Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034108.838ON52652621140.0
TDEL0B005908.838ON5413812951e-27
KAFR0A028208.838ON4533032701e-24
NCAS0B003108.838ON5643892641e-23
ZYRO0G14146g8.838ON5073742551e-22
Kpol_1068.108.838ON6173162525e-22
NDAI0E003008.838ON6644652383e-20
Suva_13.298.838ON5093972231e-18
YML114C (TAF8)8.838ON5103952185e-18
Skud_13.278.838ON5143962177e-18
SAKL0D01518g8.838ON5743242081e-16
ABL128W8.838ON4743201991e-15
Smik_13.208.838ON5103291982e-15
Ecym_46098.838ON5203321929e-15
Kwal_27.102728.838ON5513281921e-14
KLTH0C03916g8.838ON5703801803e-13
TPHA0I002308.838ON6142831697e-12
TBLA0D032508.838ON6833561563e-10
KLLA0D01617g8.838ON5623341536e-10
CAGL0B02299g8.838ON6431901367e-08
KNAG0H02030singletonON632110741.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03410
         (526 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   818   0.0  
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   118   1e-27
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   108   1e-24
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   106   1e-23
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   102   1e-22
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   101   5e-22
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...    96   3e-20
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...    91   1e-18
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...    89   5e-18
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...    88   7e-18
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...    85   1e-16
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...    81   1e-15
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...    81   2e-15
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...    79   9e-15
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...    79   1e-14
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...    74   3e-13
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...    70   7e-12
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...    65   3e-10
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...    64   6e-10
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    57   7e-08
KNAG0H02030 Chr8 complement(361381..363279) [1899 bp, 632 aa] {O...    33   1.8  

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/526 (79%), Positives = 416/526 (79%)

Query: 1   MSDWESDEKSGVKGALVGDVSAPVELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXX 60
           MSDWESDEKSGVKGALVGDVSAPVELPHEPWDARVDQMLANSVAFQMS            
Sbjct: 1   MSDWESDEKSGVKGALVGDVSAPVELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGV 60

Query: 61  XXXXXXFXXXXXXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQM 120
                 F           SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQM
Sbjct: 61  GMAGQAFQLLLQLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQM 120

Query: 121 YLSKKIGYNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIP 180
           YLSKKIGYNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIP
Sbjct: 121 YLSKKIGYNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIP 180

Query: 181 AWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDE 240
           AWLPKLPPNHTYKFTTEYNKLLNDEKVL            VSLSNLVRNCDRDADTKVDE
Sbjct: 181 AWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDE 240

Query: 241 RARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKL 300
           RARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKL
Sbjct: 241 RARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKL 300

Query: 301 ARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAAA 360
           ARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAAA
Sbjct: 301 ARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAAA 360

Query: 361 IAHAVEQRDAKLAELRAKLKETTPSATKPFQXXXXXXXXXXXXXXXXXXEVALFEELXXX 420
           IAHAVEQRDAKLAELRAKLKETTPSATKPFQ                  EVALFEEL   
Sbjct: 361 IAHAVEQRDAKLAELRAKLKETTPSATKPFQGMDINIGGGGDDDAVDDDEVALFEELSGS 420

Query: 421 XXXXXXXXIETVTKTTNLPNTQGNPMAGPRLXXXXXXXXXXXXXXXXXXXXPMPGTAEKP 480
                   IETVTKTTNLPNTQGNPMAGPRL                    PMPGTAEKP
Sbjct: 421 SDDDDDGGIETVTKTTNLPNTQGNPMAGPRLAVVVPEEPSAPASASEVPSEPMPGTAEKP 480

Query: 481 EEHDAKENXXXXXXXXXXXXXXXXXXXXEGSETDRPIAQAAPSSSE 526
           EEHDAKEN                    EGSETDRPIAQAAPSSSE
Sbjct: 481 EEHDAKENATASASPAAHPATDPAATAPEGSETDRPIAQAAPSSSE 526

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 167/381 (43%), Gaps = 64/381 (16%)

Query: 25  ELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXSGMVTE 84
           E+ H   +A V ++L+ +VA Q+                   F           + M+ +
Sbjct: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFA--------FEHLMILIDDQLNDMIGQ 71

Query: 85  LHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQ----MYLSKKIG--YNRMQVPREQT 138
           LHR + VQRR+     DV L LQG+ LTP D+++Q     Y SK  G  ++ +   +E  
Sbjct: 72  LHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKET- 130

Query: 139 VQLQDATGSYDRFKLVENQQLIASGLSGS-DMSQEL-----PIAEKIPAWLPKLPPNHTY 192
               DA    D               +GS D+  EL     P+   IP W+P  PP+HTY
Sbjct: 131 --FTDAVVDED---------------NGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTY 173

Query: 193 KFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCD-----RDADTKVDERARETPP 247
           KFT +YN+ + DE ++            V+L +L++N +      DAD    + A     
Sbjct: 174 KFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEA----- 228

Query: 248 EELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQR 307
                + +E  A+YG  E+   +     +        + +F ++ Y+  RV++AR  V  
Sbjct: 229 ----LVREETAAIYGN-EQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVE 283

Query: 308 FEWETKYRPRNPFLCSHRAVPENS----------KKVYSMLENSLNELVQVDLPRLESRK 357
           +E       RNPF+   +    NS          ++++SML+ SL  L++  +P L+  K
Sbjct: 284 YEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIK-SIPELQMTK 342

Query: 358 AAAIAHAVEQRDAKLAELRAK 378
             A   A ++RD +L ELR K
Sbjct: 343 QDARRKAEQKRDERLQELRDK 363

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  108 bits (270), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 143/303 (47%), Gaps = 28/303 (9%)

Query: 79  SGMVTELHRIATVQRRQ-HATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQ 137
           + ++ +L R++ +QRR  +AT  D+ LLL+GF L+  ++  ++ +S  I     ++  E 
Sbjct: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIK----RLYSED 119

Query: 138 TVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQEL----PIAEKIPAWLPKLPPNHTYK 193
             +L + +  Y       NQ     G   +   Q L    P+ + IP+W P LPP+HTYK
Sbjct: 120 EKKLSEDSIHY-------NQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYK 172

Query: 194 FTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARETPPEELKRI 253
           FT +YN  +ND K++             +L NL+   + +     +ER      E L ++
Sbjct: 173 FTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKIESN-----EERNDLHYDETLAKL 227

Query: 254 DDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETK 313
           + +  AL+G +EE    ++       + +     FD++ YS  RV +ARN V +FE +  
Sbjct: 228 ESQ--ALFGTVEEKMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKML 285

Query: 314 YRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAAAIAHAVEQRDAKLA 373
               NPF+     +  +   V S L  S   ++   +P L   K  AI  A  +RD ++ 
Sbjct: 286 ALKYNPFIN----LINDQTDVKSYLNRSFQLMIN-SIPELTLEKKKAIRQAEIERDERIN 340

Query: 374 ELR 376
            LR
Sbjct: 341 RLR 343

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 94/389 (24%), Positives = 172/389 (44%), Gaps = 51/389 (13%)

Query: 16  LVGDVSAPVELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXX 75
           L+ +++ P E+P    D +V ++L  S+A Q+                   F        
Sbjct: 29  LMNELTNPTEIPSNSSDEQVRKLLNKSIALQL--------KPLNLELSQLAFNELSLLVN 80

Query: 76  XXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPR 135
                +++ELHR++ +QRR  A   D+ LLL+G  L   ++  Q+ +S    + + +  +
Sbjct: 81  DQLDFLISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVS---NFMKSKNGK 137

Query: 136 EQTVQLQDATGSYDRFKLVEN--QQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYK 193
           +    ++D++  +D    + N     + +  S   +    P    IP WLP  PP+HTYK
Sbjct: 138 DYDTLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYK 197

Query: 194 FTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARETPPEELKRI 253
           FT ++NK + D+ ++             SL NL+ +    +  + +E +      EL R 
Sbjct: 198 FTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETS--NFDSELAR- 254

Query: 254 DDEIVALYGPLEEIAERHEGPRTKRRTPLYL----------------KKSFDVQAYSLGR 297
            +E +A+YG        ++    K+R P +L                 K F+V  Y+  R
Sbjct: 255 -EENIAIYG--------YDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFR 305

Query: 298 VKLARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSM-----LENSLN---ELVQVD 349
           V+L R  V+ FE E     +NPFL   R +  N KKV        ++NSL    + +  +
Sbjct: 306 VELTRKRVEEFELEQLKWEKNPFLRLSRMI--NDKKVSRSDLKLEIKNSLQRSYKSIFRN 363

Query: 350 LPRLESRKAAAIAHAVEQRDAKLAELRAK 378
            P+L+  +   +  A ++R+ K+ +L+ +
Sbjct: 364 YPKLKQERDRRLELARQKREEKIEKLKIQ 392

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 165/374 (44%), Gaps = 38/374 (10%)

Query: 25  ELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXSGMVTE 84
           EL HE  +  V ++LA SVA Q+                   F           + M+++
Sbjct: 15  ELQHEDREPNVVKVLAKSVALQLKPMNAQITQFA--------FDRLLQLVDGQLNDMISQ 66

Query: 85  LHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIG------YNRMQVPREQT 138
           LHR++ +QRR+     D+++L++GF ++P  IE Q  +S+         +N +   R+  
Sbjct: 67  LHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRDLQ 126

Query: 139 VQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYKFTTEY 198
             L      +      E+Q+ +   +S   +    P+ + +P WLP  PP+HTYKFT +Y
Sbjct: 127 SSLAHEMVPF------EDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQY 180

Query: 199 NKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARETPPEELKRIDDEIV 258
           +  + DE  +            ++LS+L +  +   D       R     EL   + E +
Sbjct: 181 SHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIV----NRSQYDSELA--EQETL 234

Query: 259 ALYGP-LEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETKYRPR 317
           A+YG  L++   +H    +        + +F V+ Y+  R+++AR  V  FE       +
Sbjct: 235 AIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQ 294

Query: 318 NPFL---------CSHRAVPENSKKVYSM-LENSLNELVQVDLPRLESRKAAAIAHAVEQ 367
           +PFL         C+ +   +   + + + L+ S   LV+  +P LE  K      A E+
Sbjct: 295 DPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVK-SIPELERNKLETEEKAKEE 353

Query: 368 RDAKLAELRAKLKE 381
           R  +L ELRA+ +E
Sbjct: 354 RSKRLQELRAQREE 367

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 134/316 (42%), Gaps = 29/316 (9%)

Query: 24  VELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXSGMVT 83
            E  +E  +  ++++LA +VA Q+                   F             MV 
Sbjct: 18  TEYKYEETEPAIEKILAKAVALQL------KSMNCDTSITKFAFEHLMSLVVGQIDDMVL 71

Query: 84  ELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQ----MYLSKKIGYNRMQVPREQTV 139
           ELHR++++QRR      D+++ L+GF LTPED+EEQ     YLSK    +   + +    
Sbjct: 72  ELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLTK-IAT 130

Query: 140 QLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYKFTTEYN 199
                  +Y +  L       A       +S   P+ + IP+WLP  PP++TYKFT +YN
Sbjct: 131 TTTRTLSTYQKLDLTHKDTSTAQTSKLVPISN--PLQKLIPSWLPDFPPDYTYKFTPQYN 188

Query: 200 KLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARETPPEELKRIDDEIVA 259
             + DE ++             +L NL+R    D  +    R  +    E++   +E +A
Sbjct: 189 TPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRIS----RDLKFSSSEMELATEETLA 244

Query: 260 LYGPLEEIAERHEGPRTKRRTPLY----LKKSFDVQAYSLGRVKLARNAVQRFEWETKYR 315
            Y  +          R K  T  +    ++ S +V+ Y+  RV++ R  V  +E      
Sbjct: 245 TYSAI--------TLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQI 296

Query: 316 PRNPFLCSHRAVPENS 331
            RNPFL   R +  N+
Sbjct: 297 QRNPFLKISRLISANN 312

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 102/465 (21%), Positives = 178/465 (38%), Gaps = 117/465 (25%)

Query: 17  VGDVSAPVELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXXX 76
           + +V  P E+ H   D +++++L  S+A Q+                   F         
Sbjct: 12  MNEVQPPREIAHNHMDMQIEKLLQKSIAIQL--------KAFKVDFSKLAFNQLTLLVDD 63

Query: 77  XXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIGYNRMQ 132
             + ++TELHR++ +QRR      D+ L ++GF + P D+    E   Y+ +K+     +
Sbjct: 64  QLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYR 123

Query: 133 VPRE-------QTVQLQDATGSYDRFKLVENQQLIASGLSGSDM--SQELPI-AEKIPAW 182
           + R+       Q   + +++ S D + L +  + I+     S++      P     I +W
Sbjct: 124 ILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSW 183

Query: 183 LPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNC------------ 230
           LP  PP+HTYKFT ++N  + DEK++             +L N ++N             
Sbjct: 184 LPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPM 243

Query: 231 ---------------DRDADTKVDERARETPPEEL----KRID-----DEIVALYGPLEE 266
                          D D + K  +  +E   E+     K ID     +E +A+YG    
Sbjct: 244 TIPPSPSLSNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTK-- 301

Query: 267 IAERHEGPRTKRRTPLYLK----------------KSFDVQAYSLGRVKLARNAVQRFEW 310
            ++ +E  R     P  +                 K FDV  YS  RV+L R  V+ FE 
Sbjct: 302 -SQSYEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFEN 360

Query: 311 ETKYRPRNPFL------CSH---------------------------------RAVPENS 331
           +     +NPFL      C                                   R   + +
Sbjct: 361 KKLRLEKNPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQIN 420

Query: 332 KKVYSMLENSLNELVQVDLPRLESRKAAAIAHAVEQRDAKLAELR 376
            ++ S L+ S   ++  + P+L+  K   +  A+E+RD +L ELR
Sbjct: 421 NEIISNLKRSFYSILN-NYPKLKKAKKQRVKLAIEKRDQRLQELR 464

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 104/397 (26%), Positives = 158/397 (39%), Gaps = 57/397 (14%)

Query: 1   MSDWESDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXX 58
           M+    +  SG    +V   + P   E+ H   DA V ++L  SV FQ++          
Sbjct: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60

Query: 59  XXXXXXXXFXXXXXXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEE 118
                                GM   LH +A +QRR   +  D+ LL + F L    + +
Sbjct: 61  --------LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQ 112

Query: 119 QMYLSKKIGYNRMQVPREQTVQLQDATG--------SYDRFKLVENQQLIASGLSGSDMS 170
           Q+ +S+ I  ++  V  E+ V+    T           +   + E Q  I   L  S+  
Sbjct: 113 QLQISEHIK-SKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSN-- 169

Query: 171 QELPIAEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNC 230
              P+ + IP+WLP  PP+HTYKFT E+N  + D K +             +L NL +  
Sbjct: 170 ---PLEKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRL 226

Query: 231 DRDADTKVDERARETPPEELKRIDDEIVALYGPLEEIAERHE--GPRTKRRTPLYLKKSF 288
            R +       A  TP   L    D            +ER E  G     R P  + KSF
Sbjct: 227 FRISS------ASHTPSPRLPDASDA-----------SERLEIWGNTLHERKPAIIAKSF 269

Query: 289 ---DVQAYSLGRVKLARNAVQRFEWETKYRPRNPFLCSHRAV-----PENSKKVYS---- 336
              +++ Y+  R++LAR  V +FE     R +NPFL    ++     P  S KV      
Sbjct: 270 NEKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSID 329

Query: 337 -MLENSLNELVQVDLPRLESRKAAAIAHAVEQRDAKL 372
             L  S+  L   +LP+++  K   I  A E+R   L
Sbjct: 330 LQLRKSVT-LFMHNLPKVQKLKKEKIQLAKEERQKSL 365

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 99/395 (25%), Positives = 163/395 (41%), Gaps = 52/395 (13%)

Query: 1   MSDWESDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXX 58
           M+   S+  +G +  +V   + P   E+ H   DA V ++L  +V FQ++          
Sbjct: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 59  XXXXXXXXFXXXXXXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEE 118
                                GM   LH +  +QRR  A+  D+ LLL+ F L    + +
Sbjct: 61  --------LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQ 112

Query: 119 QMYLSKKIG------YNRMQVPREQTVQLQDATGSYDRFKLVENQQL-IASGLSGSDMSQ 171
           Q   S+ I       Y ++           +     D    +E QQ  I   L  S+   
Sbjct: 113 QFQASEFIKSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSN--- 169

Query: 172 ELPIAEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCD 231
             P+ ++IP+WLP  PP+HTYKFT E+N  + D K +             +L NL ++  
Sbjct: 170 --PLEKQIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLS 227

Query: 232 RDADTKVDERARETPPEELKRIDDEIVALYGPLEEIAERHE--GPRTKRRTPLYLKKSF- 288
             +       A  TP  +   +DDE        + I ++ E  G   + R P   +KSF 
Sbjct: 228 HISS------ASNTP--QPPGLDDE--------DAIEQQLEIWGNALEERKPTITEKSFN 271

Query: 289 --DVQAYSLGRVKLARNAVQRFEWETKYRPRNPFLCSHRA--VPENSKKVYSMLENSLN- 343
             +++ Y+  RV+LAR  V +FE     R +NPFL       +PE+  + +  ++ ++  
Sbjct: 272 ENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIEL 331

Query: 344 ------ELVQVDLPRLESRKAAAIAHAVEQRDAKL 372
                  L   +LP+++  K   I  A E+R   L
Sbjct: 332 QFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSL 366

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 99/396 (25%), Positives = 160/396 (40%), Gaps = 54/396 (13%)

Query: 1   MSDWESDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXX 58
           M+   S+   G +  LV   + P   E+ H   DA V ++L  +V FQ++          
Sbjct: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60

Query: 59  XXXXXXXXFXXXXXXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEE 118
                                GM   LH +A +QRR  AT  D+ LL + F L P  + +
Sbjct: 61  --------LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQ 112

Query: 119 QMYLSKKIG------YNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQE 172
           Q+ +S+ I       Y ++      +    +     D    +E QQ   S L    +   
Sbjct: 113 QLQISEFIKSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVL----LPPS 168

Query: 173 LPIAEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDR 232
            P+ + +P+WLP  PP+HTY+FT E+N  + D K +             +L NL +    
Sbjct: 169 NPLEKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRL-- 226

Query: 233 DADTKVDERARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSF---D 289
                +   +   PP    R+ D+  A    LE         + ++RT   + KSF   +
Sbjct: 227 ---LHISLASHAPPP----RLPDDADAGEQQLEIWG---NALQEEKRTA--ISKSFNENN 274

Query: 290 VQAYSLGRVKLARNAVQRFEWETKYRPRNPFL-------------CSHRAVPENSKKVYS 336
           ++ Y+  RV+LAR  V +FE     R +NPFL               HRA+    + +  
Sbjct: 275 IEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAI---QRAIDL 331

Query: 337 MLENSLNELVQVDLPRLESRKAAAIAHAVEQRDAKL 372
               S+  L   +LP+++  K   I  A+E+R   L
Sbjct: 332 QFRKSM-MLFAHNLPKVQKLKKEKIRMAIEERSRSL 366

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 155/324 (47%), Gaps = 41/324 (12%)

Query: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYN---RMQVPR 135
           S M+T LHR   +QRR+  +  D+ LLL+G+ L+  ++  ++  S+ I  N   ++    
Sbjct: 77  SFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136

Query: 136 EQTVQLQDATGSYDRFKLVENQQLIASGLS-----GSDMSQELPIAEK----IPAWLPKL 186
           +++ +L+         K +  ++L+ S  S       D+   +P   K    IP WLP+ 
Sbjct: 137 QKSKELKSKL-----LKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEF 191

Query: 187 PPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDR-DADTKVDERARET 245
           PP+HTY+FT++YNK + DE+ L             +L NL+++ D  + D   +ER  + 
Sbjct: 192 PPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKR 251

Query: 246 PPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRT-PLYLKKSFDVQAYSLGRVKLARNA 304
              E     +E   ++GP  + +   E      RT PL   K+F V+ Y+  RV++AR  
Sbjct: 252 SLYE--ETQEETFLIFGPERKKSHTTENSHELLRTLPL---KNFSVEEYARNRVEIARRK 306

Query: 305 VQRFEWETKYRPRNPF-----LC--------SHRAVPENSKKVYSMLENSLNELVQVDLP 351
           V  +E       +NPF     LC        S +A+    K++ SML+ S   L++  +P
Sbjct: 307 VLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAI---DKELKSMLQRSYIGLLR-SVP 362

Query: 352 RLESRKAAAIAHAVEQRDAKLAEL 375
           +L   KA     A E+R   L +L
Sbjct: 363 KLNEVKARERELANERRREMLEKL 386

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 135/320 (42%), Gaps = 47/320 (14%)

Query: 81  MVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQ--- 137
           M+  LHR A VQRR   +  DV L L G  +  E + E+        Y R Q  R+Q   
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEE--------YVRSQYVRQQHAG 127

Query: 138 ---TVQLQDATGSYDRFKLVENQQLIASG-----LSGSDMSQELPIAEK----IPAWLPK 185
              +++ Q A+      + +  ++L++S          D+   +P        +P WLP+
Sbjct: 128 AVRSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPE 187

Query: 186 LPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARET 245
            PP+HTYKFT+ YN+ + DE+ +             +L +++        TK        
Sbjct: 188 FPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTA-----TKKPRADDAQ 242

Query: 246 PPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAV 305
            P+ +     E + +YGP          P           + F+++ Y+  RV+LAR  V
Sbjct: 243 LPQIISDGQQENLLIYGPERRRLAPEPAP----------TRGFNIEDYARCRVELARRRV 292

Query: 306 QRFEWETKYRPRNPFL-----CSHRAVPENSKKV----YSMLENSLNELVQVDLPRLESR 356
           + FE +     +NPF+     CS  A    S+K     + +L +     V   +PRL   
Sbjct: 293 EEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRT 352

Query: 357 KAAAIAHAVEQRDAKLAELR 376
           KA  +A A E+  A+   +R
Sbjct: 353 KARELAAAYERERARQESMR 372

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 137/329 (41%), Gaps = 41/329 (12%)

Query: 6   SDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXX 63
           S  +SG +  +V     P   E+ H   DA V ++L  +V FQ++               
Sbjct: 6   SGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA----- 60

Query: 64  XXXFXXXXXXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLS 123
                           GM   LH +  +QRR  A+  D+ LL + F +    + +Q  +S
Sbjct: 61  ---LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVS 117

Query: 124 KKIGYNRMQVPREQTVQL-------QDATGSYDRFKLVENQQL-IASGLSGSDMSQELPI 175
           + I  N   V   + V+L        +     D    +E QQ  I   L  S+     P+
Sbjct: 118 EFIKSNHA-VEYGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSN-----PL 171

Query: 176 AEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDAD 235
            + IP+WLP  PP+HTYKFT E+N  + D K +             +L NL +       
Sbjct: 172 EKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRL----- 226

Query: 236 TKVDERARETPPEELKRID--DEIVALYG-PLEEIAERHEGPRTKRRTPLYLKKSFDVQA 292
           + +   +  +PP  L   D  ++ + ++G  L+E        R    T   L +S +++ 
Sbjct: 227 SHLSSASHTSPPPVLDDADATEQQLEIWGNALQE--------RKPTITATSLNES-NIEQ 277

Query: 293 YSLGRVKLARNAVQRFEWETKYRPRNPFL 321
           Y+  RV+LAR  V +FE     R +NPFL
Sbjct: 278 YAKYRVELARERVAKFELNQLKRTKNPFL 306

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 145/332 (43%), Gaps = 41/332 (12%)

Query: 81  MVTELHRIATVQRRQHATHDDVALLLQG----FQLTPEDIEEQMYLSKKIGYNRMQVPRE 136
           M   LHR A +QRR   +  D+ L L+G     Q   ++ E+  Y+ K        + R 
Sbjct: 76  MFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER- 134

Query: 137 QTVQLQDATGSYDRFKLVENQQLIASG-----LSGSDMSQELPIAE----KIPAWLPKLP 187
           Q++ L +        K + +++L++S          D+   +P        +P WLP+ P
Sbjct: 135 QSLDLVEKWQ-----KPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFP 189

Query: 188 PNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERARETPP 247
           P+HTYKFT  YNK ++DE+ +             +L N++ +         DE   ET  
Sbjct: 190 PDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDE---ETIA 246

Query: 248 EELKRIDDEIVALYGPLEEIAERHE----GPRTKRRTPLYLK----KSFDVQAYSLGRVK 299
           +  K   +E   +YG +E+   R E    G  +     L L     K F++Q Y+  R+ 
Sbjct: 247 QTYKESQEETQLIYG-VEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIG 305

Query: 300 LARNAVQRFEWETKYRPRNPF-----LCS-----HRAVPENSKKVYSMLENSLNELVQVD 349
           LAR  V+ FE       +NPF     +CS      +   + +++ +++L       V   
Sbjct: 306 LARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKS 365

Query: 350 LPRLESRKAAAIAHAVEQRDAKLAELRAKLKE 381
           +P+L   KA  +A A+E+   K  E   +L++
Sbjct: 366 IPKLRQLKANEMAAAIERERIKQKEREMELEK 397

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 154/328 (46%), Gaps = 50/328 (15%)

Query: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQT 138
           S M+ +LH++A +QRR   +  D+ L+++G+ L+  D+  ++  S+ +    +    EQ 
Sbjct: 77  SNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHL----EQI 132

Query: 139 VQLQDATGSYDRFK---LVENQQLIASG----LSGSDMSQELPIAEK----IPAWLPKLP 187
            ++++ +   ++ +   L +N+ L ++     +   D+   +P + K    +P WLP  P
Sbjct: 133 KKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFP 192

Query: 188 PNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNL-------VRNCDRDADTKVDE 240
           P+HTY+FT +YNK + DE+++             +L +L         +   D+DT  +E
Sbjct: 193 PDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEE 252

Query: 241 RARETPPEELKRIDDEIVALYGPL--EEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRV 298
             +ET              L+GP+  ++ A  +E     R  P   +++F V+ Y+  RV
Sbjct: 253 AQQETQ------------LLFGPVKKKKTAAINEVNDLLRTLP---QQNFSVEEYARNRV 297

Query: 299 KLARNAVQRFEWETKYRPRNPFL-CSHRAVPENSKK---------VYSMLENSLNELVQV 348
           ++AR  V  +E       +  F+  +H   P + K+         + ++L  S   L++ 
Sbjct: 298 EIARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLK- 356

Query: 349 DLPRLESRKAAAIAHAVEQRDAKLAELR 376
             P L+ R+   IA A E R  +  +LR
Sbjct: 357 SAPSLKERRKREIALAEENRRLRDEKLR 384

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/380 (21%), Positives = 171/380 (45%), Gaps = 30/380 (7%)

Query: 12  VKGALVGDVSAPVELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXX 71
           +KG  +  +    E+P    D  + ++L  +VA Q+                   F    
Sbjct: 16  LKGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFA------FENLI 69

Query: 72  XXXXXXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKI---GY 128
                  S M+ +LH++  +QRR   +  D+ L++ G+ LT  D+  ++  S+ +     
Sbjct: 70  ILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNL 129

Query: 129 NRMQVPREQT--VQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEK----IPAW 182
            R++  RE++  V+ ++ T   ++ +L+E++ L    +   ++   +P   K    +P W
Sbjct: 130 ERVRKVREESEVVEAKEKTPLSEK-ELLESKHL-EFFIQDKEILTLVPPTPKNTKYVPRW 187

Query: 183 LPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDRDADTKVDERA 242
           LP+ PP+HTY+FT+++N+ + DE+++             +L +L +    ++ ++  +  
Sbjct: 188 LPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSD 247

Query: 243 RETPPEELKRIDDEIVALYGPLE--EIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKL 300
                E  K    +   ++GP +  +IA  +      R  P   +++++V+ Y+  RV++
Sbjct: 248 -----EIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLP---QQNYNVEEYARNRVEI 299

Query: 301 ARNAVQRFEWETKYRPRNPFL-CSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAA 359
           AR  V+ +E       +  F+  +H   P   K+    +E  +  L+      L   K+A
Sbjct: 300 ARRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGL--LKSA 357

Query: 360 AIAHAVEQRDAKLAELRAKL 379
            +     +R+ +LAE   +L
Sbjct: 358 PLLREQRKREVELAEENRRL 377

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 118/283 (41%), Gaps = 45/283 (15%)

Query: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIGYNRMQVP 134
           S MV ++ ++A +QRR+     D+ L L+GF L P D+    ++  Y+ +K G       
Sbjct: 104 SDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYG------- 156

Query: 135 REQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEK----IPAWLPKLPPNH 190
            E T+  + AT + +   + +         S  +  + +PI       IP WLP  PP++
Sbjct: 157 GEVTLLNRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDY 216

Query: 191 TYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVR----------NCDR----DADT 236
           TYKFT ++NK + D  V+             +L +L+           N D+    D DT
Sbjct: 217 TYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDT 276

Query: 237 ---KVDERARETPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAY 293
              ++D        +  KR      A +   E+      G  T  +        FD++ Y
Sbjct: 277 AKLEMDALYSGGSCDRKKR-----TAFFEDEEDRMVDEHGNSTSNK--------FDIEKY 323

Query: 294 SLGRVKLARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYS 336
              R+ + RN V+++E +      +PFL     + E + K  S
Sbjct: 324 VHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVS 366

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 145/356 (40%), Gaps = 59/356 (16%)

Query: 16  LVGDVSAPVELPHEPWDARVDQMLANSVAFQMSXXXXXXXXXXXXXXXXXXFXXXXXXXX 75
           L+ ++   ++ P+    + + Q+LA S+A Q+                   F        
Sbjct: 41  LLKNLPDLIQSPNRLESSCIGQLLAKSIALQL------KPMNDNTSISTVAFNRLLTLVD 94

Query: 76  XXXSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIG--YN 129
              + M+ +L R++  QRR     +D++L L+ F L P D+    EE  ++  K    YN
Sbjct: 95  LQLNDMIYQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYN 154

Query: 130 RM-QVPREQTVQLQD--ATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKL 186
            + ++ R+   +        +Y    L+ N+   +S       S    I   +P WLP L
Sbjct: 155 LLYELLRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSN--TILRSMPEWLPSL 212

Query: 187 PPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSL----------------------- 223
           PP+HTYKFT  YN+ + DE V+             +L                       
Sbjct: 213 PPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRE 272

Query: 224 SNLVRNCDRDADTKVDERARETPPEELK-----RIDDEIV------ALYGP---LEEIAE 269
           ++L +N + D +T  +    ++  E  K     R++DE++      A+YG    + +I +
Sbjct: 273 NDLEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKK 332

Query: 270 RHE---GPR--TKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETKYRPRNPF 320
           R E    P+  T+         +F+V+ Y+  +V+  R  V  +E +     +NPF
Sbjct: 333 RFELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPF 388

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 145/334 (43%), Gaps = 51/334 (15%)

Query: 87  RIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQTVQLQDATG 146
           +I  VQRR   +  D+ L  +G  +  +D+  Q+ +S    +   +   E     +    
Sbjct: 84  KITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS---NFVHGKFKDEANALNETVLK 140

Query: 147 SYDRF-KLVENQQLIASGLS-----GSDMSQELPIAEK----IPAWLPKLPPNHTYKFTT 196
              +F K +E ++L++S  S       D+   LP + K    +P+WLP+LPP+HTYKFT+
Sbjct: 141 VKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFTS 200

Query: 197 EYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNC---------DRDADTKVDERARETPP 247
            Y + + DE+++             +L N++            ++D+D   +  A     
Sbjct: 201 LYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS--- 257

Query: 248 EELKRIDDEIVALYGPLEEIAERHE--------GPRTKRRTPLYLKKSFDVQAYSLGRVK 299
           E +K    E   ++ P + I    E        G  +   +P+   K+F+V  Y   R  
Sbjct: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPV---KNFNVLEYCKKRDA 314

Query: 300 LARNAVQRFEWETKYRPRNPF-----LCSHRAVPENSKKVYSMLENSLNELVQ------V 348
           + +   +R E +   + RNPF     +CS     + S K    +EN L  +++      +
Sbjct: 315 IVKRRAERAENQVSNKRRNPFIRGAMICSPYG--QGSTKSRKSVENQLKTMLRRSYLGLI 372

Query: 349 D-LPRLESRKAAAIAHAVEQRDAKLAELRAKLKE 381
           D +PR++  +  A   A E+R+  L E R   KE
Sbjct: 373 DSIPRVKEVRERARKEA-EERERLLQEQRRIEKE 405

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 82/190 (43%), Gaps = 27/190 (14%)

Query: 79  SGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDI----EEQMYLSKKIGYNRMQVP 134
           + +V  LHRI+ +QRRQ     D+ + ++G+ L P D+    EE  ++ +    +   V 
Sbjct: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVF 131

Query: 135 REQTVQ--LQDATGSYD--------------------RFKLVENQQLIASGLSGSDMSQE 172
           ++  +   ++ A G  +                     ++L+E QQ     L  +D  + 
Sbjct: 132 KDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRG 191

Query: 173 LPIAEKIPAWLPKLPPNHTYKFTTEYNKLLNDEKVLXXXXXXXXXXXXVSLSNLVRNCDR 232
             +  K P WLP  PP+HTYK+T  Y  ++  E  +             +L  L+ N D 
Sbjct: 192 RNLRYK-PGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250

Query: 233 DADTKVDERA 242
            + TK +++ 
Sbjct: 251 ISTTKDNQKG 260

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 286 KSFDVQAYSLGRVKLARNAVQRFEWETKYRPRNPFL 321
           K FDV+AY+  R+++AR  V  FE+E  Y   NP L
Sbjct: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLL 431

>KNAG0H02030 Chr8 complement(361381..363279) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 26/110 (23%)

Query: 246 PPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGR-----VKL 300
           PPE  K+I D    LYG LE I         K+ T +  +    +QA   GR     ++ 
Sbjct: 494 PPELYKQIYDVTTRLYGKLELINGYQ-----KKYTAIRTQIGECIQA---GRHLRQGIRS 545

Query: 301 ARNAVQRFEWETKYRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDL 350
           A++A  R +WE +YR             ++ K V   L  +L  LV  +L
Sbjct: 546 AKDATCRQQWEAEYR-------------DHEKSVLVKLHTALKSLVDANL 582

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,753,307
Number of extensions: 1549409
Number of successful extensions: 3632
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3670
Number of HSP's successfully gapped: 31
Length of query: 526
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 412
Effective length of database: 40,409,475
Effective search space: 16648703700
Effective search space used: 16648703700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)