Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020608.266ON28628615260.0
KAFR0B027408.266ON2562752936e-31
Kwal_56.237778.266ON2672522273e-21
NDAI0B020108.266ON2812702241e-20
SAKL0H16940g8.266ON3033192135e-19
NCAS0B050408.266ON2732902082e-18
KLTH0G13596g8.266ON2672112063e-18
TDEL0F039308.266ON2802801871e-15
Kpol_392.48.266ON2812711731e-13
ZYRO0C01562g8.266ON2772861651e-12
Suva_10.1758.266ON2992951572e-11
YLR091W (GEP5)8.266ON2932911501e-10
Smik_12.1508.266ON2922901465e-10
AGR082C8.266ON2661941376e-09
Skud_12.1598.266ON2942901377e-09
KLLA0F19228g8.266ON3052771351e-08
Ecym_43048.266ON2892221305e-08
TPHA0J007608.266ON249239950.001
TBLA0D018805.484ON23048720.94
Ecym_24128.659ON44035711.7
ACR126W8.659ON43668683.7
NOTE: 1 genes in the same pillar as KNAG0G02060 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02060
         (286 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...   592   0.0  
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   117   6e-31
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    92   3e-21
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    91   1e-20
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...    87   5e-19
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    85   2e-18
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    84   3e-18
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...    77   1e-15
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    71   1e-13
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    68   1e-12
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    65   2e-11
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    62   1e-10
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    61   5e-10
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    57   6e-09
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    57   7e-09
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    57   1e-08
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    55   5e-08
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    41   0.001
TBLA0D01880 Chr4 (460408..461100) [693 bp, 230 aa] {ON} Anc_5.48...    32   0.94 
Ecym_2412 Chr2 complement(801242..802564) [1323 bp, 440 aa] {ON}...    32   1.7  
ACR126W Chr3 (570854..572164) [1311 bp, 436 aa] {ON} Syntenic ho...    31   3.7  

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/286 (100%), Positives = 286/286 (100%)

Query: 1   MNTVRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQY 60
           MNTVRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQY
Sbjct: 1   MNTVRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQY 60

Query: 61  KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATL 120
           KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATL
Sbjct: 61  KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATL 120

Query: 121 KHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIKLQVPV 180
           KHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIKLQVPV
Sbjct: 121 KHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIKLQVPV 180

Query: 181 AEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAAR 240
           AEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAAR
Sbjct: 181 AEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAAR 240

Query: 241 SGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSFALRMLCPT 286
           SGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSFALRMLCPT
Sbjct: 241 SGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSFALRMLCPT 286

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  117 bits (293), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 132/275 (48%), Gaps = 40/275 (14%)

Query: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKS--IPRLKHVAETLQNFHDVPSTKKHTQYK 61
           VR  +   +  LPLH  TL +L   +    +  IP L+          DV S +   + K
Sbjct: 16  VRDKITNAIEGLPLHQKTLLQLQDTLKRNDALAIPLLR----------DVVSYETTGKSK 65

Query: 62  ILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATLK 121
            L +++ +LY QW      L+ +P HL P    +  L   WP E H+  K +     +L+
Sbjct: 66  FLESIIYRLYFQW------LNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLR 119

Query: 122 HAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIKLQVPVA 181
           +AW+ N   A+ +S        TS      G ++ IL+H++ L  N     K K+ +P+ 
Sbjct: 120 NAWMRNKATAVDLS--------TSD-----GVIKPILNHFRYLRVNEDRLCKKKVGLPIL 166

Query: 182 EIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARS 241
           E+PLNVFG EIP CR  NLL++++ +VK+ L+E+ P L  +  + +    I  D    R+
Sbjct: 167 EVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPML--SPKLEDTLHSIINDSKNTRA 224

Query: 242 GNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVH 276
                  L+R+Y R+ +  YT  S  ++  N   H
Sbjct: 225 -------LKRVYLRSCSRAYTGESNPKDSSNITFH 252

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 92.0 bits (227), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 112/252 (44%), Gaps = 19/252 (7%)

Query: 21  TLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTLLLQLYCQWDNSFSR 80
            L +L   V   K I +    AE+L+        +    YK L  ++   Y  W+N    
Sbjct: 7   VLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSWENE--- 63

Query: 81  LSHLPPHLAPFEQDFPGLVRIWPRESHLSL--KQSTKGHATLKHAWVTNNKHALQ-MSFD 137
              +P H+  F + +  L   WP E H ++   QS K   +++  W   N   L  M + 
Sbjct: 64  ---IPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQ-SIRFLWSAGNPRVLAAMRYG 119

Query: 138 AAAANPTSGN---IELRGSLR--QILSHYQLLYNNMRMFGKIK-LQVPVAEIPLNVFGEE 191
           +   N   G     EL  +LR  +I  H+  L    ++    K L VP+ EIP+   G+ 
Sbjct: 120 SYGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQN 179

Query: 192 IPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRR 251
           I   R  NL +RKV YV R+L  + PAL + E  + L  II  + P    G  S R L+R
Sbjct: 180 IADVRIKNLFKRKVAYVWRILAVDNPAL-SAENESLLMDII--ESPQLPQGQTSSRMLKR 236

Query: 252 LYRRAFAGCYTL 263
           LY+RA  G Y +
Sbjct: 237 LYQRACRGAYVI 248

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/270 (31%), Positives = 127/270 (47%), Gaps = 31/270 (11%)

Query: 8   LLRELRSLPLHSLTLARL-----SRHVAATKS--IPRLKHVAETLQNFHDVPSTKKHTQY 60
           LL  L++LPLHS TLA+L     +R++ ATKS  IP L     TL N ++       ++ 
Sbjct: 12  LLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLL-----TLINSYEKAQASGQSKL 66

Query: 61  --KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHA 118
             K L +++   Y +W N       L  HL PF++ +  L+  WP   H  +  S K   
Sbjct: 67  SNKTLESIIYHTYFEWTND------LASHLKPFQRQYSTLLTFWPHIYHSKI-DSKKNSI 119

Query: 119 TLKHAWVTNNKHALQ--MSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKIK- 175
            L     +N+K+ L+  +S      +      + +   ++I  HY  L  N  +    K 
Sbjct: 120 ILTWNKSSNSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKR 179

Query: 176 LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGD 235
           L  P+ EIP+N  G +IP  R  NLL+ K+      L    P L N E  A+L  II G 
Sbjct: 180 LPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPIL-NLENEAQLDEIINGS 238

Query: 236 GPAARSGNYSPRQLRRLYRRAFAGCYTLAS 265
             A +S     RQLR+LYRRA +  Y + +
Sbjct: 239 S-AIKS-----RQLRKLYRRACSNSYVIKN 262

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score = 86.7 bits (213), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 130/319 (40%), Gaps = 60/319 (18%)

Query: 1   MNTVRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETL-QNFHDVPSTKKHTQ 59
           MN V+T LL  L  LPL + TL  L   V    S      + +TL Q   D  + +    
Sbjct: 1   MNRVKT-LLNFLECLPLDTRTLDLLEGTVKLCSSA-----LLDTLEQKLFDYQANENS-- 52

Query: 60  YKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL-KQSTKGHA 118
            K L  ++   Y  W+N+       P H+  F Q++  L   WP E H  L   S     
Sbjct: 53  -KSLEWIVYNTYFHWNNT------TPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERV 105

Query: 119 TLKHAWVTNNKHALQ-MSFD--------------AAAAN--------------------- 142
           +++H W  NNK  L  M F+              A   N                     
Sbjct: 106 SIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTL 165

Query: 143 PTSGNIELRGSLRQILSHYQLLYNNMRM--FGKIKLQVPVAEIPLNVFGEEIPACRTANL 200
           P    +EL     +I  HY  L  N ++  +GK KL +P+ EIP+   G++IP  R  NL
Sbjct: 166 PKISQLELTLLFHEIFQHYMFLKRNPKLCKYGK-KLPIPIVEIPMKPLGQDIPLVRIRNL 224

Query: 201 LQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGC 260
            +RK     ++L EE P L + E  A L  IIA       S + S R+++RLY+RA    
Sbjct: 225 FKRKAAATWKLLAEENPVL-SLENEALLLDIIAS---PHHSTSVSNRKIKRLYQRACKHS 280

Query: 261 YTLASTAQEGQNGGVHSFA 279
           Y +      G +  +   +
Sbjct: 281 YVICEDRSIGLDFQISKLS 299

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 3   TVRTGLLRELRSLPLHSLTLARLSRHV--AATKS------IPRLKHVAETLQNFHDVPST 54
           +V T LLR L ++PLH  TL  L R +  A  KS      +P L+ + +  +  +++   
Sbjct: 4   SVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYER--YNIQED 61

Query: 55  KKHTQYKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQST 114
           K+  + K+L ++    Y  W+N       +P HL  F+++   L R WP   H  +   T
Sbjct: 62  KRGIE-KVLESIAYNTYFIWNNP------VPSHLQVFQKNNEMLRRYWPCVYHRGM--DT 112

Query: 115 KGHATLKHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNNMRMFGKI 174
           K  + +     +NN  AL +        P +   EL    ++I  HY  L  N R+    
Sbjct: 113 KRDSIIVQWAKSNNGDAL-LKGTMNHIQPGASAEELL-MFKKIFQHYIFLTLNARITSNA 170

Query: 175 K-LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIA 233
           K LQ P+  +P+N  GE IP  R  NL ++KV +    L    P L N E    L  II 
Sbjct: 171 KRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVL-NVENHGFLDEIIN 229

Query: 234 GDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSFALRML 283
            D         + R LRRLY+RA    + +A  + E     +     RML
Sbjct: 230 ADYEN------TSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRML 273

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 103/211 (48%), Gaps = 17/211 (8%)

Query: 61  KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLS-LKQSTKGHAT 119
           K L +++   Y  W N  +      PH+  F + +  L   WP E H S L   T    +
Sbjct: 47  KSLESIVHLTYFHWCNEDA------PHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQS 100

Query: 120 LKHAWVTNNKHAL-QMSFDAAAANPT---SGNIELRGSLR--QILSHYQLLYNNMRMFGK 173
           ++  W +N+   L +MS++  A +     S   EL+ +++  ++  H+  L +   +   
Sbjct: 101 IRFLWSSNSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKT 160

Query: 174 IK-LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAII 232
            K L VP+ EIP+   G+ IP  R  NL +RK+ YV +VL  + PAL     ++ L  II
Sbjct: 161 RKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELS-LAKII 219

Query: 233 AGDGPAARSGNYSPRQLRRLYRRAFAGCYTL 263
             D P       S R+L+RLY+RA  G YT+
Sbjct: 220 --DSPQLPEDVSSKRELKRLYQRACRGAYTI 248

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 126/280 (45%), Gaps = 37/280 (13%)

Query: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQ-YKILTTL 66
           LL+ L  LPLHS TL  L+  +   +    +  +A+ + N     S++  TQ  K L ++
Sbjct: 9   LLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLE---SSRAETQRIKALESI 65

Query: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHAT-LKHAWV 125
           +   +  W       S LP HL  F+  +  ++  WP E H S+    K  +T L++ W 
Sbjct: 66  IYHTHFVWG------SPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119

Query: 126 TNNKHALQMSFDAAAANPTSGNIELRGSL---------RQILSHYQLLYNNMRMFGKIK- 175
            ++K  L M+    + NP   +  L   L           + SHY  L  N R+    + 
Sbjct: 120 DSSKTVLSMA--EYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRN 177

Query: 176 LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALY-NTECIAELTAIIAG 234
           L +P+ EIP+   G +I   R  NL + KV +  R+L  E P L   +E I  L+ II+ 
Sbjct: 178 LPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENI--LSEIIS- 234

Query: 235 DGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGG 274
                   + S R+ RRLY+ +    Y +     +G++G 
Sbjct: 235 --------DASSRKQRRLYQASCKRAYVME--YDDGEHGN 264

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 113/271 (41%), Gaps = 30/271 (11%)

Query: 8   LLRELRSLPLHSLTLARLSR--HVAATKSIPRLKHVAETLQNFH-DVPSTKKHTQYKILT 64
           LL  L  LPLH  TL  L R  HVA    +P ++     L  +     ++K   + + L 
Sbjct: 15  LLESLERLPLHKPTLDILERRIHVA---DLPFMEEYVGILNEYEISKINSKVENESRALE 71

Query: 65  TLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLS-LKQSTKGHATLKHA 123
            ++ + +  W+N        P HL  F+  +  L+  WP E H   L  +  G  +L + 
Sbjct: 72  KIVKKTHIVWNND-----KFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYL 126

Query: 124 WVTNNKHALQMSFDAAAANPTSGNIE-LRGSLRQILSHYQLLYNNMRMFGK-------IK 175
            + N+       + +   N    +++  + +  Q +S Y  ++  +    +        K
Sbjct: 127 CLNNDDRFFNF-YKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNK 185

Query: 176 LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGD 235
             VP+ E+PL   G +IPACR  NL  +KV Y+ ++L    PA+  +        II   
Sbjct: 186 NMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSH-----EKIIMNI 240

Query: 236 GPAARSGNYSPRQLRRLYRRAFAGCYTLAST 266
               +      R++ RLYRR+    Y    T
Sbjct: 241 LEDTKDN----RRINRLYRRSLKNSYVFDDT 267

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 110/286 (38%), Gaps = 44/286 (15%)

Query: 7   GLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTL 66
            L R +R LPLH  T   L  +   +          ++L    D+   +KH  +K L  L
Sbjct: 12  ALSRSIRQLPLHIETQKVLEFYCRNSS--------YKSLLVAQDISEFEKHNDHKYLEAL 63

Query: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL-KQSTKGHATLKHAWV 125
           + + +  WDN       LPP L  F+     L   WP E   SL   S     +  + W 
Sbjct: 64  IQKTHFLWDNP------LPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWR 117

Query: 126 TNNKHAL-QMSFDA---AAAN------PTSGNIELRGSLRQIL---SHYQLLYNNMRMFG 172
              + AL  + F+    A  N      P  G   L     Q     SH +L YNN     
Sbjct: 118 DGKELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNR---- 173

Query: 173 KIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAII 232
             K+ VP+ EIPL   G ++  CR  NL +RK   V  +L  E   L +T     L  II
Sbjct: 174 --KIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPL-STRNEQLLGEII 230

Query: 233 AGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSF 278
                         R +RRLY+RA    Y + +  ++     V  F
Sbjct: 231 TKS---------ETRSMRRLYQRASRRAYVVTNEGKDPNGLQVPEF 267

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 122/295 (41%), Gaps = 46/295 (15%)

Query: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVA----ETLQNFHDVPSTKK-HTQYKI 62
           LL  + SLPLH +T   L+  +    S  + K +A    E+LQ +      +   T  K 
Sbjct: 9   LLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTSLKA 68

Query: 63  LTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQS--------- 113
           L +++ Q + QW+N   R +HL      F++ +  L+  WP E+H SL  S         
Sbjct: 69  LESIVYQTHFQWNNPRPRHAHL------FQKHYHFLLSHWPFENHRSLVDSIPAQNGKLI 122

Query: 114 ---TKGHA---------TLKHAWVTNNKHALQMSFDAAA---ANPTSGNIELRGSLRQIL 158
              +KG+           +K+ WV         S   A    A   +   E    ++ + 
Sbjct: 123 SLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKSLG 182

Query: 159 SHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEEL 216
           +HY+ L  N  + +   K   PV +IP+ N  GE  P  + + L  R++  +   L  E 
Sbjct: 183 NHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVEN 242

Query: 217 PALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQ 271
           P L     +A +T  +  DG   R          RLY RA A  YT+A+   + +
Sbjct: 243 PPLSTANELALMT--VFDDGTLERRHT-------RLYMRACARAYTIANADSDNE 288

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 123/291 (42%), Gaps = 55/291 (18%)

Query: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQY--- 60
           V   LL  + S PLH +T   L+  + + +S  + K +A        VP TK    Y   
Sbjct: 5   VNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIA--------VPLTKSLQLYEKA 56

Query: 61  ----------KILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL 110
                     K L +++ Q + QW+N   R +HL      F++ +  L+  WP E+H  L
Sbjct: 57  QRRQDLRASLKALESIIYQTHFQWNNPLPRHAHL------FQKHYHFLLTHWPFENHRDL 110

Query: 111 KQST-----KGHAT------LKHAWVT--NNKHALQMS----FDAAAANPTSGNIELRGS 153
             S      K ++T      LK  W+T  N K+    +       +  +  +   E    
Sbjct: 111 VDSIAVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFL 170

Query: 154 LRQILSHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRV 211
           +  + +HY+ L  N  + +   K   P  +IP+ N  GE  PA + A L  R++ ++ + 
Sbjct: 171 INSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKS 230

Query: 212 LIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYT 262
           L  E P L     +A LTA+   +           R+LRRLY RA A  YT
Sbjct: 231 LFIENPPLSPENELA-LTAVFYDET--------VERRLRRLYMRACARAYT 272

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 114/290 (39%), Gaps = 47/290 (16%)

Query: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQ---- 59
           V   LL  ++S+PLH +T   L   +  T+S  + K +A  L     V    +  Q    
Sbjct: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRT 64

Query: 60  -YKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGH- 117
             K L +++ Q + +W+N   R      H   F++ +  L+  WP E+H  L  S   H 
Sbjct: 65  ALKALESIIYQTHFKWNNPRPR------HALLFQKHYHFLLTHWPFENHRLLVDSIAAHK 118

Query: 118 ----------ATLKHAWVTNNKHALQMSFDAAAANPTSGNI----------ELRGSLRQI 157
                       LK  W T      Q+        PT  N+          E    +  +
Sbjct: 119 GKLNSIPSKTTWLKADWAT----LFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSL 174

Query: 158 LSHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEE 215
            + Y+ L  N  + +   K   P  +IP+ N  GE  P  + + L  R++ Y+   L EE
Sbjct: 175 GNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234

Query: 216 LPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLAS 265
            P L     IA L AI         +     R+ +RLY RA A  YT+ +
Sbjct: 235 NPPLSPANDIA-LMAIF--------NDKTMDRRFKRLYMRACARAYTITN 275

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 75/194 (38%), Gaps = 20/194 (10%)

Query: 85  PPHLAPFEQDFPGLVRIWPRESHLSL-KQSTKGHATLKHAWVTNNKHALQMSFDAAAANP 143
           P HL    +    L R WP E H SL   S     +L+  W    +  LQ          
Sbjct: 72  PEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWL 131

Query: 144 TSGNIELRGSLRQ---------ILSHYQLLYNNMRMFGKIKLQVPVAEIPLNVFGEEIPA 194
             G++  R +L Q         + + Y  L     ++   +L +PV EI +   G +IP 
Sbjct: 132 REGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPD 191

Query: 195 CRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYR 254
            R   L + K   V R+L  E PAL  T    E    I  + P         R +RR+Y 
Sbjct: 192 VRVDGLFKDKTKSVLRLLYREHPAL--TPAAEEDMLRIIAECPT--------RAMRRIYL 241

Query: 255 RAFAGCYTLASTAQ 268
           RA    Y L + AQ
Sbjct: 242 RACRRAYVLDADAQ 255

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 115/290 (39%), Gaps = 42/290 (14%)

Query: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVA----ETLQNFHDVPSTKK-HT 58
           ++  LL  + SLPLH +T   L+  +   +S  + K +A    E+LQ +      +   T
Sbjct: 5   IKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRT 64

Query: 59  QYKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGH- 117
             K L +++ Q + QW+N        P H   F++    L+  WP E+H SL  S   H 
Sbjct: 65  SLKALESIIFQTHFQWNNP------RPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHN 118

Query: 118 ----------ATLKHAWVT----NNKHALQMSFDAAAANPTSGNIELRGSLRQIL----- 158
                       LK  W T     N          + A     N++     R  L     
Sbjct: 119 GKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLG 178

Query: 159 SHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEEL 216
           +HY+ L  N  + +   K   P  +IP+ N  GE   + + A L  R++  +   L  E 
Sbjct: 179 NHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVEN 238

Query: 217 PALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLAST 266
           P L     +A L A+   D           R+ +RLY RA A  YT  ++
Sbjct: 239 PPLSADNELA-LMAVFHDDS--------LDRRHKRLYMRACARAYTTVNS 279

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 114/277 (41%), Gaps = 55/277 (19%)

Query: 17  LHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTLLLQLYCQWDN 76
           LHS+T   +S+      + P+ K   ETL   H + S  ++   K L  L+  ++     
Sbjct: 15  LHSITKDAISK----VDTFPKNKQ-HETL---HRLNSFNENPTRKTLEKLVYSVH----- 61

Query: 77  SFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATLKHA-WVTNNKHALQ-M 134
            F  L+  P H+    Q    L + WP E   S+ +    + T +   W  NNK AL  +
Sbjct: 62  -FHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFL 120

Query: 135 SFDAAA----ANPTSGNIEL--------------------------RGSLRQILSHYQLL 164
           SF+        N  + N EL                          + +LRQI  HY  L
Sbjct: 121 SFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFL 180

Query: 165 YNNMRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTEC 224
             N ++    KLQ P+ EI +   G +I   R  NL ++KV  +  +L  + P L  ++ 
Sbjct: 181 KTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVL-TSDA 239

Query: 225 IAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCY 261
            + LT+I+  + P         R+ +RLY+   +  Y
Sbjct: 240 ESILTSIV--NDPDLN------RRTKRLYKNVASRSY 268

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 86/222 (38%), Gaps = 43/222 (19%)

Query: 74  WDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHA-TLKHAWVTNNKHAL 132
           +D  F  L+    H+  FE+    L   WP E H  L    + +  + ++ W  NN   L
Sbjct: 63  FDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVL 122

Query: 133 QM----------------SFDAAAANP---------------TSGNIELRGSLRQILSHY 161
            +                S D+    P               T G  E    L+ I SHY
Sbjct: 123 DIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHY 182

Query: 162 QLLYNNMRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYN 221
             + +   + G   L +P+ E+ ++  GE++P  R  NL +++     + L+ + P L +
Sbjct: 183 LFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL-S 241

Query: 222 TECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTL 263
            E  + L +II              R + RLY+ +  G YT+
Sbjct: 242 REVESLLHSIIKE----------CDRSMGRLYKWSCNGAYTM 273

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 98/239 (41%), Gaps = 57/239 (23%)

Query: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTK-KHTQYKILTTL 66
           +L  L  LPLH  TL  L + V     + +   + E L ++++    K K  Q K L  +
Sbjct: 21  ILDGLNRLPLHPNTLDLLQKQVHT--KLTKNSELIELLFDYNNAFINKQKPGQLKCLQRI 78

Query: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKG---HATLKHA 123
           + + +  ++NS+    HL      F+  +  L   WP E H  L  + K       L++ 
Sbjct: 79  IFKTHLIFNNSYKNYDHL----KAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYL 134

Query: 124 WVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHY-----------QLLYNN----- 167
           W  NN ++  ++F         G+  ++   RQI + Y           +  YN+     
Sbjct: 135 W--NNCNSDNLAF--------MGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTL 184

Query: 168 ----------MRMFGKI-----------KLQVPVAEIPLNVFGEEIPACRTANLLQRKV 205
                     + +FG++           KLQ+P+  +PLN  G +IP  R  N  ++K+
Sbjct: 185 SEIIDEKEIEINLFGELFKQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>TBLA0D01880 Chr4 (460408..461100) [693 bp, 230 aa] {ON} Anc_5.484
           YOR148C
          Length = 230

 Score = 32.3 bits (72), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 143 PTSGN-IELRGSLRQILSHYQLLYNNMRMFGKIKLQVPVAEIPLNVFG 189
           PT GN IE + SL QI+++ +LL   +    K   Q    E+P+  FG
Sbjct: 103 PTCGNKIEKQNSLPQIITYDELLQKELEQLPKETKQEEYDEVPVEEFG 150

>Ecym_2412 Chr2 complement(801242..802564) [1323 bp, 440 aa] {ON}
           similar to Ashbya gossypii ACR126W
          Length = 440

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 149 ELRGSLRQILSHYQLLYNNMRMF---GKIKLQVPV 180
           EL  SLR++     LLY+NMR     GKI+ +VPV
Sbjct: 386 ELSDSLRKLRPEGNLLYDNMRKLQGSGKIETRVPV 420

>ACR126W Chr3 (570854..572164) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL146C
          Length = 436

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 118 ATLKHAWVTNNK-HALQMSFDAAAAN-PTSGNIELRGSLRQILSHYQLLYNNMRMF---G 172
           +TL  A V NNK H L         N     + EL GSLR +     LLY+++R     G
Sbjct: 349 STLIPAKVKNNKKHKLGTKHSVMEDNLEVKFSDELSGSLRSLRPEGNLLYDSLRKLQGSG 408

Query: 173 KIKLQVPV 180
           KI+ +VP+
Sbjct: 409 KIETRVPI 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,189,484
Number of extensions: 1186111
Number of successful extensions: 2649
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2691
Number of HSP's successfully gapped: 26
Length of query: 286
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 178
Effective length of database: 41,097,471
Effective search space: 7315349838
Effective search space used: 7315349838
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)