Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G034008.836ON2232236195e-81
Smik_13.218.836ON24282992e-04
KAFR0A028108.836ON19690964e-04
Suva_13.318.836ON25182930.002
Skud_13.288.836ON24282920.002
YML113W (DAT1)8.836ON24879870.010
TPHA0C047708.836ON31419701.3
ZYRO0G14102g8.836ON24021691.6
Kpol_541.148.836ON29019682.4
NOTE: 10 genes in the same pillar as KNAG0G03400 were not hit in these BLAST results
LIST: NCAS0B00330 TBLA0B03230 KLTH0C03960g Kwal_27.10286 TDEL0B00610 Ecym_4607 KLLA0D01837g NDAI0E00310 CAGL0B02277g SAKL0D01562g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G03400
         (223 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON}     243   5e-81
Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W (R...    43   2e-04
KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON...    42   4e-04
Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W (R...    40   0.002
Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W (R...    40   0.002
YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA bind...    38   0.010
TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa] {...    32   1.3  
ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa] ...    31   1.6  
Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON} ...    31   2.4  

>KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON} 
          Length = 223

 Score =  243 bits (619), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 134/223 (60%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
           MAKTLAQ              TLREGRKP                              N
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRSRRRAVDGAGADAKTGGGGGEGKGKN 60

Query: 61  TASVSSQDMAAVDALRELTGSPQTRIQSGGLPSLNEILNCSSAGEDVNXXXXXXXXXXXX 120
           TASVSSQDMAAVDALRELTGSPQTRIQSGGLPSLNEILNCSSAGEDVN            
Sbjct: 61  TASVSSQDMAAVDALRELTGSPQTRIQSGGLPSLNEILNCSSAGEDVNAIAHASAAAVAA 120

Query: 121 XXXXXXXXXXXPFISPNELNAEYYDASAVDLAGNGHANTFHGLVASNHSGGTHMDRXXXX 180
                      PFISPNELNAEYYDASAVDLAGNGHANTFHGLVASNHSGGTHMDR    
Sbjct: 121 TAGSAGTGTGSPFISPNELNAEYYDASAVDLAGNGHANTFHGLVASNHSGGTHMDRTNST 180

Query: 181 XXXXXXXXXXXXXXXXXXILRKISPVSDIGAGRAHTVDSFYTT 223
                             ILRKISPVSDIGAGRAHTVDSFYTT
Sbjct: 181 NSSTTTSTNTTPTNNNNNILRKISPVSDIGAGRAHTVDSFYTT 223

>Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W
          (REAL)
          Length = 242

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 34/82 (41%), Gaps = 8/82 (9%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
          MAKTLAQ              TLREGRKP                               
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIAGKDTDGTQQDQ--------E 52

Query: 61 TASVSSQDMAAVDALRELTGSP 82
          + S+SS+DM AVDALRELT SP
Sbjct: 53 SRSISSRDMEAVDALRELTHSP 74

>KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON}
          Anc_8.836 YML113W
          Length = 196

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
          MAKTLAQ              TL+EGRKP                              N
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLKEGRKPGSGRRKRAVSASIASLAIPPHTGARTREESN 60

Query: 61 TA--SVSSQDMAAVDALRELTGSPQTRIQS 88
          T    ++S+D+ A+DALRELT SPQ   Q+
Sbjct: 61 TYDHPITSRDLEAIDALRELTHSPQQMSQA 90

>Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W
          (REAL)
          Length = 251

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 33/82 (40%), Gaps = 8/82 (9%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
          MAKTLAQ              TLREGRKP                               
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGRDADVSQQDQ--------E 52

Query: 61 TASVSSQDMAAVDALRELTGSP 82
          +  +SS+DM AVDALRELT SP
Sbjct: 53 SRPISSRDMEAVDALRELTHSP 74

>Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W
          (REAL)
          Length = 242

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 33/82 (40%), Gaps = 8/82 (9%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
          MAKTLAQ              TLREGRKP                               
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGKDADITLQDQ--------E 52

Query: 61 TASVSSQDMAAVDALRELTGSP 82
          +  +SS+DM AVDALRELT SP
Sbjct: 53 SRPISSRDMEAVDALRELTHSP 74

>YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA
          binding protein that recognizes oligo(dA).oligo(dT)
          tracts; Arg side chain in its N-terminal pentad
          Gly-Arg-Lys-Pro-Gly repeat is required for DNA-binding;
          not essential for viability
          Length = 248

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 30/79 (37%), Gaps = 8/79 (10%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 60
          MAKTLAQ              TLREGRKP                               
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDTGGKETDGSQQDQESRL----- 55

Query: 61 TASVSSQDMAAVDALRELT 79
             +SS+DM AVDALRELT
Sbjct: 56 ---ISSRDMEAVDALRELT 71

>TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa] {ON}
           Anc_8.836 YML113W
          Length = 314

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 64  VSSQDMAAVDALRELTGSP 82
           +SS+D+ A+DALRELT SP
Sbjct: 137 ISSRDLEALDALRELTTSP 155

>ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa]
           {ON} some similarities with uniprot|P13483 Saccharomyces
           cerevisiae YML113W
          Length = 240

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 62  ASVSSQDMAAVDALRELTGSP 82
           + VSS+D+ A+DALREL  SP
Sbjct: 115 SQVSSRDLEAIDALRELNNSP 135

>Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON}
           complement(38346..39218) [873 nt, 291 aa]
          Length = 290

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 64  VSSQDMAAVDALRELTGSP 82
           +S++D+ A+DALRELT SP
Sbjct: 158 ISTRDLEALDALRELTTSP 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,733,053
Number of extensions: 302925
Number of successful extensions: 490
Number of sequences better than 10.0: 9
Number of HSP's gapped: 486
Number of HSP's successfully gapped: 9
Length of query: 223
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 118
Effective length of database: 41,441,469
Effective search space: 4890093342
Effective search space used: 4890093342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)