: 212 E----------YEKQIRAE------------------------------MALARNELLAS 231

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE---QPYDLNS 383
            L P  +W+ W D+DI   P S+IQDM   D  VL  NV+    +  +GE   +PYD  +
Sbjct: 232 TLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRN 291

Query: 384 WMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILA 443
           W+ES              +IVEG A   T R  + +   ++G PS  + LDGVG   +L 
Sbjct: 292 WIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLV 351

Query: 444 RAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWH 489
           ++++ R+G  FP F F +  E+E F KMA++L + V GLP+Y ++H
Sbjct: 352 KSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  154 bits (389), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/350 (30%), Positives = 161/350 (46%), Gaps = 58/350 (16%)

Query: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203
           D  ++ YDLN    +     N + VLI  P++   +     + +L+ LTYP + I + FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYL 263
           +   S  +  L       R+L+                                      
Sbjct: 148 LPRTSSGNTAL-------RKLEKA------------------------------------ 164

Query: 264 NKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWL 323
             V K  T P     D+ F  + I  ++F        S RH   VQ  RR  M  +RN L
Sbjct: 165 --VRKVQTGPK----DQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNEL 218

Query: 324 TANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE---QPYD 380
             + + PY SWV W D+DI   P ++I+DM + +  +L  NV++   E  NGE   + YD
Sbjct: 219 LFSTIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYD 276

Query: 381 LNSWMESPXXXXXXXXXXXXXVIVEGYA-EYPTWRVHLAYIRDEEGDPSEVVDLDGVGGV 439
           LN+W ES              +IVEGY  E+ T+R  +A++  ++    E++ LDGVGG 
Sbjct: 277 LNNWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGG 336

Query: 440 SILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWH 489
             L +A++ R+G  FP F F +  ETE F KMA++L + + GLP+Y ++H
Sbjct: 337 CTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  138 bits (348), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/344 (26%), Positives = 162/344 (47%), Gaps = 47/344 (13%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  YDLN+   S +   N++HVLI  PL+  +E     +++L+NL+YP +LI++ F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 207 CSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKV 266
               D  L       +QL+N         +  +   L +          K+ K   L + 
Sbjct: 159 TKKGDQIL-------KQLENAV-----KNVQGIDKKLGSN---------KFAKITILRQK 197

Query: 267 EKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTAN 326
           +  F   +++  DK                     + + ++++  +R  M  +RN L ++
Sbjct: 198 DSGFHK-FNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSS 236

Query: 327 ALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGE--QPYDLNSW 384
            L    +W+ W D+++   P ++IQDM   D  VL  NV+       +    +PYD  +W
Sbjct: 237 TLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNW 296

Query: 385 MESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILAR 444
           +ES              +IVEG A   T R  +    + +G P+E + LDG+G    L +
Sbjct: 297 IESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVK 356

Query: 445 AKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLW 488
           +++ R+G  FP F F +  E+E F KMA++L + V GLP+Y ++
Sbjct: 357 SEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 82/178 (46%), Gaps = 9/178 (5%)

Query: 313 RKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEF 372
           RK +   +N L  + L PY SWV W D+ I   P +++QD+      +L  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 373 LNGEQPYD---LNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIRDEEGDPSE 429
            N +   D   LN+W+ S              V++EG +   T R  +    D       
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 430 VVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTL 487
            ++LD V     L +A++ R+G  FP F F +  ETE F +MAR L  +  GLP+Y +
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 147 VQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSD 206
           +  Y+LNE   SPD E + +H+L+ +PL +        F++L  LTYP +LID+  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 207 CSDDDNTLEAL 217
             +    L+AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 83/208 (39%), Gaps = 31/208 (14%)

Query: 302 DRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVL 361
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    +++
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 362 VPNVWRPLPEFLNGEQPYDLNSWMESPXXXXXXXXXXXXXVIVEGYAEYPTWRVHLAYIR 421
           VP + R     +  ++ YD N+W+                   E Y   P       +++
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNY----ESYVPRPV-NGKTKFLQ 476

Query: 422 D----------EEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTF----------EN 461
           D           E     VV+LD VGG  +    K+F  G+QFP F             +
Sbjct: 477 DCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYD 536

Query: 462 HAETEAFGKMARKLGFRVGGLPHYTLWH 489
             ETE     A+ LG++  G+P+    H
Sbjct: 537 GVETEGLCYQAKTLGYKCYGVPNVICRH 564

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 56  STVSLSRYLRGPA-SINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGV 114
           S+ SL++Y+  P  S++++ +K   G  N++ V       YNY++    PH     D+ +
Sbjct: 4   SSRSLTQYIPSPMESLSRLKRK---GVDNFQKVKKSGKSIYNYNYSKFVPHSFSAIDENI 60

Query: 115 QHYLISEFGNDVLTPKDQERYEAEVKQ 141
           +H   SE  ND +      R E +V +
Sbjct: 61  KH---SENDNDDVLEIIGSRKEKKVSK 84

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 430 VVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWH 489
           V++L+G G   I  +A LFR      A  ++N  ++  FG    + GF  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 490 IYE 492
           IYE
Sbjct: 272 IYE 274

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 11/89 (12%)

Query: 56  STVSLSRYLRGP-ASINKILKKLESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGV 114
           S+ SL++Y+  P  S++++ +K   G  N++ V       YNY++    PH     D+ V
Sbjct: 5   SSKSLTQYIPSPMGSLSRLKQK---GVDNFQKVKKSGKSIYNYNYSKFVPHPFSTIDESV 61

Query: 115 QHYLISEFGN----DVLTPKDQERYEAEV 139
           +H   SE G     +++ P  ++   + V
Sbjct: 62  KH---SESGRYDDLEIIRPTKEKEVTSSV 87

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 186 KHLMNLTYP-HELIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTD 241
           KH+ +L    ++++D   L+S  +D DN  +A+IAY   +Q     QI   +D +T+
Sbjct: 754 KHITDLKVNMNKVVDTGALISKQTDKDNQKKAIIAYENSIQ-----QIRNNLDQITE 805

>SAKL0G06094g Chr7 (498322..508107) [9786 bp, 3261 aa] {ON} similar
           to uniprot|Q7LIK7 Saccharomyces cerevisiae YDR457W TOM1
           Temperature dependent Organization in Mitotic nucleus
          Length = 3261

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 12/111 (10%)

Query: 141 QLFDSTVQRYDLNEFTGSPDGETNRDHVLICVP-LRDAEEVLPLMFKHLMNLTYPHELID 199
           +L   + Q + +++     + + +RD + I +P L   +E+L  M +     TY ++ +D
Sbjct: 25  ELLQCSTQEF-VSKLVNIVEWDRSRDDLFIWIPILNRIDEILNKMVE-----TYSYKFVD 78

Query: 200 VAF----LVSDCSDDDNTLEALIAYSRQLQNGTLSQ-IFGEMDAVTDYLNA 245
           +      LV     D+NT  ALI+++ +L N T ++ I+  +D +   LN 
Sbjct: 79  LTNQPVKLVEMSPTDENTAVALISFTCRLLNNTCNRSIYSSIDVMDHMLNC 129

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
           YML002W
          Length = 1107

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 130 KDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLM 189
           K    Y  +V  +F +      LN  TG    +T RD+ L  +PL DA+ ++ L    L 
Sbjct: 337 KSANSYSKKVDVIFKT------LNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLC 390

Query: 190 NLTYPHELIDVAFLVSDCSDDD-----------NTLEALIAYSRQLQNGTLSQI-FGEMD 237
                   + V +L S   D++           +T+EA ++Y  +L N   S+I   ++ 
Sbjct: 391 RAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLS 450

Query: 238 AVTDYL 243
            + D+L
Sbjct: 451 LLEDFL 456

>Kwal_47.17621 s47 (486476..490816) [4341 bp, 1446 aa] {ON} YLR320W
           (MMS22) -  [contig 206] FULL
          Length = 1446

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 321 NWLTANALKPYHSWVYWR---DADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ 377
           NW  A     Y S V W    +  I++C   V  D++   YD+L    ++   E L  E+
Sbjct: 756 NWQIAEVENSYSSMVEWLAFIEFAIQVCEWKVNTDLLMSFYDILKSRKFQDFDEELTNEE 815

Query: 378 P 378
           P
Sbjct: 816 P 816

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,174,730
Number of extensions: 2554338
Number of successful extensions: 7196
Number of sequences better than 10.0: 85
Number of HSP's gapped: 7363
Number of HSP's successfully gapped: 130
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)