Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020708.271ON89989947290.0
NCAS0B050508.271ON92389230430.0
NDAI0B020208.271ON90588730350.0
Suva_10.1768.271ON89388530300.0
Skud_12.1608.271ON89388430240.0
YLR092W (SUL2)8.271ON89388430110.0
Smik_12.1518.271ON89388829940.0
KAFR0B027508.271ON83486628770.0
TPHA0J008008.271ON91791328760.0
Kpol_543.438.271ON86681428540.0
CAGL0L12342g8.271ON89190928280.0
TDEL0F039808.271ON86788228030.0
Smik_2.435na 1ON86380927940.0
YBR294W (SUL1)na 1ON85987927790.0
Suva_4.554na 1ON85081027710.0
SAKL0H16830g8.271ON86287427660.0
Skud_2.424na 1ON86388727540.0
KLLA0F19338g8.271ON89189326360.0
KLTH0G13486g8.271ON90288826330.0
ZYRO0C01452g8.271ON90690626180.0
Kwal_56.237598.271ON86186825730.0
TPHA0A017608.271ON89391525330.0
AGR077C8.271ON84890424670.0
Ecym_42998.271ON87487822730.0
TBLA0F030508.271ON89750813761e-176
NDAI0B022108.99ON7065223074e-28
NCAS0B048008.99ON7245353076e-28
ZYRO0F04796g8.99ON7354872924e-26
YPR003C8.99ON7544872891e-25
KNAG0D023908.99ON7165022862e-25
Suva_16.3228.99ON7424872862e-25
KLTH0G16764g8.99ON7105022853e-25
TBLA0C052708.99ON7764642844e-25
Kpol_467.118.99ON7445732844e-25
AGR213Cna 2ON6894102818e-25
Smik_16.2418.99ON7444872782e-24
TPHA0H007208.99ON7874872782e-24
CAGL0L09207g8.99ON7255102772e-24
KLLA0E14059g8.99ON7064832711e-23
Skud_16.2868.99ON7454882702e-23
SAKL0B03124g8.99ON7444672702e-23
Ecym_7084na 2ON6894832664e-23
SAKL0H08800gna 2ON6204452371e-19
Kwal_27.110398.99ON7261461754e-12
TDEL0C012808.99ON7271461664e-11
KAFR0C019103.485ON1020443880.091
KAFR0L015907.366ON284103790.61
AGL321W7.477ON17384770.80
KLLA0E04731g3.485ON1060134762.7
NCAS0C024908.480ON73990743.8
NDAI0J029204.364ON75967727.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02070
         (899 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1826   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1176   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1173   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1171   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1169   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1164   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1157   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1112   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1112   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1103   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1093   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1084   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1080   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1075   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1071   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1070   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1065   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1019   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1018   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1013   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   995   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   980   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   954   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   880   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   534   e-176
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   122   4e-28
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   122   6e-28
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   117   4e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   115   1e-25
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   114   2e-25
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   114   2e-25
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   114   3e-25
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   114   4e-25
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   114   4e-25
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   112   8e-25
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   111   2e-24
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   111   2e-24
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   111   2e-24
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   108   1e-23
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   108   2e-23
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   108   2e-23
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   107   4e-23
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    96   1e-19
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    72   4e-12
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    69   4e-11
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    39   0.091
KAFR0L01590 Chr12 complement(287887..288741) [855 bp, 284 aa] {O...    35   0.61 
AGL321W Chr7 (105059..105580) [522 bp, 173 aa] {ON} Syntenic hom...    34   0.80 
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    34   2.7  
NCAS0C02490 Chr3 (464074..466293) [2220 bp, 739 aa] {ON} Anc_8.4...    33   3.8  
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    32   7.4  

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1826 bits (4729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/899 (98%), Positives = 887/899 (98%)

Query: 1   MTERRHSFRQEDSDNSFPXXXXXXXXXXXXVSSTPDLDNLELEYDQYKADELHPQRTILS 60
           MTERRHSFRQEDSDNSFP            VSSTPDLDNLELEYDQYKADELHPQRTILS
Sbjct: 1   MTERRHSFRQEDSDNSFPNEYGAEYNNANEVSSTPDLDNLELEYDQYKADELHPQRTILS 60

Query: 61  NQADTDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFF 120
           NQADTDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFF
Sbjct: 61  NQADTDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFF 120

Query: 121 NHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIA 180
           NHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIA
Sbjct: 121 NHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIA 180

Query: 181 TLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI 240
           TLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI
Sbjct: 181 TLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI 240

Query: 241 IATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVN 300
           IATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVN
Sbjct: 241 IATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVN 300

Query: 301 TRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNF 360
           TRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNF
Sbjct: 301 TRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNF 360

Query: 361 LWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPE 420
           LWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPE
Sbjct: 361 LWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPE 420

Query: 421 LPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTT 480
           LPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTT
Sbjct: 421 LPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTT 480

Query: 481 GSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVAS 540
           GSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVAS
Sbjct: 481 GSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVAS 540

Query: 541 YHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV 600
           YHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV
Sbjct: 541 YHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV 600

Query: 601 EIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIA 660
           EIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIA
Sbjct: 601 EIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIA 660

Query: 661 ENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIK 720
           ENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIK
Sbjct: 661 ENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIK 720

Query: 721 RVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDE 780
           RVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDE
Sbjct: 721 RVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDE 780

Query: 781 RPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIG 840
           RPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIG
Sbjct: 781 RPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIG 840

Query: 841 FGTVNEEFSDESIIAGHSSYHLVKNTIGDIENGYQVKTATGTNLPFFHIDIPDFKKWDI 899
           FGTVNEEFSDESIIAGHSSYHLVKNTIGDIENGYQVKTATGTNLPFFHIDIPDFKKWDI
Sbjct: 841 FGTVNEEFSDESIIAGHSSYHLVKNTIGDIENGYQVKTATGTNLPFFHIDIPDFKKWDI 899

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/892 (64%), Positives = 696/892 (78%), Gaps = 29/892 (3%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASI- 90
           +ST +LD+LELEYDQYK  E +    +++N  + +        +E Q   D    + +  
Sbjct: 37  NSTQNLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTNN 96

Query: 91  EELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHY 150
           +E QY    +    +IP+Y E  V+  ++++HS+R   TL   ++Y LSIFPI  WLPHY
Sbjct: 97  KENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHY 156

Query: 151 NVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIG 210
           N+ WF  DLIAGITVGCVLVPQSMSYAQIATLP QYGLYSSFIGAF YSLFATSKDVCIG
Sbjct: 157 NLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIG 216

Query: 211 PVAVMSLETAKIIARVMKRFP-NDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELIS 269
           PVAVMSLETAK++ +V+ ++P NDP +  PI+AT  +LLCG + AGVG LRLGFLVELIS
Sbjct: 217 PVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELIS 276

Query: 270 LNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIP 329
           LNAV GFMTGSALNI+ GQVP LMGY   VNTRTA YKVI+ TLKHLPDTKLDAVFGLIP
Sbjct: 277 LNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIP 336

Query: 330 LFILYFWRWWCNGYGPKLTDRYYPKG--SRGNFLWKKFYFYAQASRSGIIIIVFTAISWS 387
           LF+LY W+WWC+  GPKL D+++PK    R NF +KKFYFYAQA+++ IIIIVFTAISWS
Sbjct: 337 LFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWS 396

Query: 388 ITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSF 447
           ITR     +R ISILGTVPKGLK+VG +K+P  L +K+APELPA+VIVLLLEHIAI+KSF
Sbjct: 397 ITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSF 456

Query: 448 GRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCV 507
           GRINDYKVVPDQELIAIGVTNLIGTFF+AYP TGSFSRSALKAKC V+TPLSG+FTG+CV
Sbjct: 457 GRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACV 516

Query: 508 LLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVF 567
           LLALYCLTGAFFYIPKATLSAVII +VSDL+ASY  TWNF+KMNPLD +CFL T+ ITVF
Sbjct: 517 LLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVF 576

Query: 568 SSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEF 627
           SSIENGIYFA+CWSCA+LL KV FPAGKFLGR+E+AEV+DG +  DNS+   T    +E+
Sbjct: 577 SSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYV--DNSIESAT---TAEY 631

Query: 628 -------GGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAEN-KLKYYTKWVPFDHAYTR 679
                    N+  +K      S    KD      S+S +  N K++YYTKWVPFDHAYTR
Sbjct: 632 SSASSPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTR 691

Query: 680 ELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPW 739
           ELNP V I PPPPGVIVYR++DS+TYIN S HYD+I DE+KR TRRGQLL+HRKK+DRPW
Sbjct: 692 ELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPW 751

Query: 740 NDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDS 799
           NDPGEW+ P+FL N+ H +K    ++ + V+  +   +RD RP+LK++CLDFSQVAQ+D+
Sbjct: 752 NDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDA 811

Query: 800 TSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSS 859
           +++QSLVDLRK++N YADRQVEFHFAGI+SPW+KRGL+  GFGT+N+EFSD SIIAGHSS
Sbjct: 812 SAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSS 871

Query: 860 YHLVK---NTIGDIENG---------YQVKTATGTNLPFFHIDIPDFKKWDI 899
           YHL +   ++  D+E+          Y V  ATGTNLPFFHIDIPDF KWD+
Sbjct: 872 YHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1173 bits (3035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/887 (65%), Positives = 696/887 (78%), Gaps = 31/887 (3%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRT----ILSNQADTDREKIANVFVEEQSVRDSNIPS 87
           +S+ +L +LELEYDQYKA E + +      + +N  D       N   ++ S+++  I  
Sbjct: 31  TSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQI-- 88

Query: 88  ASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWL 147
               ++  F  +S    +IPS+ E  ++  +++ HSL+  F+L + K Y LSIFPII WL
Sbjct: 89  ----QINTFNADS---VIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWL 141

Query: 148 PHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDV 207
           PHYN+ WF  DLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAF YSLFATSKDV
Sbjct: 142 PHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDV 201

Query: 208 CIGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVE 266
           CIGPVAVMSLET K+I +V+ ++P  DP++  P+IAT  A LCG I AG+GFLRLGFLVE
Sbjct: 202 CIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVE 261

Query: 267 LISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFG 326
           LISLNAV GFMTGSALNI+ GQ+PALMGYG  VNTRT+TYKVI+ +LKHLPDTKLDAVFG
Sbjct: 262 LISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFG 321

Query: 327 LIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISW 386
           LIPLFILY W+WWC   GP++ D+++    +GNF  KKFYFYAQA+++ +IIIVFTAI+W
Sbjct: 322 LIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAW 381

Query: 387 SITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKS 446
           SIT+     ER ISILG+VPKGLK+VG +K+P  L +KIAPELPA+VIVLLLEHIAI+KS
Sbjct: 382 SITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKS 441

Query: 447 FGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSC 506
           FGRINDYKVVPDQELIAIGVTNLIGTFF+AYP TGSFSRSALKAKC V+TPLSGLFTGSC
Sbjct: 442 FGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSC 501

Query: 507 VLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITV 566
           VLLALYCLTG F YIPKATLSAVIIH+VSDL+ASYHTTWNF+KMNPLD   F+ T+ ITV
Sbjct: 502 VLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITV 561

Query: 567 FSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEI-----INDNSVVMTTD 621
           FSSIENGIYFA+CWSCA+L+ KVAFPAGKFLGRVEIAEVV+G +     + D S      
Sbjct: 562 FSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLS 621

Query: 622 DCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTREL 681
                   NK+     L+      +KD+L S  SS    ++K++YYTKW+PFDHAYT+EL
Sbjct: 622 LSADTINHNKKLK--ILHIPLLKTLKDQLFSDISSIQ-GKSKIRYYTKWLPFDHAYTKEL 678

Query: 682 NPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWND 741
           NP+V I PPPPGVIVYR++DS+TY+N S HYD+I +EIK+ T+RGQL++HRKKSDRPWND
Sbjct: 679 NPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWND 738

Query: 742 PGEWKPPKF--LSNVLHWRKNKKKNQTADVESLETGIV-RDERPVLKVLCLDFSQVAQVD 798
           PGEW+ P F  L   L +R+NK  N   +    +  +  RD+RP+LKVLCLDFSQVAQVD
Sbjct: 739 PGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVD 798

Query: 799 STSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHS 858
           +T+LQSLVDLRKA+N YADRQVEFHFAGI+SPWIK+GL+ IGFGT+NEE+SDESIIAGH+
Sbjct: 799 ATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHT 858

Query: 859 SYHLVKNTIGDIE------NGYQVKTATGTNLPFFHIDIPDFKKWDI 899
           SYHL +    D+E        Y+V TATGTNLPFFHIDIPDF +WD+
Sbjct: 859 SYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1171 bits (3030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/885 (64%), Positives = 694/885 (78%), Gaps = 30/885 (3%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIE 91
           ++ PDLD+LELEYDQYK +E         N  +++     N   E + V+ S +   +  
Sbjct: 22  TTVPDLDDLELEYDQYKNNE--NNGAFNDNDLESNSLTNHNTASEAKGVKGSKVEYFNTS 79

Query: 92  ELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYN 151
           ++  + +       +  + E  V+  E+++HS+RS  TL AA NY+ S+FPII+WLPHYN
Sbjct: 80  DISLYDNS------VSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYN 133

Query: 152 VYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGP 211
           V WFI DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS FATSKDVCIGP
Sbjct: 134 VNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGP 193

Query: 212 VAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISL 270
           VAVMSL+TAK+IA V  R+P+ D  + GPIIATT ALLCG I+A VGFLRLGFLVELISL
Sbjct: 194 VAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISL 253

Query: 271 NAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPL 330
           NAVAGFMTGSA NI+ GQVPALMGY KLVNTR ATYK+++++LKHLPDT LDA FGLIPL
Sbjct: 254 NAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPL 313

Query: 331 FILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITR 390
           FILY W+WWC  YGP+L DR+  K  R + + K   FYAQASR+GIIIIVFT I+W+ITR
Sbjct: 314 FILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITR 373

Query: 391 HVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRI 450
              S +R ISILG+VP GLK+VG   VPP L +K+ P LPA++IVLLLEHIAISKSFGR+
Sbjct: 374 GKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRV 433

Query: 451 NDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLA 510
           NDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV+TPLSGLF+GSCVLLA
Sbjct: 434 NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLA 493

Query: 511 LYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSI 570
           LYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLDF+CF+ T++ITVFSSI
Sbjct: 494 LYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSI 553

Query: 571 ENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGN 630
           ENGIYFA+CWSCA+ + KVAFPAGKFLGRVEIAEV D  +  D+  V  T +  +     
Sbjct: 554 ENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTL 613

Query: 631 KEFSKDKLNGKSDFIVKD--KLDST-------ASSSSIAENKLKYYTKWVPFDHAYTREL 681
           +E    +  G +++I+    KL++        + S+SI + ++KY+TKW+PFDH YT+EL
Sbjct: 614 EEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKEL 673

Query: 682 NPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWND 741
           NPDV I PPP GV+VYR+S+SYTYIN S HY++I DEIK+VTRRGQL++HRKKSDRPWND
Sbjct: 674 NPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWND 733

Query: 742 PGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGI------VRDERPVLKVLCLDFSQVA 795
           PG W+PP F  N+  W+K +      D+ES E  +      VRD+RP+LK+LCLDFSQVA
Sbjct: 734 PGPWEPPTFFKNLKFWKKKE-----TDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVA 788

Query: 796 QVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIA 855
           Q D+T+LQSLVDLRKA+N YADRQVEFHF GIISPW+KRGL+  GFGT+NEE+SDESI+A
Sbjct: 789 QTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVA 848

Query: 856 GHSSYHLVKNTIG-DIENGYQVKTATGTNLPFFHIDIPDFKKWDI 899
           GH+SYH+ +     +  + Y V TA+GTNLPFFHIDIPDF KWDI
Sbjct: 849 GHTSYHVARVPQNEETPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1169 bits (3024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/884 (65%), Positives = 692/884 (78%), Gaps = 30/884 (3%)

Query: 33  STPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEE 92
           S P+LD+LELEYDQYK +E        +N   +D +  +N      +V D+     S  +
Sbjct: 23  SVPNLDDLELEYDQYKNNE--------NNGVFSDNDLESNSVANRNAVNDAKGVKGS--K 72

Query: 93  LQYF--AHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHY 150
           ++YF  +  S     +  + E  V+  E++NHS+RS  TL  A +Y+ S+FPII+WLPHY
Sbjct: 73  IEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHY 132

Query: 151 NVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIG 210
           N  WFI DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS FATSKDVCIG
Sbjct: 133 NFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIG 192

Query: 211 PVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELIS 269
           PVAVMSL+TAK+IA V  ++P+ D  + GP+IATT ALLCG I+A VGFLRLGFLVELIS
Sbjct: 193 PVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELIS 252

Query: 270 LNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIP 329
           LNAVAGFMTGSA NI+ GQVPALMGY KLVNTR ATYKV++ TLKHLPDTKLDAVFGLIP
Sbjct: 253 LNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIP 312

Query: 330 LFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSIT 389
           LF+LY W+WWC  YGP+L DRY  K +R + + K  YFYAQASR+GIIIIVFT I W+IT
Sbjct: 313 LFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAIT 372

Query: 390 RHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGR 449
           R   S ER ISILG+VP GLK+VG   VP  L +K+ P LP+++IVLLLEHIAISKSFGR
Sbjct: 373 RGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGR 432

Query: 450 INDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLL 509
           INDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV+TPLSGLF+GSCVLL
Sbjct: 433 INDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLL 492

Query: 510 ALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSS 569
           ALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLDF+CF+ T++ITVF+S
Sbjct: 493 ALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFAS 552

Query: 570 IENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGG 629
           IE+GIYFA+CWSCA+LL KVAFPAGKFLGRVEIAEV D  +  D+  V    +  +    
Sbjct: 553 IEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRIST 612

Query: 630 NKEFSKDKLNGKSDFIVKD--KLDST-------ASSSSIAENKLKYYTKWVPFDHAYTRE 680
            +E  +D+    + +I     K+++        + SSSI + ++KY+TKW+PFDH YTRE
Sbjct: 613 LEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRE 672

Query: 681 LNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWN 740
           LNPDV I PPP  V+VYR+S+SYTY+N S HY+IIIDE+KR TRRGQ+++HRKKSDRPWN
Sbjct: 673 LNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWN 732

Query: 741 DPGEWKPPKFLSNVLHWRKNKKK---NQTADVESLETGIVRDERPVLKVLCLDFSQVAQV 797
           DPG W+ P FL N+  W+K +      Q A   S++    RDERP+LK+LCLDFSQVAQ 
Sbjct: 733 DPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAE--RDERPLLKILCLDFSQVAQT 790

Query: 798 DSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGH 857
           D+T+LQSLVDLRKA+N YADRQVEFHF GIISPW+KRGL+  GFGT+NEE+SDESI+AGH
Sbjct: 791 DATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGH 850

Query: 858 SSYHLVKNTIGDIEN--GYQVKTATGTNLPFFHIDIPDFKKWDI 899
           +SYH+ +    + EN   Y V TA+GTNLPFFHIDIPDF KWDI
Sbjct: 851 TSYHVAR-VPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/884 (64%), Positives = 694/884 (78%), Gaps = 28/884 (3%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIE 91
           ++ PDLD+LELEYDQYK +E        +N    D++  +N   +  +V  S     S  
Sbjct: 22  NTVPDLDDLELEYDQYKNNE--------NNDTFNDKDLESNSVAKHNAVNSSKGVKGS-- 71

Query: 92  ELQYFAHESDGA---KVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLP 148
           ++ YF + SD +     +  + E  V+  E+++HS+RS  T+  A +Y+ S+FPII+WLP
Sbjct: 72  KIDYF-NPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLP 130

Query: 149 HYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVC 208
           HYN  WF  DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS FATSKDVC
Sbjct: 131 HYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVC 190

Query: 209 IGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVEL 267
           IGPVAVMSL+TAK+IA V  ++P+ D  + GP+IATT ALLCG I+A VGFLRLGFLVEL
Sbjct: 191 IGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVEL 250

Query: 268 ISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGL 327
           ISLNAVAGFMTGSA NI+ GQVPALMGY  LVNTR ATYKV++ TLKHLPDTKLDAVFGL
Sbjct: 251 ISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGL 310

Query: 328 IPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWS 387
           IPLF+LY W+WWC  YGP+L DRY  K  R + + K  YFYAQASR+GIIIIVFT I W+
Sbjct: 311 IPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWA 370

Query: 388 ITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSF 447
           ITR     ER ISILG+VP GLK+VG   VPP L +K+ P LPA++IVLLLEHIAISKSF
Sbjct: 371 ITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSF 430

Query: 448 GRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCV 507
           GRINDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV+TPLSGLF+GSCV
Sbjct: 431 GRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCV 490

Query: 508 LLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVF 567
           LLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLDF+CF+ T++ITVF
Sbjct: 491 LLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVF 550

Query: 568 SSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEF 627
           +SIE+GIYFA+CWSCA+L+ KVAFPAGKFLGRVE+AEV D  +  D+ VV    +  +  
Sbjct: 551 ASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGI 610

Query: 628 GGNKEFSKDKLNGKSDFIVKD--KLDST-------ASSSSIAENKLKYYTKWVPFDHAYT 678
              ++  +D     + ++     K+++        + SSSI++ ++KY+TKW+PFDH YT
Sbjct: 611 STLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYT 670

Query: 679 RELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRP 738
           RELNPDV I PPP GV+VYR+S+SYTY+N S HY+II +E+K+VTRRGQL++HRKKSDRP
Sbjct: 671 RELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRP 730

Query: 739 WNDPGEWKPPKFLSNVLHWRKNKKKNQTAD-VESLETGIVRDERPVLKVLCLDFSQVAQV 797
           WNDPG W+ P FL N+  W+K +   ++ +   S    + RD+RP+LK+LCLDFSQVAQ 
Sbjct: 731 WNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQT 790

Query: 798 DSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGH 857
           D+T+LQSLVDLRKA+N YADRQVEFHF GIISPW+KRGL+  GFGT+NEE+SDESI+AGH
Sbjct: 791 DATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGH 850

Query: 858 SSYHLVKNTIGDIEN--GYQVKTATGTNLPFFHIDIPDFKKWDI 899
           +SYH+ +   G+ EN   Y V TA+GTNLPFFHIDIPDF KWDI
Sbjct: 851 TSYHVARVPQGE-ENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/888 (64%), Positives = 692/888 (77%), Gaps = 36/888 (4%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIE 91
           ++ PDLD+LELEYDQYK +E        +N A  D +  +N   +  +V   N   A   
Sbjct: 22  NTVPDLDDLELEYDQYKNNE--------NNDAFKDNDLESNSVAKPNAV--GNGKGAKGS 71

Query: 92  ELQYFAHESDGA---KVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLP 148
           +++YF + SD +     +  + E  V+  E+++HS+RS  TL  A++Y+ S+FPII+WLP
Sbjct: 72  KIEYF-NPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLP 130

Query: 149 HYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVC 208
           HYN  WF  DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS FATSKDVC
Sbjct: 131 HYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVC 190

Query: 209 IGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVEL 267
           IGPVAVMSL+TAK+IA V  ++P+ DP + GP+IATT ALLCG I+A +GFLRLGFLVEL
Sbjct: 191 IGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVEL 250

Query: 268 ISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGL 327
           ISLNAVAGFMTGSA NI+ GQVPALMGY  LVNTR ATYKV++ TLKHLPDTKLDAVFGL
Sbjct: 251 ISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGL 310

Query: 328 IPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWS 387
           IPLF+LY W+WWC  YGP L DRY  K  R + + K  YFYAQASR+G+II+VFT I W+
Sbjct: 311 IPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWA 370

Query: 388 ITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSF 447
           ITR     ER ISILG+VP GLK+VG   VP  L +K+ P LPA++IVLLLEHIAISKSF
Sbjct: 371 ITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSF 430

Query: 448 GRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCV 507
           GRINDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV+TPLSGLF+GSCV
Sbjct: 431 GRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCV 490

Query: 508 LLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVF 567
           LLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLDF+CF+ T++ITVF
Sbjct: 491 LLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVF 550

Query: 568 SSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEF 627
           +SIE+GIYFA+CWSCA+LL K+AFPAGKFLGRVEIAEV D  I  ++  V  T +  +  
Sbjct: 551 ASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGI 610

Query: 628 GGNKEFSKDKLNGKSDFIVKD--KLDST-------ASSSSIAENKLKYYTKWVPFDHAYT 678
             ++E  + + +  + +I     K+++        + SS I + ++KY+TKWVPFDH YT
Sbjct: 611 RTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYT 670

Query: 679 RELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRP 738
           RELNPD+ I PPP GV+VYR+S+SYTY+N S HY+II +++K VTRRGQL++HRKKSDRP
Sbjct: 671 RELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRP 730

Query: 739 WNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLET------GIVRDERPVLKVLCLDFS 792
           WNDPG W+ P FL N+  W+K +     +D E LE       G  RD+RP+LK+LCLDFS
Sbjct: 731 WNDPGPWEAPAFLKNLKFWKKRE-----SDSEFLENAPDNSIGTERDDRPLLKILCLDFS 785

Query: 793 QVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDES 852
           QVAQ D+T+LQSLVDLRK +N YADRQVEFHF GIISPW+KRGLV  GFGT+NEE+SDES
Sbjct: 786 QVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDES 845

Query: 853 IIAGHSSYHLVK-NTIGDIENGYQVKTATGTNLPFFHIDIPDFKKWDI 899
           I+AGH+SYH+ +     +  + Y V TA+GTNLPFFHIDIPDF KWDI
Sbjct: 846 IVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1112 bits (2877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/866 (63%), Positives = 662/866 (76%), Gaps = 47/866 (5%)

Query: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95
           +LD+LE E++QYK  EL    T  + + D+ R          Q   D N+ S+S + +  
Sbjct: 14  NLDDLEQEFNQYKKIELTISSTRQNEEVDSKR----------QGKSDKNVKSSSFDSIFS 63

Query: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155
              +      +P+Y E ++T  +++ +SLR  FT     +YI S+FPI HWLPHYN+ WF
Sbjct: 64  LTQQQQ----VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWF 119

Query: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215
           I DLIAGITVGCVLVPQSMSYAQIATL PQ+GLYSSFIGAF YSLFATSKDVCIGPVAVM
Sbjct: 120 ISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVM 179

Query: 216 SLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAG 275
           SL+TAK+IARV  + P+D D+    IATT ALLCG IA GVG LRLGFLVELISLNAVAG
Sbjct: 180 SLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAG 239

Query: 276 FMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYF 335
           FMTGSALNIISGQVP LMGY   VNTRT+TYKVI++TLKHLPDTKLDAVFGLIPLF+L+ 
Sbjct: 240 FMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFA 299

Query: 336 WRWWCNGYGPKLTDRYYPKGS--RGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVP 393
           W+W C+  GP+L +R++  G   R + + K FYFYAQ +++ IIIIVFT ISW+ITR   
Sbjct: 300 WKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKT 359

Query: 394 SKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDY 453
           S+ R IS+LG+VPKGLKDV    VP  L AK+APELPA++IVLLLEHIAI+KSFGRINDY
Sbjct: 360 SETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDY 419

Query: 454 KVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYC 513
           K+VPDQE++AIG+TNL+GTFFHAYP TGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYC
Sbjct: 420 KIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYC 479

Query: 514 LTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENG 573
           LTGAFFYIPKATL AVIIH+VS+L+ASY  T NF+KMNPLD  CFL T+IITVF+SIE+G
Sbjct: 480 LTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDG 539

Query: 574 IYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEF 633
           IYFA+CWS A+LLFKVAFP GKFLG++EI EV+DG+++ D+SV+ ++D+       N E 
Sbjct: 540 IYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE-------NSEI 592

Query: 634 SKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPG 693
                 G S  +V +  ++T            YYTKWVPFD +YT+ELNPD  I+PPPPG
Sbjct: 593 LPTTKAGYSVEVVSNHNENT-----------NYYTKWVPFDFSYTKELNPDAHIKPPPPG 641

Query: 694 VIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSN 753
           VIVYRM+DS+TY+N S H+DI+ DEIKR T+RG+L Q  +KSDRPWNDPG+W+P  F+  
Sbjct: 642 VIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKK 701

Query: 754 VLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVN 813
            L  R+        D+E      V D+RP LK++CLDFSQV+Q+D+T++Q L DLRK+VN
Sbjct: 702 YL--RRENYDEDNVDIEDR----VIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVN 755

Query: 814 AYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIENG 873
            YADRQVEFHF GIISPWIK+ L   GFGT+N E+SDESII GHSSYHL K+  G     
Sbjct: 756 KYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVDG----- 810

Query: 874 YQVKTATGTNLPFFHIDIPDFKKWDI 899
             +K ATGTNLPFFHIDIP+F KWDI
Sbjct: 811 --IKAATGTNLPFFHIDIPNFNKWDI 834

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1112 bits (2876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/913 (61%), Positives = 667/913 (73%), Gaps = 67/913 (7%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPS-ASI 90
           S+T DL+ LE EYDQYK +E              + E I+  ++     ++ N+ S    
Sbjct: 27  SNTVDLEALEEEYDQYKKEE--------------EIEYISGNYLNSSPTQNINVTSNPKY 72

Query: 91  EELQYFAHES-----------DGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILS 139
           EE +   H             D   +IP++ E  +T  E++NHSL+  FT NAAKNY LS
Sbjct: 73  EEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALS 132

Query: 140 IFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYS 199
           IFPIIHWLP YN  WFI DLIAGIT+GCVLVPQSMSYAQIATL PQYGLYSSFIGAF+Y+
Sbjct: 133 IFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYA 192

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           LFATSKDVCIGPVAVMSLETAK+IA V   F NDPDV GPIIATT ALLCGGIAA VGFL
Sbjct: 193 LFATSKDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLCGGIAAAVGFL 252

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           RLGFLVELISLNAV GFMTGSA NI+ GQVP LMGY KLVNTR ATYKV+++TLKHLPDT
Sbjct: 253 RLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDT 312

Query: 320 KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIII 379
           KLDAVFGLIPLFILY  +WWC  YG +L ++ +    R  F  KKFYFY  A R+ ++II
Sbjct: 313 KLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVII 372

Query: 380 VFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLE 439
           +FTAISWSITR+  S ER I++LGTVP GLKD+G  K   ++  KI P+LPA++IVLLLE
Sbjct: 373 IFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLE 432

Query: 440 HIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLS 499
           HIAI+KSFGRINDYK+VPDQELIAIG++NL+GTFF AYP TGSFSRSAL AKCNVKTPLS
Sbjct: 433 HIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLS 492

Query: 500 GLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFL 559
           G+FTG CVLLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TT +F+ MNPLD +CFL
Sbjct: 493 GIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFL 552

Query: 560 TTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMT 619
            T++ITVFSSIENGIYFA+C+SCAL +F+ AFPAGKFLGR+EIAEV++    +D  +   
Sbjct: 553 VTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDDFQMDNF 612

Query: 620 TDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTR 679
                SE+     F  D+  GK D  + +K     +S   ++N   +YTKWVPFDH YT+
Sbjct: 613 NGFETSEYNN---FPADQSYGKFD--IANKNTHKYNSPHCSKN---FYTKWVPFDHTYTK 664

Query: 680 ELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPW 739
           ELN DV I  PPPGVIVYR+SDS+ Y+N S H+D I DE+KR T+RG+ + + KKS RPW
Sbjct: 665 ELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPW 724

Query: 740 NDPGEWKPPKFLSNVLHWRKNKKKNQTADVE------------SLETGIVRDERPVLKVL 787
           NDPGEW+ P +++     R   K+ Q A+              S    I  D RPVL+V+
Sbjct: 725 NDPGEWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVI 784

Query: 788 CLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEE 847
           CLDFSQV+Q D+T+LQSL DLRK+VN+YADRQVEFHF GIISPW+KRGL+K+GFGTVNE 
Sbjct: 785 CLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEA 844

Query: 848 FSDESIIAGHSSYHLVKN---------------TIGDIE------NGYQVKTATGTNLPF 886
           +SD S I GH SYH+VKN               TI D+       N Y ++ A+GTN PF
Sbjct: 845 YSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPF 904

Query: 887 FHIDIPDFKKWDI 899
           FHIDIP+F KWD+
Sbjct: 905 FHIDIPNFSKWDV 917

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/814 (65%), Positives = 648/814 (79%), Gaps = 35/814 (4%)

Query: 101 DGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLI 160
           + ++ +P Y+E  VT  E++NHS+R   T  +  NY++SIFPII WLP YN  W I DLI
Sbjct: 73  NSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLI 132

Query: 161 AGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETA 220
           AGIT+GCVLVPQSMSYAQIATLPPQYGLYSSF+GA+ YSLFATSKDVCIGPVAVMSL+TA
Sbjct: 133 AGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTA 192

Query: 221 KIIARVMKRFPNDPD--VQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMT 278
           K+I  V      +    +  P+IATT ALLCG I+AGVG LRLGFLVELISLNAV GFMT
Sbjct: 193 KVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMT 252

Query: 279 GSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRW 338
           GSALNIISGQVPALMGY   VNTR ATYKVI+NTLKHLPDTK+DA+FGLIPL ILYFW+W
Sbjct: 253 GSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKW 312

Query: 339 WCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERR 398
           W +  GPKL DRYYP      ++ K FYFY  A RSGIIIIV T+ISWS+TR     ER 
Sbjct: 313 WFSSMGPKLVDRYYPNSKYKKYI-KAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERP 371

Query: 399 ISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPD 458
           ISILGTVP GL++VG    P  L AK+APELP+++IVLLLEHIAI+KSFGR+NDYKVVPD
Sbjct: 372 ISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPD 431

Query: 459 QELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAF 518
           QELIAIG++NLIGTFF++YP TGSFSRSALKAKCNVKTPLSG+FTGSCVLLALYCLTGAF
Sbjct: 432 QELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAF 491

Query: 519 FYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAI 578
           FYIPKATLSAVIIH+VSDLVASY TTW+F+KMNPLDF+CF+TT+ ITVF+SIE+GIYF +
Sbjct: 492 FYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTM 551

Query: 579 CWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKL 638
           CWS A+LLFKVAFPAGKFLG V+IAE+V+ EI++ + +V   +  V       ++S   +
Sbjct: 552 CWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDYLVEKAETSV-------QYSTVLM 604

Query: 639 NGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYR 698
           N        +K + +  SS  +E++LKY+ KW+P+DHAYT+E+NP+V + PPP GVIVYR
Sbjct: 605 N-------PEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYR 657

Query: 699 MSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWR 758
           +++S+TYIN S +Y+ + D++K +TR GQL+ H KKSDRPWNDPG+WKPPKFL N+++WR
Sbjct: 658 LTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWR 717

Query: 759 KNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADR 818
           KNK K+   D  +     V D RP+LK++CLDFSQVAQ DST+LQSL+DLR+A+N YADR
Sbjct: 718 KNKNKD---DEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADR 774

Query: 819 QVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIENG----- 873
           QVEFHF+GI+SPW+K+GLV +GFGTVN+E+SDESII GH+SYH+VK    D+EN      
Sbjct: 775 QVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTE--DLENNPMTTV 832

Query: 874 --------YQVKTATGTNLPFFHIDIPDFKKWDI 899
                   Y +   TGTN PFFHI+IPDF KW+I
Sbjct: 833 EEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/909 (60%), Positives = 672/909 (73%), Gaps = 65/909 (7%)

Query: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95
           +LDNLELEY+Q+K +E  P  T  +  AD ++      + E     +S     S      
Sbjct: 3   ELDNLELEYNQFKNNE-RPSNT--NAGADIEKGLDTKKYFERSITDNSTYGKKSYS---- 55

Query: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155
                     IPSY E  +T  ++++ +LR  FT  +  +YI S+FP+++WLP YN  WF
Sbjct: 56  ----------IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWF 105

Query: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215
           + DLIAGITVG VLVPQSMSYAQIATLPP+YGLYSSFIGA +YS FATSKDVCIGPVAVM
Sbjct: 106 LSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVM 165

Query: 216 SLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274
           SL+TAK+IARV ++ P+ DP + GPIIAT  A +CG IA GVG LRLGFLVELISLNAVA
Sbjct: 166 SLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVA 225

Query: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334
           GFMTGSA NII GQ+P LMGY K VNTR +TY V++++LKHLPDTKLDA FGLIPLF L+
Sbjct: 226 GFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLF 285

Query: 335 FWRWWCNGYGPKLTDRYYPKGSR--GNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHV 392
           FW+WWCN  GPKLTDRY+P  SR   N  WK FYFY QASR+GIIII+FTA+S+ IT+ V
Sbjct: 286 FWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGV 345

Query: 393 PSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRIND 452
              +RRIS+LGTVPKGL+  G +K+P  +   IA E+P+++IVLLLEHIAISKSFGR+ND
Sbjct: 346 AKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVND 405

Query: 453 YKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALY 512
           YK+ P+QE+IAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV TPLSG+F+ +CVLLA+Y
Sbjct: 406 YKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIY 465

Query: 513 CLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIEN 572
           CLTGAFFYIPKATLSAVIIH+V DL+ASYHTTW+ +KMN  DF+ F+TT+ ITVFSSIEN
Sbjct: 466 CLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525

Query: 573 GIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGG--- 629
           GIYFA+CWSCA+LL+  AFPAGKFLGR+EIAEVV+ +I++D+       +   +  G   
Sbjct: 526 GIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYF 585

Query: 630 NKEFSKDKLNGKSDFIVKDKLDSTASSSSI--------AENKLKYYTKWVPFDHAYTREL 681
           +   ++DKL   S+ +   K ++   + SI          + ++YYTKWVPFDHAY++EL
Sbjct: 586 DNSVAEDKLGTSSNDL--KKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKEL 643

Query: 682 NPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWND 741
           NP V I PPPPGVIVYR+SDSYTYIN S HYD+I DEIKRVTRRGQL+QHR K DRPWND
Sbjct: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703

Query: 742 PGEWKPPKFLSNVLHWRK--NKKKNQTADVESLETGIV--------------RDERPVLK 785
           PGEW+ P  L    + +K  +  K +  DV++ E                  +DERP+L+
Sbjct: 704 PGEWEAPD-LKKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLR 762

Query: 786 VLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVN 845
           V+CLDFSQVA  D+T+LQSL DLRKAVN YADRQVEFHF GI SPWIKRGL  +GFGT N
Sbjct: 763 VVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTN 822

Query: 846 EEFSDESIIAGHSSYHLVK---------NTIGDIENGY------QVKTATGTNLPFFHID 890
           EE+SDESIIAGHSSYHL +         N +  +E+        +V  A+GTNLPFFH+D
Sbjct: 823 EEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVD 882

Query: 891 IPDFKKWDI 899
           IPDF KWDI
Sbjct: 883 IPDFSKWDI 891

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/882 (61%), Positives = 653/882 (74%), Gaps = 50/882 (5%)

Query: 37  LDNLELEYDQYKADELHPQRTILSNQADTDREKIANV-FVEEQSVRDSNIPSASIEELQY 95
           LD+LE EYD YKA+E      +  N ++ D      +  V+E  VR    P         
Sbjct: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGP------- 69

Query: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155
              E+ G   IP + E  V+  +++N  +R K TLN+A +Y+ S+FPI+ W PHYN+ W 
Sbjct: 70  ---EAIGGN-IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWG 125

Query: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215
             DL+AGITVGCVLVPQSMSYAQIA+LPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM
Sbjct: 126 YADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 185

Query: 216 SLETAKIIARVMKRFP-NDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274
           SL+TAK+IA+V  ++P NDP V  P+IAT  +LLCG +A GVG LRLGFLVELISLNAVA
Sbjct: 186 SLQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVA 245

Query: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334
           GFMTGSA NI+ GQVPALMGY   VNTR +TYKV++++LKHLPDTKLDAVFGL+PL +LY
Sbjct: 246 GFMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLY 305

Query: 335 FWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPS 394
            W+WWC  YGPKL DR      +   + K+FYFY+ A R+ +IIIVFTAISW IT++   
Sbjct: 306 LWKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDK 365

Query: 395 KERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYK 454
           + R I +LGTVP GL+DVG  K+P  L AK+AP++PA++IVLLLEHIAISKSFGRINDYK
Sbjct: 366 EHRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYK 425

Query: 455 VVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCL 514
           VVPDQELIAIG TNLIGTFF+AYP TGSFSRSALKAKC V+TP SG+FTG CVL+A+YCL
Sbjct: 426 VVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCL 485

Query: 515 TGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGI 574
           T AFF+IP ATLSAVIIH+VSDL+ASY TTWNF+KMNPLD   F+ T++ITVFSSIENGI
Sbjct: 486 TDAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGI 545

Query: 575 YFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFS 634
           YFA+CWSCA+LL K AFPAG+FLGRVE+AEV++  ++ D   +   D      G +K   
Sbjct: 546 YFAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLK 605

Query: 635 KDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGV 694
            DK                A S+S   N  K+++KWV   +AY RELNPDV I PPPPGV
Sbjct: 606 ADK---------------GAISASSGSN-YKFHSKWVAEQYAYNRELNPDVKILPPPPGV 649

Query: 695 IVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNV 754
           +VYRMSDS+TYIN S HYD I D IK+ TRRGQLL  RKKSDRPWNDPGEW   +   ++
Sbjct: 650 VVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEW---EISPSI 706

Query: 755 LHWRKNKKKNQTADVESLETGIV----RDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRK 810
             + K  KKNQ  D+ES +  +     RDERP+LK++CLDFSQV QVDST++QSLVDLRK
Sbjct: 707 KKFFKLGKKNQN-DIESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRK 765

Query: 811 AVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNT--IG 868
           AV+ YADRQVEFHF GIIS W+KR L+ +GFGTVN  +SDESIIAGHSSYH+ K T  + 
Sbjct: 766 AVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLA 825

Query: 869 D-----------IENGYQVKTATGTNLPFFHIDIPDFKKWDI 899
           D           ++   ++  ATGTN+PFFH+DIPDF KWD+
Sbjct: 826 DDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/809 (65%), Positives = 626/809 (77%), Gaps = 36/809 (4%)

Query: 106 IPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITV 165
           IP+Y E  VT  ++++H+++   TL +A +Y+ S+FPII WLPHYN  W   DL+AGITV
Sbjct: 76  IPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGITV 135

Query: 166 GCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIAR 225
           GCVLVPQSMSYAQIA+L P+YGLYSSFIGAFIYSLFATSKDVCIGPVAVMSL+TAK+IA 
Sbjct: 136 GCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 195

Query: 226 VMKRFPNDP-DVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNI 284
           V+K++P D  +V GPIIATT  LLCG +A G+G LRLGFLVELISLNAVAGFMTGSA +I
Sbjct: 196 VLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFSI 255

Query: 285 ISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYG 344
           I GQ+PALMGY KLVNTR ATYKV++NTLKHLP+TKLDAVFGLIPL ILY W+WWC  +G
Sbjct: 256 IWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSFG 315

Query: 345 PKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGT 404
            KL DR+Y    +     K FYFYAQA R+ ++IIVFTAIS+ ITR+   ++R ISILGT
Sbjct: 316 IKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISILGT 375

Query: 405 VPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAI 464
           VP GL +VG +K+P  L + ++ ELPA++IVL+LEHIAISKSFGRINDYKV+PDQELIAI
Sbjct: 376 VPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAI 435

Query: 465 GVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKA 524
           GVTNLIGTFFH+YP TGSFSRSALKAKCNV+TP SG+FTG+CVLLALYCLT AFFYIPKA
Sbjct: 436 GVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPKA 495

Query: 525 TLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCAL 584
           TLSAVIIH+VSDL+ASY TTWNF+KMNPLD + F+ T++ITVFSSIENGIYFA+CWSCA+
Sbjct: 496 TLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCAM 555

Query: 585 LLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDF 644
           LL K AFPAGKFLGRVE+AEV++  I          D  VS      EFSK         
Sbjct: 556 LLLKQAFPAGKFLGRVEVAEVLNPTIQGH------IDSIVSPNESPNEFSKQ-------- 601

Query: 645 IVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYT 704
            VK  +D+  SS      + K+  KWVPFDHAYTRELN    ++PPPPGVIVYR SDS+T
Sbjct: 602 -VKSSVDALPSS------EYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFT 654

Query: 705 YINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKN-KKK 763
           Y+N S HYD+I D IK  TRRGQL+  RKKSDRPWNDPGEWK P    N+   ++    K
Sbjct: 655 YVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGLATK 714

Query: 764 NQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFH 823
           N      +  T     E+P+LKV+CLDFSQVAQVDST++QSLVDLRKAVN YADRQVEFH
Sbjct: 715 NSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFH 774

Query: 824 FAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIE------------ 871
           FAGIISPWIKR L+ + FGT+NEEFSD SII GHSS+H+ K    +++            
Sbjct: 775 FAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTC 834

Query: 872 -NGYQVKTATGTNLPFFHIDIPDFKKWDI 899
            N   +  ATGTNLPFFHIDIPDF KWD+
Sbjct: 835 SNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1075 bits (2779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/879 (60%), Positives = 650/879 (73%), Gaps = 51/879 (5%)

Query: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95
           D++  E EY  Y+  E    R  L N  D +  K+        S +   +    + ++ Y
Sbjct: 17  DIEVFESEYRTYRESEAAENRDGLHN-GDEENWKV------NSSKQKFGVTKNELSDVLY 69

Query: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155
                     IP+Y E  VT  E+++HS+++  T  +A +Y++S+FPII W PHYN  W 
Sbjct: 70  --------DSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWG 121

Query: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215
             DL+AGITVGCVLVPQSMSYAQIA+L P+YGLYSSFIGAFIYSLFATSKDVCIGPVAVM
Sbjct: 122 YADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 181

Query: 216 SLETAKIIARVMKRFPNDP-DVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274
           SL+TAK+IA V+K++P D  +V  PIIATT  LLCG +A G+G LRLGFLVELISLNAVA
Sbjct: 182 SLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVA 241

Query: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334
           GFMTGSA NII GQ+PALMGY  LVNTR ATYKV++NTLKHLP+TKLDAVFGLIPL ILY
Sbjct: 242 GFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILY 301

Query: 335 FWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPS 394
            W+WWC  +G  L DRYY    +     K FYFYAQA R+ ++I+VFTAISWSITR+  S
Sbjct: 302 VWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSS 361

Query: 395 KERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYK 454
           K+R ISILGTVP GL +VG +K+P  L + ++ E+PA++IVL+LEHIAISKSFGRINDYK
Sbjct: 362 KDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYK 421

Query: 455 VVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCL 514
           VVPDQELIAIGVTNLIGTFFH+YP TGSFSRSALKAKCNV+TP SG+FTG CVLLALYCL
Sbjct: 422 VVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCL 481

Query: 515 TGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGI 574
           T AFF+IPKATLSAVIIH+VSDL+ SY TTW F+K NPLD + F+ T+ ITVFSSIENGI
Sbjct: 482 TDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGI 541

Query: 575 YFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFS 634
           YFA+CWSCA+LL K AFPAGKFLGRVE+AEV++  +  D   V+++++  +E   NK+  
Sbjct: 542 YFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNEL--NKQ-- 597

Query: 635 KDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGV 694
                      VK  ++       +   + K+  KWVPFDH Y+RELN + T++PPPPGV
Sbjct: 598 -----------VKSTVE------VLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGV 640

Query: 695 IVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNV 754
           IVYR+ DS+TY+N S HYDII D IK  TRRGQL+  RKKSDRPWNDPGEWK P  L ++
Sbjct: 641 IVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSL 700

Query: 755 LHW-RKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVN 813
             + R +   N    + +  +     E+P+LKV+CLDFSQVAQVDST++QSLVDLRKAVN
Sbjct: 701 FKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVN 760

Query: 814 AYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIE-- 871
            YADRQVEFHFAGIISPWIKR L+ + FGT NEE+SD+SIIAGHSS+H+ K    D++  
Sbjct: 761 RYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYT 820

Query: 872 -----------NGYQVKTATGTNLPFFHIDIPDFKKWDI 899
                      N   +  ATGTNLPFFHIDIPDF KWD+
Sbjct: 821 DEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/810 (65%), Positives = 623/810 (76%), Gaps = 41/810 (5%)

Query: 106 IPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITV 165
           IP Y E  VT  E++ HS+++  T  +A NY+ S+FPI+ WLPHYN  W   DL+AGITV
Sbjct: 66  IPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITV 125

Query: 166 GCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIAR 225
           GCVLVPQSMSYAQIA+L P+YGLYSSF+GAFIYSLFATSKDVCIGPVAVMSL+TAK+IA 
Sbjct: 126 GCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 185

Query: 226 VMKRFPNDP-DVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNI 284
           V+K++P D  +V GPIIAT   LLCG +   +G LRLGFLVELISLNAVAGFMTGSA +I
Sbjct: 186 VLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSI 245

Query: 285 ISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYG 344
           I GQVPALMGY KLVNTR +TYKV++NTLKHLP+TKLDAVFGLIPL ILY W+WWC  YG
Sbjct: 246 IWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYG 305

Query: 345 PKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGT 404
             L +R+Y    +     K FYFYAQA R+ ++I+VFTAISWSITR+  S++R ISILGT
Sbjct: 306 ITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISILGT 365

Query: 405 VPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAI 464
           VP GL +VG +K+P  L + ++ ELPA++IVL+LEHIAISKSFGRINDYKVVPDQELIAI
Sbjct: 366 VPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAI 425

Query: 465 GVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKA 524
           GVTNL+GTFFH+YP TGSFSRSALKAKCNV+TP SGLFTG CVLLALYCLT AFF+IPKA
Sbjct: 426 GVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPKA 485

Query: 525 TLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCAL 584
           TLSAVIIH+VSDL+ SY TTW F+K NPLD V F+ T+ ITVFSSIENGIYFA+CWSCA+
Sbjct: 486 TLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCAI 545

Query: 585 LLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDF 644
           LL K AFPAG+FLGRVE+AE+++  + N+ S V++ ++       NK+            
Sbjct: 546 LLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNE------SNKQ------------ 587

Query: 645 IVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYT 704
            VK  +D   SS      + ++ TKWVPFDH Y+RELN    I PPPPGVIVYR+SDS+T
Sbjct: 588 -VKTTVDVLRSS------EYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFT 640

Query: 705 YINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHW-RKNKKK 763
           Y+N S HYDII D +K  TRRGQL+  RKKSDRPWNDPGEWK P  L  +  + RK+  +
Sbjct: 641 YVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTE 700

Query: 764 NQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFH 823
           N+   V +  T     E+P+LKV+CLDFSQVAQVDST++QSLVDLRKAVN YADRQVEFH
Sbjct: 701 NEEPSVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFH 760

Query: 824 FAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGD-------------- 869
           FAGIISPWIKR L  + FGTVNEE+SDES+IAGHSS H+ K +  D              
Sbjct: 761 FAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAP 820

Query: 870 IENGYQVKTATGTNLPFFHIDIPDFKKWDI 899
             N   +  ATGTNLPFFHIDIPDF KWDI
Sbjct: 821 YSNYGTLCAATGTNLPFFHIDIPDFSKWDI 850

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/874 (60%), Positives = 655/874 (74%), Gaps = 41/874 (4%)

Query: 33  STPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDS-NIPSASIE 91
           + P+LD+LE EYD YK  E +P+          ++  +           D+  + +    
Sbjct: 23  AEPNLDDLEAEYDNYKNAEQNPR----------EKSDVVETLPPTTHQNDAKGLKNDGQT 72

Query: 92  ELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYN 151
            ++ +   S G  VIP Y E  V   ++++ SL S  + ++ + Y++S+FP+I W+PHYN
Sbjct: 73  TVELYGTTSSGG-VIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYN 131

Query: 152 VYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGP 211
             W   D++AG+TVGCVLVPQSMSYAQIA+LP QYGLYSSFIGAFIYS FATSKDVCIGP
Sbjct: 132 FAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGP 191

Query: 212 VAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLN 271
           VAVMSLETAK+IARV +  P+D ++ GPIIAT  +LLCG I  G+G LRLGFLVELISLN
Sbjct: 192 VAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLN 251

Query: 272 AVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLF 331
           AVAGFMTGSA +II+GQ+PALMGY + VNTR  TYKV++NTLKHLPDTKLDAVFGLIPL 
Sbjct: 252 AVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLL 311

Query: 332 ILYFWRWWCNGYGPKLTDRYY-PKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITR 390
           ILY W++ CN  GP   DR   P   R  F WK F+FYAQA R+  +I++FT I+W ITR
Sbjct: 312 ILYLWKYGCNTIGPNWVDRRMNPHSPRAKF-WKSFFFYAQALRNAFVIVLFTLIAWGITR 370

Query: 391 HVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRI 450
           H   K+  IS+L TVP GLK+VG +K P  L   +APELPAA I+LLLEHIAI+K+FGRI
Sbjct: 371 H--KKKHPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRI 428

Query: 451 NDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLA 510
           NDYKVVPDQELIAIGVTNL+GTFF+AYP TGSFSRSALKAKCNV+TPLSG+FTG+CVLLA
Sbjct: 429 NDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLA 488

Query: 511 LYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSI 570
           LYCLT AF+YIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLD +CFL T+ IT+FSSI
Sbjct: 489 LYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSI 548

Query: 571 ENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGN 630
           ENGIYFAICWSCA+LLFK+AFP+GKFLGRVE++EV++  +  D  VV             
Sbjct: 549 ENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV------------- 595

Query: 631 KEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPP 690
           ++F  + +N  S    K  L +  SS S   ++++++TKW+P ++ Y RE N  + +QPP
Sbjct: 596 EDFDSENINVASSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPP 655

Query: 691 PPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKF 750
           PPGVIVYR S+S+TYIN S  YDII DE+KR+TRRG +L H KKSDRPWNDPG+W+PP F
Sbjct: 656 PPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLF 715

Query: 751 LSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRK 810
           L  +  +++ K+  Q      L   + RDERPVLK+L +D+SQV Q+D+T +Q+LVDLRK
Sbjct: 716 LKKL--FKRGKRLEQ-----ELSPELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRK 768

Query: 811 AVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDI 870
           A+N YADRQVEFHF+GIISPWIKR LV +GFGTVN+EF+DES+I GHSSYH+VK    D 
Sbjct: 769 AINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDE 828

Query: 871 ENG-----YQVKTATGTNLPFFHIDIPDFKKWDI 899
           EN      Y +  A+GTN+PFFH+++PDF KW +
Sbjct: 829 ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/887 (60%), Positives = 650/887 (73%), Gaps = 52/887 (5%)

Query: 32  SSTPDLDNLE-LEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASI 90
           SST  LDN E  + + ++++     RT   ++A  +R+   N   +   +        + 
Sbjct: 10  SSTEVLDNQEDTDIEVFESE----YRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTK 65

Query: 91  EELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHY 150
            E+   A++S     IP+Y E  VT  E+++HS++S  T+ +A +Y+ S+FPII WLPHY
Sbjct: 66  SEVSDVAYDS-----IPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHY 120

Query: 151 NVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIG 210
           N  W   DL+AGITVGCVLVPQSMSYAQIA+L P+YGLYSSFIGAFIYSLFATSKDVCIG
Sbjct: 121 NFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIG 180

Query: 211 PVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELIS 269
           PVAVMSL+TAK+IA V+K++P    +V GPIIAT    LCG ++  +G LRLGFLVELIS
Sbjct: 181 PVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELIS 240

Query: 270 LNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIP 329
           LNAVAGFMTGSA +II GQ+PALMGY  LVNTR ATYKV++NTLKHLP+TKLDAVFGLIP
Sbjct: 241 LNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIP 300

Query: 330 LFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSIT 389
           L ILY W+WWC  +G  L DRYY    +     K FYFYAQA R+ ++IIVFTAISW IT
Sbjct: 301 LVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRIT 360

Query: 390 RHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGR 449
           R+  SKER ISILGTVP GL +VG +K+P  L + ++ ELPA++IVL+LEHIAISKSFGR
Sbjct: 361 RNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGR 420

Query: 450 INDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLL 509
           INDYKV+PDQELIAIGVTNLIGTFFH+YP TGSFSRSALKAKCNV+TP SG+FTG+CVLL
Sbjct: 421 INDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLL 480

Query: 510 ALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSS 569
           ALYCLT AFF+IPKATLSAVIIH+VSDL+ SY TTW F+K NPLD + F+ T+ ITVFSS
Sbjct: 481 ALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSS 540

Query: 570 IENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGG 629
           IENGIYFA+CWSCA+LL K AFPAGKFLGRVE+AEV++  +    + V ++++  +E   
Sbjct: 541 IENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELPNELSK 600

Query: 630 NKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQP 689
             + + D L                        + K+  KW+PFDH Y+RELN    ++P
Sbjct: 601 QVKSTVDVLPAP---------------------EYKFSVKWIPFDHDYSRELNRYTKVRP 639

Query: 690 PPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPK 749
           PPPGVIVYR++DS+TY+N S HYDII D IK  TRRGQL+  RKKSDRPWNDPGEWK P 
Sbjct: 640 PPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPN 699

Query: 750 FLSNVLHWRKNKKKNQTAD----VESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSL 805
               +    K K+K+ T D    V S        E+P+LKV+CLDFSQVAQVDST++QSL
Sbjct: 700 SFKALF---KFKRKSATTDNELPVSSGRNNQESYEKPLLKVVCLDFSQVAQVDSTAVQSL 756

Query: 806 VDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKN 865
           VDLRKAVN YADRQVEFHFAGIISPWIKR L+ + FGT NEE+SD+SIIAGHSS+H+ K 
Sbjct: 757 VDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKV 816

Query: 866 TIGDIE-------------NGYQVKTATGTNLPFFHIDIPDFKKWDI 899
              D++             N   +  ATGTNLPFFHIDIPDF KWD+
Sbjct: 817 LKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 863

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/893 (58%), Positives = 643/893 (72%), Gaps = 52/893 (5%)

Query: 32  SSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQ---SVRDSN---- 84
           S  PD D LE EYD  K  E+      +SN          +   E++   S+ D+N    
Sbjct: 26  SVGPDFDQLEQEYDDLKTSEIIAPH--ISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGF 83

Query: 85  ---------IPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKN 135
                        +IE++    +  D  +V P+Y E  V   + ++  LR   T +A   
Sbjct: 84  KKHDNGNGKFADVNIEQI----YNYDSLRV-PNYEETVVDAKQLYDEKLRPYLTFSAIVE 138

Query: 136 YILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGA 195
           Y+ S+FP++ W+ HYN  W   DL+AGITVGCVLVPQSMSYAQIATLP QYGLYSSF+GA
Sbjct: 139 YLTSLFPLLKWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGA 198

Query: 196 FIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPND-PDVQGPIIATTTALLCGGIAA 254
           FIYS FATSKDVCIGPVAVMSLETAK+IARV+++   D P++  PIIATT +L+CGG+A 
Sbjct: 199 FIYSFFATSKDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVAL 258

Query: 255 GVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLK 314
           GVG LRLGFLVE ISLNAVAGFMTGSA+NI+SGQVP LMGY K VNTR +TYKVI+NTLK
Sbjct: 259 GVGLLRLGFLVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLK 318

Query: 315 HLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGS-RGNFLWKKFYFYAQASR 373
           HLPDTKLDAVFGLIPLFILY W+++C   GPKL DRY  +   +    +K   FY QA R
Sbjct: 319 HLPDTKLDAVFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALR 378

Query: 374 SGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAV 433
           +  +II+FT ISW ITRH   ++  IS+LGTVP GLK+VG +K+P  L + +A ELP+A+
Sbjct: 379 NAFVIIIFTLISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAI 438

Query: 434 IVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCN 493
           I+L+LEHIAISK+FGR+N YKVVPDQELIAIGVTNLI TFF+AYP TGSFSRSALKAKCN
Sbjct: 439 IILVLEHIAISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCN 498

Query: 494 VKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPL 553
           VKTPLSG+FTG+CVLL+LYCLT AF++IPKA LSA+IIH+VSDLVASY TTWNF+ MNPL
Sbjct: 499 VKTPLSGIFTGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPL 558

Query: 554 DFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEI-IN 612
           DFVCF+ T+IIT+FSSIENGIYFA+CWSCALLL KV FP G+FLG VEI +V + E+  N
Sbjct: 559 DFVCFIVTVIITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDEN 618

Query: 613 DNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVP 672
            + +V++ D        N          K++  VK       ++ S   ++L+Y+TKW+P
Sbjct: 619 IDRIVLSEDSQPKTIEDNVT--------KNNTAVK---VGVVANESFGHSQLQYHTKWLP 667

Query: 673 FDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHR 732
            ++ Y RELNPDV +Q PPPGVIVYR S+S+TY+N S  YD I D +K +TR G+LL+H 
Sbjct: 668 LNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHV 727

Query: 733 KKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFS 792
            K D+ WNDPGEW+PP  +         KK  +  +   LE G V DERPVLK+L +D+S
Sbjct: 728 SKHDKMWNDPGEWEPPFLV---------KKLFKLGNKHDLEGGEVIDERPVLKILAMDWS 778

Query: 793 QVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDES 852
           QV Q+DST +Q+LVDLRKA+N YA+RQVEFHF+GIISPWIKR L+  GFGTVNEEFSDES
Sbjct: 779 QVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDES 838

Query: 853 IIAGHSSYHLVKNT--IGDIENGY----QVKTATGTNLPFFHIDIPDFKKWDI 899
           II GH+SY LVKN   + D E        + TA G NLPFFH+++P+F KW +
Sbjct: 839 IIVGHTSYSLVKNRPDLQDPEAALPEPIALHTALGVNLPFFHLEMPEFHKWHL 891

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/888 (58%), Positives = 634/888 (71%), Gaps = 42/888 (4%)

Query: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95
           DLD+L+ EY Q+K  E H   T   +       + A  F  E      +       +   
Sbjct: 29  DLDDLDAEYGQFKNAE-HSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVA 87

Query: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155
            A   +    +  + E  VT  EF++ +LRS FTL    NY+ S+ PI+ WLPHYN  W 
Sbjct: 88  PAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWL 147

Query: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215
            QDL+AGITVGCVLVPQSMSYAQIATL PQYGLYSSF+GAFIYS FATSKDVCIGPVAVM
Sbjct: 148 YQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVM 207

Query: 216 SLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAG 275
           SL+TAK I+ V+   P D ++  P+IAT  ALLCG I+ G+G LRLGFLVELIS  AVAG
Sbjct: 208 SLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAG 267

Query: 276 FMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYF 335
           FMTGSALNII+GQVPALMGY KLVNTRT+TYKVI+N+L+HLPDTKLDAVFGL+PL ILY 
Sbjct: 268 FMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYV 327

Query: 336 WRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSK 395
           W+W C+  GP+L  RY   GSR + +W   + Y QA R+ ++I+VFTAI+W ++ H   K
Sbjct: 328 WKWGCSTGGPRLVQRY---GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMS-HRALK 383

Query: 396 E---RRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRIND 452
           E    RIS+LGTVP GLKDVG +KVP  L +KIAPELPA+VIVL+LEHIAISK+FGR+ND
Sbjct: 384 EGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVND 443

Query: 453 YKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALY 512
           Y+VVPDQELIAIG TNLIGTFF+AYP TGSFSRSALKAKCNV TPLSGLF+G+CVLLA+Y
Sbjct: 444 YRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIY 503

Query: 513 CLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIEN 572
           CLT AF +IPKATLSAVIIH+VSDL+ASY TTW+F++++P D VCFL T++ITVFSSIEN
Sbjct: 504 CLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIEN 563

Query: 573 GIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGGNKE 632
           GIYFA+CWS A+LLF+ AFPAGKFLGRV+IAE           V M++ +        ++
Sbjct: 564 GIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNREK 623

Query: 633 FSKDKLNGKSDFIVKDKLDSTASSSSIAENKL---------------------KYYTKWV 671
             +      S  +  + L  TA   + A N                       +++TKWV
Sbjct: 624 ERETTFTAVS--VSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWV 681

Query: 672 PFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQH 731
           PFD  YTRELNP+V + PPPPGVIV+R S+S+TY+N S  YD I DE+ R+TRRG+    
Sbjct: 682 PFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIV 740

Query: 732 RKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDF 791
            K S RPWNDPGEW PPKFL  +        K+ + D+E+    + RDERPVL+V+ +D+
Sbjct: 741 AKSSSRPWNDPGEWHPPKFLRKLF-------KSSSEDLEN--RAVARDERPVLRVIAMDW 791

Query: 792 SQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDE 851
           SQVAQVDST LQ+L DLRKAVN YADRQVEFHFAGII PW+KRGL+  GFGTVN+EF+DE
Sbjct: 792 SQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADE 851

Query: 852 SIIAGHSSYHLVKNT-IGDIENGYQVKTATGTNLPFFHIDIPDFKKWD 898
           S++ GH S H+ ++    + E       ATGTNLPFFH+++PDF +WD
Sbjct: 852 SLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/906 (57%), Positives = 652/906 (71%), Gaps = 66/906 (7%)

Query: 31  VSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASI 90
           +S   +LD+LE EYDQYKA E              DRE++     +E    D ++    +
Sbjct: 30  LSEVSNLDDLEQEYDQYKAAE--------------DRERVVGRGDDEY---DDDLRKGKV 72

Query: 91  E----ELQYFAHESDGA-------KVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILS 139
           +    EL+Y+ + ++G          +PSY EG V   + F H L+ + TL A K+Y  S
Sbjct: 73  DYKETELEYW-NSTNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFES 131

Query: 140 IFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYS 199
            FPII WLP YN  W   DL+AGITVGCVLVPQSMSYAQIATLPPQYGLYSSF+GAFIYS
Sbjct: 132 AFPIIKWLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYS 191

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFP-NDPDVQGPIIATTTALLCGGIAAGVGF 258
            FATSKDVCIGPVAVMSLETAK+I   +++FP  D +V GP+IAT  ALLCG +A G G 
Sbjct: 192 FFATSKDVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGV 251

Query: 259 LRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPD 318
           LRLGFLVELISLNAVAGFMTGS+LNIISGQVPALMG+ K V+TR +TYK+I+N+LK+L  
Sbjct: 252 LRLGFLVELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKH 311

Query: 319 TKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIII 378
           T+LDAVFGLIPL +LY W+WWC+ YGPKL DR++    +   + K FYFYAQA RS +II
Sbjct: 312 TQLDAVFGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVII 371

Query: 379 IVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLL 438
           IVFTAIS+ IT+    K  RIS+LG VPKGLKDV  +++P  L +K+   +P+A+I+LLL
Sbjct: 372 IVFTAISYGITKG--RKTPRISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLL 429

Query: 439 EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPL 498
           EHI+I+KSFGR+N+YKVVPDQELIAIG TNLIGTFF+AYP TGSFSRSALKAKCNV+TPL
Sbjct: 430 EHISIAKSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPL 489

Query: 499 SGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCF 558
           SG+F+G+CVLLALYCLT  F+YIP ATLSAVIIH+VSDL ASY T+WNFYKMNP DF+ F
Sbjct: 490 SGVFSGACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAF 549

Query: 559 LTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVM 618
           + T+ ITVFSSI+ GIYFA+CWS A+ L K  F  G+FLGRVE+AEVV+ ++  D +V  
Sbjct: 550 IVTVFITVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQV--DPNVES 607

Query: 619 TTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAE---------------NK 663
            ++   S   G +  S  + + K      D LD +A  S+                   K
Sbjct: 608 VSESAGSHLDGFQAQSSIESSSKK----LDPLDKSAVHSNYLNGGDDGSDNNINNQIGQK 663

Query: 664 LKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVT 723
           L Y+TKW+ +D +Y+RE NP+V IQPPPPGVIVYR  DSYTY+N S HYDII DE++R T
Sbjct: 664 LVYHTKWISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTT 723

Query: 724 RRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETGI----VRD 779
           RRGQ++   KK DRPWNDPGEW+ P++   +    K K   + A+ E+ E+      ++D
Sbjct: 724 RRGQMISAVKKVDRPWNDPGEWEAPRWFKKLT--SKKKTAEEWAETEAQESKAAEQKLQD 781

Query: 780 ERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKI 839
            RP+LK++CLDFSQ +Q D+T++Q+L DLRK VN YADRQVEFH  G+ +PW+KR LV  
Sbjct: 782 NRPLLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNF 841

Query: 840 GFGTVNEEFSDESIIAGHSSYHLVKNTIGDIENG------YQVKTATGTNLPFFHIDIPD 893
           GFGTVNEE+SDES++AGH SYH+ +     +E+G      Y V  A+GTNLPFFH++IPD
Sbjct: 842 GFGTVNEEYSDESLLAGHRSYHVARAPT-SLEDGLGSPAQYSVYPASGTNLPFFHVEIPD 900

Query: 894 FKKWDI 899
           F KWD+
Sbjct: 901 FSKWDL 906

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/868 (58%), Positives = 624/868 (71%), Gaps = 25/868 (2%)

Query: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95
           DLD+L+ EY  +K  E H +   +     ++      V    +  +D N   +       
Sbjct: 11  DLDDLDAEYGHFKNTE-HSE---IGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66

Query: 96  FAHESDGAKVIP-SYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYW 154
            A+E       P +Y E  VT  E+++ ++R   T +  + Y+  + P+I+WLPHYN  W
Sbjct: 67  GANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRW 126

Query: 155 FIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAV 214
           F QD++AGITVGCVLVPQSMSYA IATLPPQ+GLYSSF+GA IYS FATSKDVCIGPVAV
Sbjct: 127 FYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAV 186

Query: 215 MSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274
           MSL+TAK +++VM   P D D+  P++AT  A LCG I+ G+G LRLGFLVELIS  AVA
Sbjct: 187 MSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVA 246

Query: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334
           GFMTGSALNIISGQ+PALMGY KLVNTRT+TYKVI+ TLKHLPDTKLDAVFGLIPL +LY
Sbjct: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306

Query: 335 FWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPS 394
            W+W CN  GP+L +RY  +GSR   +W    FY QA R+ +IIIVFTAI+WSI+ H   
Sbjct: 307 TWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHH--K 364

Query: 395 KERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYK 454
           K+  IS+LG VP GLKDVG +K+P  L AKIAPELPA+VIVLLLEHIAI+K+FGR+NDY+
Sbjct: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424

Query: 455 VVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCL 514
           VVPDQELIAIG TNL+GTFF+AYP TGSFSRSALKAKCNV TPLSG+F+G+CVLLA+YCL
Sbjct: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484

Query: 515 TGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGI 574
           T AF YIPKATLSAVIIH+VSDL+ASY TTW+ +++NPLD VCFL T+ I VFSSIENGI
Sbjct: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544

Query: 575 YFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGG----N 630
           YFA+CWS A+LLFKVAFP  +FLGRVEIAE+   E ++  S          +  G    +
Sbjct: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGVSYAS 604

Query: 631 KEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPP 690
              S +  N K   I   +  S     +       ++TKWVPF+  YTRELNP V +  P
Sbjct: 605 GSVSSESFNAKKQGI---EGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQP 660

Query: 691 PPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKF 750
           PPGVIV+R S+S+TY+N +  Y+ I DE+ R TRRG+ +Q   KS RPWNDPGEW PPKF
Sbjct: 661 PPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHPPKF 719

Query: 751 LSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRK 810
           L     W   K        ESLE G+V D+RPVL+V+ +D+SQVAQVDST LQ+L DLRK
Sbjct: 720 LRK---WFGKKYS------ESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRK 770

Query: 811 AVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDI 870
           AV+ YADRQVEFHF+GIISPWIKRGL+  GFGTVNEE +DES++ GH +Y + +      
Sbjct: 771 AVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGD 830

Query: 871 ENGYQVKTATGTNLPFFHIDIPDFKKWD 898
           E     + ATG N+PFFH ++PDF KWD
Sbjct: 831 EEALLPQPATGVNMPFFHAEMPDFSKWD 858

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/915 (55%), Positives = 640/915 (69%), Gaps = 72/915 (7%)

Query: 31  VSSTPDLDNLELEYDQYK-ADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSAS 89
           ++ + DL+  ELEYD  K  D+ H +           R+  + V +EE + +  N     
Sbjct: 5   INGSIDLERFELEYDHGKRGDDTHDRVEA--------RDLYSKVDIEEVTFQCDNYSGR- 55

Query: 90  IEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPH 149
                    + + +  IP Y E  VT  +F+   +   F++     Y+ S+FP++ WLPH
Sbjct: 56  --------LDVNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPH 107

Query: 150 YNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCI 209
           YN+ W IQDLIAGITVGCVLVPQSMSYAQIATL PQYGLYSSFIGAFIYS FATSKDVCI
Sbjct: 108 YNLDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCI 167

Query: 210 GPVAVMSLETAKIIARVMKRFPNDPDV--QGPIIATTTALLCGGIAAGVGFLRLGFLVEL 267
           GPVAVMSL+TAK+I RV      D       PIIAT  ALLCG I+ G+GFLRLGFL+E 
Sbjct: 168 GPVAVMSLQTAKVIERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEF 227

Query: 268 ISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGL 327
           ISLNAVAGFMTGSA NII GQVPALMGY K VNTR +TY+V++NTLKHLPDTKLDAVFGL
Sbjct: 228 ISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGL 287

Query: 328 IPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKK---------FYFYAQASRSGIII 378
           IPL ILY  +W+ +  GP+  ++     +R N   ++         ++FY+ A R+G++I
Sbjct: 288 IPLSILYLCKWFFSSLGPQYLNKL---SNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVI 344

Query: 379 IVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLL 438
           IVFTAISW+ITR   S    ISILGTVPKGLK+V   KVP  L  K+AP+LP+++I+LLL
Sbjct: 345 IVFTAISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLL 404

Query: 439 EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPL 498
           EHIAISKSFGR+NDYK+VPDQELIAIGVTNLIGTFF AYP TGSFSRSALKAKC+VKTPL
Sbjct: 405 EHIAISKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPL 464

Query: 499 SGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCF 558
           SGLF+G+CVLLALYCLTGAF+YIPKATLSAVIIH+VSDL+ASY TT NFYKMNPLDFVCF
Sbjct: 465 SGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCF 524

Query: 559 LTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEI-INDNSVV 617
           +TT+ ITVFSSIE GIYFAIC+SCA L+FK  FP G FLG ++IAEV++  +  ND +++
Sbjct: 525 ITTVFITVFSSIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTIL 584

Query: 618 MTTDDCVSEFGGNKEFSKD---------KLNGKSDFIVKDKLDSTASSSSIAENKLKYYT 668
           +  DD  S  G  +E +KD           N KS      +  S   SS+     L YY 
Sbjct: 585 L--DDSSSVLG--EENTKDDSVKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYV 640

Query: 669 KWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQL 728
           +WVP  + Y RE+NP + I PPPPG+IVYR  DS+TY+N S HYDII DE+K+ TR+G  
Sbjct: 641 RWVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGIS 700

Query: 729 LQHRKKSDRPWNDPGEWKPPKFLSNVLHWRK-------NKKKNQTADVESLETGIVRDER 781
             +++K DRPWND GEW+ PK L N+ +  K       ++ K+    +ES       D +
Sbjct: 701 NVYKRKQDRPWNDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNK 760

Query: 782 PVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGF 841
           P LK++C DFSQV Q D+T++QSL DLRKAVN Y+++Q+E+HF+GIIS W+K+ L+++GF
Sbjct: 761 PELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGF 820

Query: 842 GTVNEEFSDESIIAGHSSYHLVKNTIGDIENG-----------------YQVKTATGTNL 884
           GTVN+ +SD+SII GH SYH+ K  I + E+G                 Y ++T TGTN 
Sbjct: 821 GTVNDNYSDKSIIIGHQSYHVSK--INNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNY 878

Query: 885 PFFHIDIPDFKKWDI 899
           PFFHIDIPDF  W++
Sbjct: 879 PFFHIDIPDFSNWEL 893

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/904 (54%), Positives = 620/904 (68%), Gaps = 67/904 (7%)

Query: 1   MTERRHSFRQEDSDNSFPXXXXXXXXXXXXVSSTPDLDNLELEYDQYKADELHPQRTILS 60
           M+ + H+ R    D   P                 D++ L+ EYDQ KA E+H      S
Sbjct: 1   MSRQVHTGRSSSDDTGAPQWPSRNSVL------NDDIEALQAEYDQLKAGEVH------S 48

Query: 61  NQADTDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFF 120
            Q  T  +      +  +    S  P+A     QY     +  + +P Y E  V+  +++
Sbjct: 49  AQGATHGD------IGSRQYSGSGKPAA-----QYLGLNVNSREAVPEYEETVVSVKDYY 97

Query: 121 NHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIA 180
           N+ LR   +LN A++Y LS+FP+  W+ HYNV W   D++AGITVGCVLVPQSMSYAQ+A
Sbjct: 98  NYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLA 157

Query: 181 TLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI 240
           +L PQYGLYSSF+GAFIYS FATSKDVCIGPVAVMSLETAK+IARV +  P D ++ GPI
Sbjct: 158 SLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPI 217

Query: 241 IATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVN 300
           IAT   LLCG IA  +G LRLGFLVE IS+ AV GFMTGSAL+IISGQVP+LMGY K VN
Sbjct: 218 IATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVN 277

Query: 301 TRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYP-KGSRGN 359
           TR  TYKVI+ +LKHL DT ++A FGL+PL +L+ W+W C   GP+L DRY   K SR +
Sbjct: 278 TRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRAS 337

Query: 360 FLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPP 419
             W   +FY QA R+ +II+VFTAISW I+RH   K   IS+LG VP GLK+VG +++P 
Sbjct: 338 -RWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVPSGLKNVGPLELPE 395

Query: 420 ELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPT 479
            L  K+ PELPAA I+LLLEHIAI+KSFGRIN+YKVVPDQELIAIGVTNL  TFF+AYP 
Sbjct: 396 GLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPA 455

Query: 480 TGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVA 539
           TGSFSRSALKAKCNVKTPLSGLFTG+CVLLALYCLT AF++IPKATLSAVIIH+V+DL+A
Sbjct: 456 TGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIA 515

Query: 540 SYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGR 599
           SY  TW F++ NPLDF  F+ T+IITVFSSIE+GIYF+I WSCA+LL KVAFP GKFLG 
Sbjct: 516 SYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVLLCKVAFPDGKFLGY 575

Query: 600 VEIAEVVDGE---IINDNSVVMTTDDCVSEFGGNKEFSK-DKLNGKSDFIVKDKLDSTAS 655
           +++AEV++      IN  + + + D+  +       F + DK  GK + +          
Sbjct: 576 IDVAEVIEPAGPPSINSEADLASIDNSAT-------FQQIDKDGGKLNTV---------- 618

Query: 656 SSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDII 715
            S + +   +++ +W+P DHAY+RELNP+  + PPPPGVIVYR +DS+TY+N S H+DII
Sbjct: 619 ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDII 678

Query: 716 IDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETG 775
           +D +K  TR GQL+ H    +R W DPG W+PP+     +      K+  +A        
Sbjct: 679 LDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFI----ADKRTGSA-------- 726

Query: 776 IVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRG 835
            V D RPVL+VL +D+SQV+QVDST +Q+LVDLR A+N YADR VEFHFAGI+SPWIKR 
Sbjct: 727 -VADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRA 785

Query: 836 LVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIG--DIENGYQVKTATGTNLPFFHIDIPD 893
           LV  GFG      +D  +I+   SYHLV+       I +G+ V  A GTN PFFH+D+PD
Sbjct: 786 LVNTGFG-----IADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPD 840

Query: 894 FKKW 897
           F+ W
Sbjct: 841 FETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/878 (50%), Positives = 602/878 (68%), Gaps = 46/878 (5%)

Query: 31  VSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASI 90
           +  T  LD LE +Y ++K +E     +   + A+ +R +I        S++ +     ++
Sbjct: 34  LQDTSGLDELETDYTRFKTNE----DSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNAL 89

Query: 91  EELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHY 150
            + +            P Y E  VT +E+++ ++RS+   +  ++Y LS+FPII W+ HY
Sbjct: 90  PDFK-----------APPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHY 138

Query: 151 NVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIG 210
           N  W   D IAGITVGCVLVPQSMSYAQ+A L P+YGLYSSFIGAFIYS FATSKDVCIG
Sbjct: 139 NFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIG 198

Query: 211 PVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISL 270
           PVAVMS++ +K+I+ V+ + P    +  P++A+  AL    +   +G LRLGF++ELIS+
Sbjct: 199 PVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISV 258

Query: 271 NAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPL 330
            AVAGFMTGSAL+I++ Q+P+L+G  K +NTR  TY+V+++TLKHL  + ++A FGLI L
Sbjct: 259 TAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICL 317

Query: 331 FILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISW-SIT 389
            +L+FW+W C   GPKL  +Y    S+   +W+ F+FYAQA R+  ++ + T +SW  I 
Sbjct: 318 ALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIG 377

Query: 390 RHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGR 449
           RH   K+  IS+LGTVP GLK VG   +P  L  K+ P+LP AVI+LLLEHI I+KSFGR
Sbjct: 378 RH--KKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGR 435

Query: 450 INDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLL 509
           IN+YK+VPDQELIAIGVTNLIG+FF+AYP TGSFSRSALKAKCNVKTPLSGLF+G+CVLL
Sbjct: 436 INNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLL 495

Query: 510 ALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSS 569
           ALY LT AF+YIPKA LSAVIIH+V DL+ASY  ++  +  NP D + FL TI++T+FSS
Sbjct: 496 ALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSS 555

Query: 570 IENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTD-DCVSEFG 628
           IENGIYFA+ +S A LL K AFP+GKFLG V+I EV +  +  D   +   D +   E  
Sbjct: 556 IENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEIS 615

Query: 629 GNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQ 688
            + + +KD     S  ++  KLD            ++++TKWVP D+ Y+RELNP++ + 
Sbjct: 616 KDSKLAKDPDVHASANLMASKLD------------VRFHTKWVPLDNGYSRELNPEIAVH 663

Query: 689 PPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPP 748
            PPPGVIVYR ++S+ Y+N S  +DII+D +K +TR G+L+ H +KS++ W +PG+W PP
Sbjct: 664 MPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPP 723

Query: 749 KFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDL 808
            FL         K +++ A  E +E     D RPVLK+L +D++QV  VDSTS+QSL+DL
Sbjct: 724 LFLRKFF----KKYRHKAAKPEVVEQ---VDNRPVLKILAMDWTQVTHVDSTSIQSLIDL 776

Query: 809 RKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIG 868
           RK +N YADRQV FHF+GI+SPWIKR LV  GFGT+NE +S++ ++  +S+YH+V+N + 
Sbjct: 777 RKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLS 836

Query: 869 DIENGYQ-------VKTATGTNLPFFHIDIPDFKKWDI 899
             E   Q       +  A+GTN PFFHID+PDF KWDI
Sbjct: 837 ADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  534 bits (1376), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 273/508 (53%), Positives = 356/508 (70%), Gaps = 26/508 (5%)

Query: 109 YVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCV 168
           Y E  VT +E FNH +   FT  + K Y+LS+ PI  W+ HYN+ WFI D+IAGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 169 LVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMK 228
           LVPQSMSYAQIATL PQYGLYSS +G FIY++FATSKD+CIGPVA+MSL+TAK IA V +
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 229 RFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQ 288
           +    PD+   IIA+T A++CG I  G+G LRLGF ++LI + AV GF +GSA NI+ GQ
Sbjct: 123 K---HPDIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 289 VPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLT 348
           +P LMGY K VNTR  TYKV+V+TLK LP T ++AV GLIPLF L+ W++ C+ Y  +  
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD-YALR-- 236

Query: 349 DRYYPKGSRGNFL-W-KKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVP 406
                   RGN   W K+  FY  + R  I+II+ +A ++       +K   + +LG +P
Sbjct: 237 --------RGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYG------AKNPSLKVLGKIP 282

Query: 407 KGL---KDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIA 463
           KG     D     +P +L + I  E+PA+VIVL+LEH++I+KSF R+N+Y+V  DQEL A
Sbjct: 283 KGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTA 342

Query: 464 IGVTNLIGT-FFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIP 522
           IGV+N++G     AYP TGSFSR+ALKA+C V+TPL  +F+G CV++A+  LT A  +IP
Sbjct: 343 IGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIP 402

Query: 523 KATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSC 582
           KATLSAVIIH+VS L++SY  T   YKM PLD + FL TI ITVFS IE G+YFA+CW+C
Sbjct: 403 KATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWAC 462

Query: 583 ALLLFKVAFPAGKFLGRVEIAEVVDGEI 610
            LL+ ++AFP G FLG V + E+    I
Sbjct: 463 FLLMIRIAFPYGAFLGYVRVREISRSSI 490

 Score =  206 bits (523), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 152/262 (58%), Gaps = 28/262 (10%)

Query: 631 KEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPP 690
           ++  +  ++   D I+  +L          E+       W+P+ H +TRELNP V I PP
Sbjct: 649 EQLDQSSVDENQDNIINKRLTRQLVYDHELEHDTPTEIIWIPYSHRFTRELNPHVKIHPP 708

Query: 691 PPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQL-LQHRKKSDRPWNDPGEWKPPK 749
           PPGV+VYR SDS TYIN S +YD IID IK  T+ G++ +       +PWN+PG W+ PK
Sbjct: 709 PPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEIDVLSDALYVKPWNNPGPWEKPK 768

Query: 750 FLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLR 809
                       K  + AD E      + D+RP L++LCLDFSQVAQ+DST+LQ+L+DLR
Sbjct: 769 L-----------KFWEHADPEIARKKRMADKRPTLRILCLDFSQVAQIDSTALQALIDLR 817

Query: 810 KAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEF----SDESIIAGHSSYHLVKN 865
             VNAY    VE+HF GIISPW++R L++IGFG +N+EF    +D S +           
Sbjct: 818 HEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEFFPKVNDSSTV----------E 867

Query: 866 TIGDIENGYQVKTATGTNLPFF 887
            I D+E  Y  + A G N+PFF
Sbjct: 868 VISDLE--YNGELALGENVPFF 887

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 131/522 (25%), Positives = 220/522 (42%), Gaps = 64/522 (12%)

Query: 82  DSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIF 141
           D+N  S S E +    H  DG      Y + +V +    N+  RS  T +   +Y+   F
Sbjct: 9   DTNGSSDSAEAIS--QHNEDGL----VYNQEDVQDRIAINN--RSILTTSNIWDYLAYYF 60

Query: 142 PIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYSL 200
           P   W+P+Y +  F+ DL AG++V    +P ++SYA  +A + P  GLYS  I  FIY++
Sbjct: 61  PCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAI 120

Query: 201 FATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLR 260
           F +   + +GP + +SL   + +  ++    +D  +    I+     + G     +G  R
Sbjct: 121 FGSVPQMIVGPESAISLVVGQAVEPMVN---HDERISTISISIVVTFISGSFLLFLGIFR 177

Query: 261 LGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKV----IVNTLK-- 314
           LGFL  ++S   + GF+      +I   + + +   K++ T    Y      I+  +K  
Sbjct: 178 LGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYG 237

Query: 315 ----HLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQ 370
               H P T + +++  I L ++   +        +L  R         F W  F     
Sbjct: 238 QHNYHAP-TAILSLYSFIILMLMKVMK-------KRLMKR---------FKWVIFV---- 276

Query: 371 ASRSGIIIIVFTAISWSITRHVPSKER-RISILG--------TVPKGLKDVGAIKVPPEL 421
                I+I++   I +S   H   K +  ISI+G        ++   L     + + P L
Sbjct: 277 ---PEILIVIVGTIMFSF--HFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLL 331

Query: 422 PAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTG 481
            A I        ++   E    SK+ G   D  V  ++EL+A+G  N++G+ F A P  G
Sbjct: 332 DAGI-----VCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFG 386

Query: 482 SFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASY 541
            + RS + A    +T +SG+  GS  L  +          P   LS V       L+   
Sbjct: 387 GYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEA 446

Query: 542 HTTWNFYKMNP--LDFVCFLTTIIITVFSSIENGIYFAICWS 581
            T   FY  +    + +    T I T+F S+E GI    C+S
Sbjct: 447 PTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYS 488

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 135/535 (25%), Positives = 228/535 (42%), Gaps = 63/535 (11%)

Query: 92  ELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIF-------PII 144
           E   F  +SD +K + S      +EL+  N S    F L + +   +S +       P  
Sbjct: 31  ESHLFHRQSDSSKSLTS-----PSELQDVNSSPMRSF-LTSEQLVKMSFYDRLKYYLPCF 84

Query: 145 HWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYSLFAT 203
            WLP Y +  F  D+IAGIT+    +P ++SYA  +A + P  GLYS  I  F+Y +F +
Sbjct: 85  SWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYCVFGS 144

Query: 204 SKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI-IATTTALLCGGIAAGVGFLRLG 262
              + +GP + +SL    ++ + +++     +  G I I+     L G I    G  RLG
Sbjct: 145 VPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAILLIFGITRLG 200

Query: 263 FLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHL----PD 318
           FL  ++S   + GF++   L ++   +   +   KL+ T    Y      ++ L    P+
Sbjct: 201 FLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFKYGPE 260

Query: 319 T--KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGI 376
              K  A+  L    IL   R+       KL  RY           K   F+ +     I
Sbjct: 261 NLHKPTAILSLCSFIILMTLRFL----KKKLMKRY-----------KSVIFFPE-----I 300

Query: 377 IIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVL 436
           ++IV +++  S+  ++  K+  IS+LG       D     +  +  +     L   ++  
Sbjct: 301 LLIVISSLIISVNFNL-KKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCHELLSVGLMCA 359

Query: 437 LL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCN 493
           +L   E    SKS G I D  +  ++EL+A+G  NL+G+ F A P+ G + RS + A   
Sbjct: 360 ILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSG 419

Query: 494 VKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAV--------IIHSVSDLVASYHTTW 545
            +T +SG   G   L  +  L     Y P   LS +        +  + SD+   +H   
Sbjct: 420 AQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDI--RFHIRC 477

Query: 546 NFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV 600
           + Y     + + F    + T+  S+E GI     +S   ++   A    + L RV
Sbjct: 478 HGYN----ELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRV 528

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 124/487 (25%), Positives = 202/487 (41%), Gaps = 56/487 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP+YN+   I DLIAG+++    +P ++S+A  +A + P  GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +  +   + +GP + +SL   + + +++    ++PD+    ++     + GG     G  
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMIS---HNPDLHTLQLSAVITFISGGFLFFFGLC 206

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           RLGFL  ++S   + GF++   L +I   + +     K++      Y        H P  
Sbjct: 207 RLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHY--------HTPFE 258

Query: 320 KLDAVFGLIPLFILYFWRWWCNGY-GPK-----------LTDRYYPKGSRGNFLWKKFYF 367
           K           IL+   +  N Y GP            +  +   K       W  F  
Sbjct: 259 K-----------ILFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLMPRCRWIVFV- 306

Query: 368 YAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTV-PKGLKDVGAIKVPPELPAKIA 426
                   I++++   I  SI ++       IS +G    KGL D     +  E    I 
Sbjct: 307 ------PDILLLIIGTIFLSI-KYRFKHNYSISTVGDFNTKGL-DKLLNPLSAENRGLIP 358

Query: 427 PELPAAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSF 483
             L A  I  +L   E    SKS G   D  +  ++EL+A+G  NL  +   + P  G +
Sbjct: 359 QLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGY 418

Query: 484 SRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLV--ASY 541
            RS + A    +T +SG F G  VLL +  L     YIP   LS V       L+  A  
Sbjct: 419 GRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPA 478

Query: 542 HTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE 601
              ++F      + + F  T++ T+F S+E G    IC  C   +  +   + K   R++
Sbjct: 479 DLMFHFRCFGYDELLVFTLTVLTTMFYSVEVG----ICIGCGYSVISIIKHSAK--SRIQ 532

Query: 602 IAEVVDG 608
           I   V G
Sbjct: 533 ILARVQG 539

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 123/487 (25%), Positives = 202/487 (41%), Gaps = 56/487 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y       D+IAGI+V    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +  +   + +GP + +SL   + +  +     N   +    I+T    + G I    G  
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLHKENVSLID---ISTVITFVSGTILLFSGIS 221

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           R GFL  ++S   + GF++   L +I   + + +   K + +    Y      +  L D 
Sbjct: 222 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 281

Query: 320 K------LDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASR 373
                    A+F    L +L+  R                       L +K   Y +++ 
Sbjct: 282 APAQYHIPTAIFSGCCLIVLFLTR----------------------LLKRKLMKYHKSAI 319

Query: 374 SGIIIIVFTAISWSITRHVPSKERR-ISILGTVPKGLKDVGAIKVPPELP-AKIAPEL-P 430
               I++   ++  I+     K R  ISI+G     + +   +K P   P  K+ P+L  
Sbjct: 320 FFPDILLVVIVTILISMKFNLKHRYGISIIGDF--SMDNFDELKNPLTRPRRKLIPDLFS 377

Query: 431 AAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487
           A++IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P  G + RS 
Sbjct: 378 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSK 437

Query: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAV-IIHSVSDLVA-----SY 541
           + A    ++ +SG+F G   L+ +  L     YIP   LS +  I  +S L        +
Sbjct: 438 INALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKF 497

Query: 542 HTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE 601
           H     +     +   F  T   T+F SIE G    IC  C   +  +   + K   R++
Sbjct: 498 HLRCGGFS----ELFVFAVTFCTTIFYSIEAG----ICIGCVYSIINIIKHSAK--SRIQ 547

Query: 602 IAEVVDG 608
           I   V G
Sbjct: 548 ILARVAG 554

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 129/502 (25%), Positives = 211/502 (42%), Gaps = 51/502 (10%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P + W+P+YN   F  D IAG+++    +P  +S+A  +A + P  GLYS  +  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           LF +   + +GP + +SL   + +  +     +D  ++   IAT  + + G      G  
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTS---HDLSLETVDIATMISFMSGLTLLFGGIF 188

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           RLGFL  ++S   + GF++     +I   +   +   KL+ T    Y        H P  
Sbjct: 189 RLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHY--------HTPFE 240

Query: 320 KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIII 379
           K           IL+  R+  + Y   L   +         +  + +      R   I+ 
Sbjct: 241 K-----------ILFLVRYGPSNY--HLPTSFLSLAVFTTLMTIRIFKKKMMRRIKWIVF 287

Query: 380 VFTAISWSITRHVPS------KERRISILGTV-PKGLKDVGAIKVPPE------LPAKIA 426
           +   +S  I   V S      K+  IS++G     G  D    + P        +PA   
Sbjct: 288 IPEILSVVIFSIVLSYMCDLKKKYDISVIGDFNTDGFDD---FRNPLSKCNRGLIPALRD 344

Query: 427 PELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRS 486
             L +A++  L E I  SKS G   +     ++EL+A+G+ N IG+ F   P  G + RS
Sbjct: 345 VSLVSALLGFL-ESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRS 403

Query: 487 ALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIH-SVSDLVASYHTTW 545
            + A    +T ++G+F GS  L  +  L     YIP   LS +     VS L  + H   
Sbjct: 404 KINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIK 463

Query: 546 NFYKMNPLD-FVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAE 604
              +    D  + F+ T + T F SIE GI     +S   ++   A    + L RVE  +
Sbjct: 464 FHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARVEGTD 523

Query: 605 VVDGEIINDNSVV---MTTDDC 623
                 IN N  +   + +D+C
Sbjct: 524 ----HFINANEYLQLDLDSDNC 541

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 125/487 (25%), Positives = 205/487 (42%), Gaps = 56/487 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y       D+IAGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +  +   + +GP + +SL   + +  +     N   +   I+ T    + G I    G  
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVIT---FVSGAILLFSGIS 211

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPD- 318
           R GFL  ++S   + GF++   L +I   + + +   K + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLIDY 271

Query: 319 -----TKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASR 373
                 K  A+F      IL   R        KL  R+           K   F+     
Sbjct: 272 APAQYHKPTAIFSGCCFIILIVMRLL----KKKLMKRH-----------KSAVFFPD--- 313

Query: 374 SGIIIIVFTAISWSITRHVPSKERR-ISILGTVPKGLKDVGAIKVP-PELPAKIAPEL-P 430
               I++   ++  I+  +  K+R  ISI+G     + +   +K P      K+ P+L  
Sbjct: 314 ----ILLVVIVTILISMKLSLKQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 431 AAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487
           A++IV +L   E    SKS G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLS---AVIIHSVSDLVAS---Y 541
           + A    ++ +SG+F G   L+ +  L     YIP   LS    VI  S+ + V     +
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 542 HTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE 601
           H     Y     +   F  T  +T+F SIE+G    IC  C   +  +   + K   R++
Sbjct: 488 HLQCGGYS----ELFVFAVTFGVTIFYSIESG----ICIGCVYSILNIIKHSAK--SRIQ 537

Query: 602 IAEVVDG 608
           I   + G
Sbjct: 538 ILARIAG 544

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 126/502 (25%), Positives = 217/502 (43%), Gaps = 52/502 (10%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y+    ++D IAG ++    +P +MSY+  +A +PP  GL +     F+Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + I + MK   +D  +    +      + G I    G +
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEKQMK---HDKSLDVVNLCLILTFISGAILFCFGIM 186

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           R G+L  ++S   + GF++   L ++   +   +   K+ N     Y        H P  
Sbjct: 187 RFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPFQ 238

Query: 320 KLDAVFGLIPL-FILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIII 378
           KL  +F   P  + +       + +   ++ R   K  R + ++KK  F  +      I+
Sbjct: 239 KLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKK--RLSRVYKKVIFVPE------IL 290

Query: 379 IVFTAISWSITRHVPSKER-RISILGTVPKGLKDVGAIKVP-PELPAKIAPEL-PAAVIV 435
           IV   ++   + H   K R  I I+G +  G  D    + P  +    +  EL  A  +V
Sbjct: 291 IVVALVTLG-SYHFSFKLRYNIDIVGDIEVG--DTSKFRNPLSKKNLSLFSELFHAGFMV 347

Query: 436 LLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKC 492
            LL   E    SKS G   +  V  ++EL+A+G  NL+G+ F A P+ G + RS + A  
Sbjct: 348 ALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYS 407

Query: 493 NVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVII--------HSVSDLVASYHTT 544
              T +SG+F G    +    L  A  +IP   LS +           + +DL   YH  
Sbjct: 408 GAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADL--RYHFR 465

Query: 545 WNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAE 604
              Y     + + F  T++ T F S+E GI       C   + +V   + K   +++I  
Sbjct: 466 CRGYN----ELLIFALTVLTTFFYSVEAGITLG----CGYSVIRVIKNSTK--SKIQILR 515

Query: 605 VVDG--EIINDNSVVMTTDDCV 624
            V G  + +N +    +T+ CV
Sbjct: 516 RVSGTDQFVNADDFNSSTNTCV 537

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/464 (24%), Positives = 195/464 (42%), Gaps = 58/464 (12%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P ++WLP+Y     + DL+AGIT+    +P ++SYA  IA + P  GLY+  +  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F ++  + +GP   +SL   + +    K   ++PD+   +I     L+ G I    G  
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKK---HNPDLDPILIVIAVTLISGTILLISGIF 226

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           RLG+L  +++   + GF+         G V  +M    L+N       ++ +T +H    
Sbjct: 227 RLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADTPEHYNTP 276

Query: 320 KLDAVFGLIPLFILYFWRWWCNGYGPKLTD------------RYYPKGSRGNFLWKKFYF 367
            L  VF          W++    +    T             R + K       W  F  
Sbjct: 277 FLKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIFIP 327

Query: 368 YAQASRSGIIIIVFT---AISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAK 424
                 + ++I+ +    A ++ I      K    SI    P   K+ G I V   +   
Sbjct: 328 EILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHN-PLSNKNRGLIHVVFNIGII 386

Query: 425 IAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFS 484
            A       I    E    SK+ G  ++  V  ++EL+A+G++N++ +   A P+ G + 
Sbjct: 387 TA-------IFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 485 RSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAV-------IIHSVSDL 537
           RS + A    KT LSG+F G   +LA+  L     YIP   LS +       ++  +   
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKE 499

Query: 538 VASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWS 581
           V S+H  W     N L  +    T + ++F S+E  +Y    +S
Sbjct: 500 V-SFH--WRCRGYNELFLIVL--TFMTSIFYSVETSMYIGCVYS 538

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 152/573 (26%), Positives = 245/573 (42%), Gaps = 70/573 (12%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   W+P Y  +  I D +AGI++    +P ++SYA  IA + P  GLYS  I  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + +  ++K   +D  ++   I+     + G     +G L
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSV-ELLK--SHDSALEIINISVVLTFISGAALLILGIL 205

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKL-----VNTRTATYKVIVNTLK 314
           RLGFL  ++S + + GF++   L +I   +   +   KL     V+  T+  KV    +K
Sbjct: 206 RLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQF-LIK 264

Query: 315 HLPDT--KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQAS 372
           + P    K  A+   I    L+  R         L  R+  K     F+ +         
Sbjct: 265 YAPTNYHKPTALLSAIAFVTLFSIRL--------LKKRWMAKHRWLAFIPEILMV----- 311

Query: 373 RSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPE-LPA 431
              +II ++ + +W        K+  I I+G       D     +  E   KI P+ L  
Sbjct: 312 ---VIISIYLSATWEF-----KKQYGILIVGDFNTHAIDKLKNPISKE-NRKIMPQLLNT 362

Query: 432 AVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSAL 488
            V++ LL   E +  SKS G   D  +  ++EL+A+G  N+I + F A P+ G + RS +
Sbjct: 363 GVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSKI 422

Query: 489 KAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVI-IHSVSDL-VASYHTTWN 546
            A    KT +SG+F GS  L+ +  L     YIP   LS +  I  +S L  A     ++
Sbjct: 423 NAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSELKFH 482

Query: 547 FYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE----- 601
           F      +   F  T++ T+  S+E GI     +S   ++   A    + LGRV+     
Sbjct: 483 FRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQGTREF 542

Query: 602 --IAEVVDGEIINDNSVVMTTDDCVSEFGG-------------NKEFSKDKLNGKSDFIV 646
             I E +D + I D   + T    + E  G             N +  K++LN    F  
Sbjct: 543 ANIDEYLDSDPIGD---IETNKFVLEEIEGCLIVKIPEPLTFTNTDDLKERLNRLERF-- 597

Query: 647 KDKLDSTASSSSIAENKLKYYTKWVPFD-HAYT 678
                S  +       + K YTK V FD H  T
Sbjct: 598 ----GSVKAHPGGPGGRSKDYTKCVIFDLHGMT 626

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 189/410 (46%), Gaps = 41/410 (10%)

Query: 134 KNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 193
           K+Y+    PI+ WLP Y+     +D++AG+T+    +P ++S   +A + P  GLY+  I
Sbjct: 41  KSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVI 100

Query: 194 GAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIA 253
              IY++F +   + +GP  V SL    ++ +    + +   ++  +       + G + 
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVASL----VVGQSCDAWAHK-SLEPLMTVAVIGCISGVLV 155

Query: 254 AGVGFLRLGFLVELISLNAVAGFMTGSAL-NIISGQVPALMGYGKLVNTRTATYKVIVNT 312
             +G  RLGF+   IS   + GF +  A+  +I+  +P L      ++ R   YK     
Sbjct: 156 FAMGIFRLGFIDNAISKAFLKGFTSALAVVMLITELLPQLQ-----IDDR---YK----- 202

Query: 313 LKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLT---------DRYYPKGSRGNFLWK 363
            + L + K+ +      +F L   R + N +  KL+          +Y  K     + W 
Sbjct: 203 -QALKEGKVGSAAWDKLVFALENAREYSNPFSVKLSVAAFSILLLSKYLKKYLTAKYGWT 261

Query: 364 KFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPA 423
           K  F+       ++++V  +I  S      +K   + I+G +P   KD   IKVP +   
Sbjct: 262 KLTFFPD-----LLLVVLGSILLSFYYDWDNK-YNLPIVGDLPPN-KD--HIKVPIQSFQ 312

Query: 424 KIAPELPAAVIVLLLEHIAISKSFGRIN---DYKVVPDQELIAIGVTNLIGTFFHAYPTT 480
           +      A+ +V +L     + +F  I+   D  V  ++EL+++G+ N++G+ F + P  
Sbjct: 313 EFKDLFDASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAF 372

Query: 481 GSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVI 530
           G + RS L   C  +TP++G+F     +  +  L G F Y+P   L+ +I
Sbjct: 373 GGYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVII 422

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 129/487 (26%), Positives = 208/487 (42%), Gaps = 56/487 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y       D+IAGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + +  +     N   +   I+ T    + G I    G  
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVIT---FVSGAILLFSGIS 211

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDT 319
           R GFL  ++S   + GF++   L +I   + + +   K + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 271

Query: 320 K------LDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASR 373
                    A+F    L IL+  R        K     Y KG+          F+     
Sbjct: 272 APAQYHMPTAIFSGCCLIILFLMRLL------KRKLLKYHKGA---------IFFPD--- 313

Query: 374 SGIIIIVFTAISWSITRHVPSKERR-ISILGTVPKGLKDVGAIKVP-PELPAKIAPEL-P 430
             I+++V   I  S+   +  K R  I+I+G     + +   +K P      K+ P+L  
Sbjct: 314 --ILLVVIVTILISMKFDL--KHRYGITIVGDF--SMDNFDKLKNPLTRSRRKLIPDLFS 367

Query: 431 AAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487
           A++IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSK 427

Query: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLS---AVIIHSVSDLVAS---Y 541
           + A    ++ +SG+F G   L+ +  L     YIP   LS    VI  S+ + V S   +
Sbjct: 428 INALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKF 487

Query: 542 HTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE 601
           H     Y     +   F  T  +T+F SIE G    IC  C   +  +   + K   R++
Sbjct: 488 HLRCGGYS----ELFVFAVTFGVTIFYSIEAG----ICIGCVYSILNIIKHSAK--SRIQ 537

Query: 602 IAEVVDG 608
           I   V G
Sbjct: 538 ILARVAG 544

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 121/487 (24%), Positives = 200/487 (41%), Gaps = 55/487 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P + WLP YN   F  D I+GI++    +P ++SYA  IA + P  GLYS  I   IY 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRF----PNDPDVQGPIIATTTALLCGGIAAG 255
           +  +   + +GP   +SL   + + ++   +      D  +    I+ T   L G +   
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 256 VGFLRLGFLVELIS-------LNAVAGFMTGSALNIISGQVPALMGYGKLVNTR--TATY 306
            G LRLGFL  ++S       +++V G M   AL I   ++  ++    + N R     +
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDAL-ITEMKLNCIL----IDNDRHYHTAF 288

Query: 307 KVIVNTLKHLPDT--KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKK 364
           + I+  +K+ P+   K   V  ++   ILYF R+    Y  K                K 
Sbjct: 289 EKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRYCKKKYIIK---------------HKS 333

Query: 365 FYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAK 424
             F  +     I+I+V +    S + +       ISI+G V     ++ A  +   L + 
Sbjct: 334 LIFLPE-----ILIVVISTGILSASYNF-KDNYGISIIGDVNSNNSNLIAGNLQNPLSSS 387

Query: 425 IAPELP-------AAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAY 477
                P       A   +   E    SKS G   +  +  ++EL+A+GV NL  +     
Sbjct: 388 NKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGL 447

Query: 478 PTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVI----IHS 533
           P+ G + RS + A    KT +SG+  G   +L +  L     +IP   LS +     +  
Sbjct: 448 PSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSL 507

Query: 534 VSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPA 593
           + +        W     N L  + F  T   T+F S+E GI     +S   ++   A   
Sbjct: 508 IEEAPGEVKFHWRCKGYNEL--IIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSR 565

Query: 594 GKFLGRV 600
            + LGR+
Sbjct: 566 IQILGRI 572

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 213/510 (41%), Gaps = 65/510 (12%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P + W+PHY+   F  DL+AGI++    +P ++SYA  IA + P  GLYS  I   IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRF-PNDPDVQGPIIATTTALLCGGIAAGVGF 258
           +F +   + +GP + +SL    ++ +  ++F  +D ++    I      + G +   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 259 LRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPD 318
           +RLGFL  ++S   + GF++   L +I   +   +     +      Y   V  +  L  
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFR 249

Query: 319 ------TKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQAS 372
                  K  A+  LI   +L   R        KL +RY            +F  +    
Sbjct: 250 YASEYYHKPTAILSLICFLVLISTRIA----KKKLMNRY------------RFLIFVPE- 292

Query: 373 RSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVP-----PELPAKIAP 427
              I+++V   I  S+ ++       IS +G         G+I  P       L + +  
Sbjct: 293 ---ILLVVSVTILLSL-KYDFKHSYGISTIGEFNA--DGFGSIGNPLSNENRALYSSLWN 346

Query: 428 ELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487
           E  A  ++   E    SKS G   +     ++ELIA+G  N++G+ F A P+ G + RS 
Sbjct: 347 EGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSK 406

Query: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLS---AVIIHSVSDLVAS---Y 541
           +      KT +SG   G   LL    L     Y P   LS    VI  S+ + V S   +
Sbjct: 407 VNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKF 466

Query: 542 HTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVE 601
           H   + Y     +   F  T I T+  S+E G+     +S  L++   A      L R++
Sbjct: 467 HIHCSGYS----ELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSA------LSRIQ 516

Query: 602 IAEVVDG--EIINDNSVVMTTDDCVSEFGG 629
           I   ++G  E +N        DD +  + G
Sbjct: 517 ILAKLEGSDEFVN-------VDDYIKNYNG 539

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 125/483 (25%), Positives = 208/483 (43%), Gaps = 44/483 (9%)

Query: 134 KNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSF 192
           K+ I    P   W+P Y+V   + D IAG+++    +P +MSYA  +A +PP  GLYS  
Sbjct: 67  KDTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLV 126

Query: 193 IGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGI 252
               +Y++  +   + +GP + +SL   + I     R   DP ++   I      + G +
Sbjct: 127 FSPAVYTVLGSVPQMIVGPESAISLILGQAIE---ARLSEDPKLKAINICLVITFISGLV 183

Query: 253 AAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATY----KV 308
               G LRLGFL  ++S   + GF++G  + ++   +   +    +  TR   Y    + 
Sbjct: 184 LLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEK 243

Query: 309 IVNTLKHLPDT--KLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFY 366
           ++  +K+ P+   K  A+  L+   IL   R +   YG K             F W    
Sbjct: 244 VLFIMKYGPENYHKPTAILSLVAFVILMSLRIFKKRYGKK-------------FKWLVLL 290

Query: 367 FYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELP--AK 424
                    I+++V  +I  S   H+ S+   I I+  +PK    +  +K P      A 
Sbjct: 291 -------PDILVVVALSIFVSYKMHLKSR-YGIEIINDIPK--DSMKHLKNPFSNVNVAT 340

Query: 425 IAPELPAAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTG 481
                    +V +L   E    SKS G   +  +  ++ELIA+G  N++G+ F   P  G
Sbjct: 341 FKDLFSTGFMVAMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFG 400

Query: 482 SFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLV--- 538
            + RS + A    +T +SG F G   L  +  L     YIP   LS  +I +V  L    
Sbjct: 401 GYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILS--VITTVVGLTLLE 458

Query: 539 -ASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFL 597
            A +   +++      +   F  T++ T+F S+E GIY     S   ++   A    + L
Sbjct: 459 EAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQIL 518

Query: 598 GRV 600
           GRV
Sbjct: 519 GRV 521

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 122/488 (25%), Positives = 202/488 (41%), Gaps = 58/488 (11%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y       D+IAGI++    +P ++SY   IA +PP  GLYS  I  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +  +   + +GP + +SL   + +  +     N   +    I+     + G I    G  
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLID---ISVVITFVSGAILLFSGIS 211

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPD- 318
           R GFL  ++S   + GF++   L +I   + + +   K + +    Y      +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLIDY 271

Query: 319 -----TKLDAVFGLIPLFILYFWRWWCNGYGPKLTDR-YYPKGSRGNFLWKKFYFYAQAS 372
                 K  A+F    L +L+  R              ++P                   
Sbjct: 272 APAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPD------------------ 313

Query: 373 RSGIIIIVFTAISWSITRHVPSKERR-ISILGTVPKGLKDVGAIKVP-PELPAKIAPEL- 429
              I+++V  AI  S+   +  K R  I+I+G     + +   +K P      K+ P+L 
Sbjct: 314 ---ILLVVIVAIFISMKFSL--KHRYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLF 366

Query: 430 PAAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRS 486
            A++IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS
Sbjct: 367 SASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRS 426

Query: 487 ALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLS---AVIIHSVSDLVAS--- 540
            + A    ++ +SG+F G   L+ +  L     YIP   LS    VI  S+ + V     
Sbjct: 427 KINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIK 486

Query: 541 YHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV 600
           +H     Y     +   F  T  +T+  SIE G    IC  C   +  +   + K   R+
Sbjct: 487 FHLRCGGYS----ELFVFAVTFGVTILCSIEAG----ICIGCVYSILNIIKHSAK--SRI 536

Query: 601 EIAEVVDG 608
           +I   V G
Sbjct: 537 QILARVAG 544

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 109/467 (23%), Positives = 196/467 (41%), Gaps = 64/467 (13%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y++  F  D IAG+++    +P +MSYA  IA + P  GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + I  +++   +DP +    +      + G +    G  
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIR---HDPSLSSLDLCVIITFISGVVLFTFGVF 213

Query: 260 RLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATY----KVIVNTLK- 314
           R GFL  ++S   + GF++   + ++   +   +   K+ +   + Y    + ++  +K 
Sbjct: 214 RFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIKY 273

Query: 315 -----HLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYA 369
                HLP + L     LI +                          +    ++   F+ 
Sbjct: 274 APANYHLPTSLLSLCCFLILM-------------------SLRLIKKKLLKRFRSLVFFP 314

Query: 370 QASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAP-- 427
           +     I+++V T I +S    +  +   I ++G +   + D    K+   L     P  
Sbjct: 315 E-----ILLVVVTVIFFSYNFDLKHR-YNIEVVGDIEASVFD----KLRNPLSKNKRPFY 364

Query: 428 --ELPAAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGS 482
                A  +V +L   E    SKS G   D  V  ++EL+A+G  NLIG+ F A P+ G 
Sbjct: 365 GDLFSAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGG 424

Query: 483 FSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAV--------IIHSV 534
           + RS + A    +T +SG   G+  +  +  L     YIP   LS +        +  + 
Sbjct: 425 YGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAP 484

Query: 535 SDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWS 581
           +DL   +H     Y     + + F+ T++ T F S+E GI     +S
Sbjct: 485 ADL--RFHIRCRGYN----ELISFIITVLTTFFYSVEAGITVGCGYS 525

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 115/483 (23%), Positives = 207/483 (42%), Gaps = 47/483 (9%)

Query: 134 KNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 193
           K+YI    PI+ W P Y+     +DL+AGI++    +P ++S + +A + P  GL+S  I
Sbjct: 41  KSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVI 100

Query: 194 GAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIA 253
              IY++F +   + +GP  V+SL   +           D  V   +IA T+    G I 
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVVSLVVGQ-SCEAWSHKSVDSLVTVAVIACTS----GFIL 155

Query: 254 AGVGFLRLGFLVELISLNAVAGFMTGSA-LNIISGQVPALM---GYGKLV---NTRTATY 306
             +G  R+GF+   IS   + GF+   A + +I+  +P L     Y   V   N  T T+
Sbjct: 156 LSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTTTW 215

Query: 307 KVIVNTLKHLPD------TKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPK--GSRG 358
                 LK+ P+       KL  +   I +   Y  +++    G KL  R++P       
Sbjct: 216 DKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKKYFTEKRGSKLC-RFFPDLLLVVA 274

Query: 359 NFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVP 418
            F++   Y+   +S  G  II           ++P  +    +  T  K  K++  I   
Sbjct: 275 GFIYLS-YYNDWSSTMGTRII----------GNLPPNKNHFKVPITSFKEFKELFDISF- 322

Query: 419 PELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYP 478
                          I+ L +     K+ G   D  +  ++EL+++G+ N++ + F A P
Sbjct: 323 ------------LVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSALP 370

Query: 479 TTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLV 538
             G + RS L   C+ +TP++G+      +  +  + GAF Y+P   L+ +I +   +L+
Sbjct: 371 AFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLL 430

Query: 539 ASYHTTWNFY--KMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKF 596
               +   FY       + + F+  ++ T+  S + G+   +  +   LL        + 
Sbjct: 431 EEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRVQI 490

Query: 597 LGR 599
           LGR
Sbjct: 491 LGR 493

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 103/445 (23%), Positives = 185/445 (41%), Gaps = 47/445 (10%)

Query: 172 QSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFP 231
            S+S + +A LPP  GLYS  I   IY +  T     +GP  V+SL   +       R  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHR-S 59

Query: 232 NDPDVQGPIIATTTALLC--GGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQV 289
            +P      ++T   + C  GGI   +G  R+GF+   +S   + GF++  AL ++  ++
Sbjct: 60  LEP------LSTVAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITEL 113

Query: 290 PAL----------MGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWW 339
                        +  G +  T    ++ I+       DT              + W   
Sbjct: 114 LPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLS 159

Query: 340 CNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRI 399
              +   +T RY  +       WKK  F+ +     I+I+V  +I+ S T+   S+ + I
Sbjct: 160 LFTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQKW-SELKGI 213

Query: 400 SILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLL---EHIAISKSFGRINDYKVV 456
            I+G +P    +   IKVP +  ++       + ++ +L   E   + KS    ++    
Sbjct: 214 KIIGDIPP---NSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDAS 270

Query: 457 PDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTG 516
            ++EL+++GV NL+ + F A P  G + RS +   C  +T  SG+F     ++ +  L  
Sbjct: 271 SNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMN 330

Query: 517 AFFYIPKATLSAVIIHSVSDLVASYHTTWNFY--KMNPLDFVCFLTTIIITVFSSIENGI 574
           AF ++P   L+ +I      L+        FY       +   F+  ++ T+  S + G+
Sbjct: 331 AFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGV 390

Query: 575 YFAICWSCALLLFKVAFPAGKFLGR 599
              +C +   LL        + LGR
Sbjct: 391 TMGMCLTMIRLLKHSTRSRVQILGR 415

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 73/146 (50%), Gaps = 4/146 (2%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   WLP Y+   FI DLIAG ++    +P +MSY+  +A +PP  GL +      +Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + I ++ K   +D  +    +      + G I    G +
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTK---HDASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 260 RLGFLVELISLNAVAGFMTGSALNII 285
           R GFL  ++S   + GF++   L ++
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMV 227

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 78/175 (44%), Gaps = 5/175 (2%)

Query: 431 AAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487
           A  +V LL   E    SKS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLV--ASYHTTW 545
           + A     T +SG+F G   L+    L  A  +IP   LS +       L   A     +
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKF 477

Query: 546 NFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRV 600
           +F      + + F  T++ T F S+E GI     +S    +        + LGR+
Sbjct: 478 HFRCRGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRI 532

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 4/146 (2%)

Query: 141 FPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYA-QIATLPPQYGLYSSFIGAFIYS 199
            P   W+P Y    F+ DL+AGIT+    +P ++SYA  +A + P  GLYS     FIY+
Sbjct: 82  LPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYA 141

Query: 200 LFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFL 259
           +F +   + +GP + +SL   + + ++     ++ ++    I+     + G      G  
Sbjct: 142 IFGSVPQMIVGPESAISLVVGQAVEKLRA---HNHEISTMSISVLVTFISGMFLFVFGIC 198

Query: 260 RLGFLVELISLNAVAGFMTGSALNII 285
           R GFL  ++S   + GF++   + +I
Sbjct: 199 RFGFLGNVLSRALLRGFISSVGVVMI 224

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 90/197 (45%), Gaps = 10/197 (5%)

Query: 424 KIAPEL-PAAVIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPT 479
           ++AP L  A  IV +L   E    +KS G   ++ +  ++EL+A+G  NL  +   A P 
Sbjct: 347 ELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPA 406

Query: 480 TGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAV-IIHSVSDL- 537
            G + RS + +    +T +SG+  G  VLL +        YIP   LS +  I  +S L 
Sbjct: 407 FGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLE 466

Query: 538 VASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFL 597
            A     ++F      + + F  T++ T F S+E G+     +S   ++   A    + L
Sbjct: 467 EAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQIL 526

Query: 598 GRVEIAEVVDGEIINDN 614
            RVE      G+ IN +
Sbjct: 527 ARVE----STGQFINSD 539

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 92/443 (20%), Positives = 158/443 (35%), Gaps = 77/443 (17%)

Query: 190 SSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIA-RVMKRFPNDPDVQGPIIATTTALL 248
           S+ I  FIYS   +S   CIG   +        +A  +M+  P + +    I  T    +
Sbjct: 254 STIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYV 313

Query: 249 CGGIAAGVGFLRLGFLVELISLNAVAGFMTGSAL-NIISGQVPALMGYGKLVNTRTATYK 307
              +  G+ FL LG L     L  + GF     L   I G    L+  G  V TR A ++
Sbjct: 314 ISSMFTGLTFLTLGKL----RLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFE 369

Query: 308 VIVNTLKHL-PDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYY---PKGSRGNFLWK 363
             +  +K L  DT +              W+W      P L         K  + + +  
Sbjct: 370 YSLPLIKELFTDTSM-------------LWKWLT----PTLLTVVLILTQKCFKRSLVLP 412

Query: 364 KFYFYAQASRSGIIIIV-------FTAISWSITRHVPS-------------KERRISILG 403
            FY         I+ I+            W  +   P+             K   + +  
Sbjct: 413 SFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFK 472

Query: 404 TVPK--GLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQEL 461
            +P    L   G + VP  +PA                 +A+S    +++ Y V  D+EL
Sbjct: 473 QIPTMLALTFFGILHVPINVPA-----------------LAMSV---QMDKYDV--DKEL 510

Query: 462 IAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYI 521
           IA G++NL+   F +      ++ S L  +    +P +G       ++ +        +I
Sbjct: 511 IAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFI 570

Query: 522 PKATLSAVI-IHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICW 580
           P   + ++I +     LV +   TW+  K+   ++V  +  ++         GI   I  
Sbjct: 571 PICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILI 628

Query: 581 SCALLLF---KVAFPAGKFLGRV 600
           +C   L    K+    G+F G+V
Sbjct: 629 ACFKFLIDSSKLQTINGEFSGKV 651

>KAFR0L01590 Chr12 complement(287887..288741) [855 bp, 284 aa] {ON}
           Anc_7.366 YLR190W
          Length = 284

 Score = 35.0 bits (79), Expect = 0.61,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 42/103 (40%), Gaps = 13/103 (12%)

Query: 715 IIDEIKRVTRRGQLLQHRKKSD--RPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESL 772
           ++ E+ R +R    L  + K +  R W     W PP   S  + WR  + +     + S 
Sbjct: 1   MVSEVMRSSRISSCLDEQNKENFVRLWESTSSWNPP---SRKITWRTGRPRMLPVGLPSR 57

Query: 773 ETGIVR--DERPV------LKVLCLDFSQVAQVDSTSLQSLVD 807
            T +VR   ERP+        +L     +  + DS S+ S  D
Sbjct: 58  NTKLVRVLTERPINLANHSSHLLNEVLKETTKFDSNSISSATD 100

>AGL321W Chr7 (105059..105580) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR104C (SOD1)
          Length = 173

 Score = 34.3 bits (77), Expect = 0.80,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 35/84 (41%), Gaps = 12/84 (14%)

Query: 335 FWRWWCNGYGPKLTDRYYP--KGSRGNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHV 392
           +WRWW  G G  LT R     KG  G  +    +F  +A  +       T ISW+IT   
Sbjct: 7   YWRWWLGGNGSILTLRAVAVLKGDAG--VSGVVHFEQEADAA------VTTISWNITGFE 58

Query: 393 PSKERRISI--LGTVPKGLKDVGA 414
           P+ E    I   G V  G    G+
Sbjct: 59  PNTEHGFHIHEFGDVTNGCTSSGS 82

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 56/134 (41%), Gaps = 5/134 (3%)

Query: 450 INDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLL 509
           ++ Y V  D+ELIA G +NLI  F  +      ++ S L  +    +P++G+       +
Sbjct: 555 VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 510 ALYCLTGAFFYIPKATLSAVIIHSVSDLVA-SYHTTWNFYKMNPLDFVCFLTTIIITVFS 568
            +        +IP   + ++I     +L+  +   TW   K+ P +++     +I     
Sbjct: 613 VMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVV 670

Query: 569 SIENGIYFAICWSC 582
               GI   I  +C
Sbjct: 671 DFVIGIIVGILLAC 684

>NCAS0C02490 Chr3 (464074..466293) [2220 bp, 739 aa] {ON} Anc_8.480
           YPL029W
          Length = 739

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 18/90 (20%)

Query: 620 TDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTR 679
           T DC + +  N++F K+      D  +K       S+++  E+KLK YT     D+ Y +
Sbjct: 71  TIDCDNVYTKNEQFRKE-----LDLALKRIYQDQVSAATRKESKLKKYTWCKLRDYIYQQ 125

Query: 680 ELNPDV-------------TIQPPPPGVIV 696
             NPD+             TIQP  P  I+
Sbjct: 126 LNNPDLDSIIDQYRTTLYKTIQPNEPKTII 155

>NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {ON}
           Anc_4.364 YJR134C
          Length = 759

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 33  STPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEE 92
           S  D+D LE      K DEL  + + L++Q D D EKI+N+  E++S+      S+ +E 
Sbjct: 401 SKDDIDKLE-----KKIDELKLENSQLNSQLDKDHEKISNLTEEKKSL------SSELES 449

Query: 93  LQYFAHE 99
           L    H+
Sbjct: 450 LNKSLHD 456

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,831,743
Number of extensions: 4299699
Number of successful extensions: 11918
Number of sequences better than 10.0: 58
Number of HSP's gapped: 12015
Number of HSP's successfully gapped: 74
Length of query: 899
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 780
Effective length of database: 39,836,145
Effective search space: 31072193100
Effective search space used: 31072193100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)