Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020508.264ON43243221250.0
NDAI0B020008.264ON4334198581e-111
NCAS0B050308.264ON4334267921e-101
Kpol_543.408.264ON4144157722e-98
ZYRO0C01606g8.264ON4324317439e-94
TDEL0F039108.264ON4294347124e-89
SAKL0H16984g8.264ON4354196994e-87
TPHA0A017908.264ON4394136979e-87
Suva_10.1748.264ON4564526571e-80
YLR090W (XDJ1)8.264ON4594556535e-80
KLLA0F19184g8.264ON5124186532e-79
Ecym_43068.264ON4344466393e-78
KLTH0G13640g8.264ON4144196349e-78
Kwal_56.237828.264ON4143796201e-75
Smik_12.1498.264ON4604576162e-74
AGR084C8.264ON4274036105e-74
Skud_12.1588.264ON4554395971e-71
CAGL0L12276g8.264ON4524285385e-63
KLLA0F03333g2.243ON4093754246e-47
ADL257C2.243ON4103793872e-41
Ecym_32812.243ON4093783827e-41
KNAG0I019002.243ON4093773722e-39
KAFR0J009402.243ON4113803696e-39
Suva_14.2772.243ON4093783679e-39
SAKL0E08734g2.243ON4113863634e-38
Kwal_23.48302.243ON4113793625e-38
Skud_14.2682.243ON4103863618e-38
KLTH0G09394g2.243ON4114203609e-38
CAGL0J09966g2.243ON4073973591e-37
YNL064C (YDJ1)2.243ON4093853582e-37
Smik_14.2632.243ON4093853572e-37
ZYRO0A01496g2.243ON4124493564e-37
TBLA0E038102.243ON4103793564e-37
TPHA0C031102.243ON4073783531e-36
Kpol_1003.122.243ON4083773249e-33
Ecym_62368.730ON3743773035e-30
KAFR0A041608.730ON3783702738e-26
Kwal_26.90248.730ON3753702683e-25
TDEL0C046002.243ON4112632685e-25
NDAI0D010302.243ON4112632642e-24
NCAS0G030002.243ON4102632633e-24
TDEL0B037908.730ON3733642604e-24
ZYRO0A06226g8.730ON3772562463e-22
CAGL0F03729g8.730ON3613572365e-21
Smik_14.2492.218ON5332532334e-20
YNL077W (APJ1)2.218ON5282532309e-20
SAKL0H05258g8.730ON3682422233e-19
KLLA0C07260g8.730ON3683632224e-19
Skud_13.3838.730ON3753642224e-19
AER346W8.730ON3673582224e-19
KLTH0G08756g2.218ON4623932245e-19
Skud_14.2532.218ON5322622245e-19
Kwal_23.30612.218ON4582502236e-19
Suva_14.2622.218ON5362522238e-19
KNAG0G028808.730ON3783742154e-18
TDEL0C043502.218ON4622732156e-18
KLLA0E07899g2.218ON4954052148e-18
KLTH0D12496g8.730ON3752422102e-17
SAKL0E09306g2.218ON4612662094e-17
CAGL0J10296g2.218ON4792762077e-17
Ecym_53842.218ON5033082061e-16
AER427W2.218ON4702522051e-16
Smik_13.4228.730ON3782442012e-16
YMR214W (SCJ1)8.730ON3772462003e-16
TBLA0E036602.218ON4482452004e-16
NCAS0G028502.218ON4942532005e-16
Suva_13.3978.730ON3752391951e-15
KNAG0M020202.218ON4603661933e-15
NDAI0E008708.730ON3762391905e-15
NCAS0B005308.730ON3752431843e-14
Kpol_1002.1222.218ON5032901863e-14
ZYRO0C15048g2.218ON4912541845e-14
TPHA0G006308.730ON3932471801e-13
TPHA0C029802.218ON5542951792e-13
Kpol_1064.408.730ON3872471731e-12
NDAI0F024502.218ON5302691694e-12
TPHA0G014808.698ON660651581e-10
Kpol_1072.48.698ON661651571e-10
TBLA0B034908.730ON3842461533e-10
Suva_13.3402.350ON225561475e-10
YMR161W (HLJ1)2.350ON224561465e-10
NCAS0C012208.698ON669621491e-09
YOR254C (SEC63)8.698ON663621482e-09
Smik_13.3612.350ON224561422e-09
ZYRO0D10934g8.698ON663621472e-09
Skud_13.3232.350ON224561412e-09
NDAI0H031802.350ON229561413e-09
TBLA0B093802.350ON227541403e-09
Skud_15.4208.698ON665621454e-09
KAFR0H023108.698ON655621455e-09
YFL016C (MDJ1)8.61ON5113001436e-09
TPHA0B037601.398ON355561417e-09
NDAI0C026101.398ON340561417e-09
TBLA0D026008.61ON5102731437e-09
Smik_15.4378.698ON663621438e-09
TBLA0C014801.398ON353561418e-09
Kwal_47.179578.61ON4782611428e-09
KLTH0F09944g2.350ON233561371e-08
KAFR0B048902.350ON220561361e-08
KLLA0C09823g8.698ON669641411e-08
KAFR0H031501.398ON359561391e-08
Skud_6.568.61ON5172741401e-08
CAGL0G07469g8.698ON668661402e-08
KLTH0A02882g8.61ON4732791392e-08
CAGL0H04499g2.350ON232561352e-08
NCAS0D009602.350ON224561352e-08
TDEL0G028002.350ON225561342e-08
Kwal_23.3578singletonOFF85561252e-08
NDAI0G042501.398ON363561373e-08
Ecym_43727.217ON579571383e-08
ZYRO0E04598g1.398ON357561373e-08
AAL008W1.398ON349561363e-08
SAKL0E06050g2.350ON232561324e-08
Suva_6.448.61ON5072741365e-08
SAKL0H05984g8.698ON658621365e-08
TDEL0A064308.698ON666621365e-08
Suva_8.3038.698ON664621365e-08
Kpol_526.62.350ON228561316e-08
KNAG0J018408.698ON650621356e-08
AFR507W8.61ON474581356e-08
CAGL0H03707g1.398ON349561328e-08
KLLA0D06402g1.297ON631581348e-08
Kpol_529.212.15ON622561349e-08
SAKL0B02068g8.61ON5102811339e-08
Kwal_26.88798.698ON656621341e-07
KLTH0D11770g8.698ON652621331e-07
KLLA0D04818g1.398ON354561311e-07
Ecym_12921.398ON347561311e-07
Ecym_56262.350ON243561282e-07
KLLA0D07656g8.61ON4713151312e-07
TBLA0B037308.698ON693621312e-07
Ecym_23748.698ON661611312e-07
NCAS0G013602.15ON616561302e-07
Kwal_0.2071.398ON353561283e-07
YNL227C (JJJ1)2.15ON590561303e-07
YNL007C (SIS1)1.398ON352561283e-07
Kwal_14.24521.297ON607641303e-07
ZYRO0A07502g2.350ON238561263e-07
TBLA0A011007.157ON434561293e-07
KLTH0H12100g1.398ON350561283e-07
Skud_14.1102.15ON596561293e-07
TDEL0B059601.398ON369561283e-07
Suva_14.1162.15ON600561293e-07
Kpol_457.151.398ON357561284e-07
KNAG0I008602.350ON219561244e-07
SAKL0D08778g1.398ON348561274e-07
Smik_14.3211.398ON366561274e-07
TDEL0C008708.61ON4702611284e-07
KNAG0G011308.61ON500581284e-07
KNAG0H016801.398ON363561274e-07
NCAS0G036101.398ON327561264e-07
Skud_14.3201.398ON368561274e-07
AFL190C2.350ON235561245e-07
Suva_14.3411.398ON359561265e-07
AAL103W8.698ON669621285e-07
TPHA0C045902.350ON233561236e-07
Smik_6.638.61ON5102651276e-07
KLTH0G18546gna 1ON283591246e-07
TPHA0L007907.157ON446561267e-07
KAFR0A079502.15ON551561259e-07
Smik_14.1062.15ON593561269e-07
NDAI0F038002.15ON638561251e-06
ABL194C2.15ON552561251e-06
KNAG0F008602.15ON626561251e-06
CAGL0J07370g2.15ON623561241e-06
CAGL0C04565g1.113ON175651181e-06
KLLA0E04423g7.217ON428541232e-06
NDAI0E045607.217ON394571232e-06
NCAS0C048901.398ON367561222e-06
NCAS0E029307.217ON387571212e-06
ZYRO0G03850g7.157ON418561212e-06
KLLA0E01629g2.350ON231561192e-06
SAKL0E14234g2.15ON678561223e-06
TBLA0J018707.157ON470561213e-06
TPHA0D005508.61ON486581213e-06
TBLA0C027201.297ON715641223e-06
NDAI0K012308.698ON680621213e-06
Skud_5.1587.217ON391571203e-06
TPHA0I011101.297ON666581213e-06
Suva_12.1851.113ON168591153e-06
TBLA0A055601.92ON312631193e-06
KLTH0A03740g7.217ON395571203e-06
Kpol_1070.227.217ON380561203e-06
NDAI0A028207.157ON482561204e-06
KLLA0D19602g2.15ON620561204e-06
CAGL0J02750g7.217ON382571194e-06
SAKL0B01276gna 1ON292581184e-06
KLTH0B08338g2.15ON590561195e-06
KLTH0H10032g1.297ON607641195e-06
TBLA0D042407.217ON389591186e-06
KAFR0B047807.157ON423561186e-06
CAGL0J04224g8.61ON5222281187e-06
YJR097W (JJJ3)1.113ON172591127e-06
Skud_10.3191.113ON168611128e-06
CAGL0L00957g7.217ON373571178e-06
TDEL0H022907.217ON387561169e-06
TPHA0O019402.15ON598561179e-06
TPHA0C012607.217ON380561161e-05
Smik_5.1737.217ON391571161e-05
KAFR0A016201.297ON665571171e-05
SAKL0F04444g7.157ON429561151e-05
KLLA0D13464g7.157ON433561151e-05
Kwal_23.44202.15ON592561161e-05
KNAG0B052401.297ON668561161e-05
KNAG0C024501.185ON544621151e-05
KAFR0L007407.217ON364561151e-05
TBLA0G001702.15ON659561162e-05
Ecym_14508.61ON4922631152e-05
TBLA0E024907.217ON366601142e-05
ADR124C1.297ON611621152e-05
Kwal_47.181337.217ON393571142e-05
SAKL0D06226g1.297ON615581152e-05
Suva_5.1507.217ON391571142e-05
YER048C (CAJ1)7.217ON391571132e-05
Kwal_14.1174na 1ON284601122e-05
ZYRO0F15400g2.15ON525561133e-05
Kpol_499.307.157ON408561133e-05
KAFR0C024507.217ON373541123e-05
SAKL0F08052g7.217ON393571123e-05
ADR015W7.157ON436561123e-05
NDAI0G056401.297ON623581124e-05
KNAG0L013307.217ON396561115e-05
CAGL0J01936g7.157ON425561106e-05
TDEL0H032107.157ON411561106e-05
KLTH0F13398g7.157ON419551106e-05
Smik_9.2037.157ON432541107e-05
NDAI0D005001.113ON190671067e-05
Kwal_55.209657.157ON421551097e-05
TBLA0A057401.113ON170371057e-05
NCAS0A132107.157ON414561089e-05
TDEL0E005002.15ON581561081e-04
YIR004W (DJP1)7.157ON432561081e-04
KNAG0B018901.92ON370591071e-04
NCAS0A093201.297ON635581081e-04
Kpol_1027.131.297ON641581081e-04
ZYRO0D16390g7.217ON398561062e-04
Skud_9.1817.157ON421541062e-04
Ecym_44697.157ON433541052e-04
Suva_9.2137.157ON431561052e-04
Ecym_11101.113ON156581002e-04
Smik_10.3851.113ON172591012e-04
CAGL0H02827g1.297ON656611053e-04
CAGL0I06226g1.185ON455561053e-04
KLTH0F03124g1.113ON16256993e-04
KLTH0F04906g1.185ON590541044e-04
KNAG0I007407.157ON425561034e-04
ZYRO0G21230g1.297ON584581035e-04
SAKL0C02904g1.92ON281671015e-04
SAKL0C05456g1.185ON583561035e-04
KAFR0F018101.185ON555561026e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02050
         (432 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   823   0.0  
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    335   e-111
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    309   e-101
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   301   2e-98
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   290   9e-94
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   278   4e-89
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   273   4e-87
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   273   9e-87
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   257   1e-80
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   256   5e-80
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   256   2e-79
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   250   3e-78
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   248   9e-78
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   243   1e-75
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   241   2e-74
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   239   5e-74
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   234   1e-71
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   211   5e-63
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   167   6e-47
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   153   2e-41
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   151   7e-41
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   147   2e-39
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   146   6e-39
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   145   9e-39
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   144   4e-38
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   144   5e-38
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   143   8e-38
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   143   9e-38
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   142   1e-37
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   142   2e-37
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   142   2e-37
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   141   4e-37
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   141   4e-37
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   140   1e-36
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   129   9e-33
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   121   5e-30
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   109   8e-26
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   107   3e-25
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   107   5e-25
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   106   2e-24
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   105   3e-24
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   104   4e-24
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    99   3e-22
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    96   5e-21
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    94   4e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    93   9e-20
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    91   3e-19
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    90   4e-19
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    90   4e-19
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    90   4e-19
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    91   5e-19
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    91   5e-19
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    91   6e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    91   8e-19
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    87   4e-18
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    87   6e-18
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    87   8e-18
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    86   2e-17
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    85   4e-17
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    84   7e-17
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    84   1e-16
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    84   1e-16
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    82   2e-16
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    82   3e-16
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    82   4e-16
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     82   5e-16
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    80   1e-15
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    79   3e-15
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    78   5e-15
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       75   3e-14
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    76   3e-14
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    75   5e-14
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    74   1e-13
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    74   2e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    71   1e-12
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    70   4e-12
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    65   1e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    65   1e-10
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    64   3e-10
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    61   5e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    61   5e-10
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     62   1e-09
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    62   2e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   2e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    61   2e-09
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    59   2e-09
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      59   3e-09
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    59   3e-09
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    60   4e-09
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    60   5e-09
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    60   6e-09
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    59   7e-09
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               59   7e-09
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    60   7e-09
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    60   8e-09
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    59   8e-09
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    59   8e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    57   1e-08
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    57   1e-08
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    59   1e-08
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    58   1e-08
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    59   1e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    59   2e-08
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    58   2e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    57   2e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    57   2e-08
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    56   2e-08
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    53   2e-08
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    57   3e-08
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    58   3e-08
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    57   3e-08
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    57   3e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    55   4e-08
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    57   5e-08
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    57   5e-08
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    57   5e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    57   5e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    55   6e-08
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    57   6e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    57   6e-08
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    55   8e-08
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    56   8e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    56   9e-08
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    56   9e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    56   1e-07
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    56   1e-07
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    55   1e-07
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    55   1e-07
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    54   2e-07
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    55   2e-07
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    55   2e-07
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    55   2e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    55   2e-07
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    54   3e-07
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    55   3e-07
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    54   3e-07
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    55   3e-07
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    53   3e-07
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    54   3e-07
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    54   3e-07
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    54   3e-07
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    54   3e-07
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    54   3e-07
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    54   4e-07
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    52   4e-07
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    54   4e-07
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    54   4e-07
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    54   4e-07
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    54   4e-07
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    54   4e-07
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      53   4e-07
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    54   4e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    52   5e-07
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    53   5e-07
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    54   5e-07
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    52   6e-07
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    54   6e-07
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    52   6e-07
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    53   7e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    53   9e-07
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    53   9e-07
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      53   1e-06
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    53   1e-06
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    53   1e-06
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    52   1e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    50   1e-06
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    52   2e-06
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             52   2e-06
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     52   2e-06
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     51   2e-06
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    51   2e-06
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    50   2e-06
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    52   3e-06
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    51   3e-06
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    51   3e-06
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    52   3e-06
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    51   3e-06
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    51   3e-06
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    51   3e-06
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    49   3e-06
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    50   3e-06
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    51   3e-06
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    51   3e-06
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    51   4e-06
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    51   4e-06
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    50   4e-06
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    50   4e-06
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    50   5e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    50   5e-06
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    50   6e-06
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               50   6e-06
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    50   7e-06
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    48   7e-06
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    48   8e-06
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    50   8e-06
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    49   9e-06
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    50   9e-06
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    49   1e-05
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    49   1e-05
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    50   1e-05
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    49   1e-05
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    49   1e-05
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    49   1e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    49   1e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    49   1e-05
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    49   1e-05
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    49   2e-05
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    49   2e-05
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    49   2e-05
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    49   2e-05
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    49   2e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    49   2e-05
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    49   2e-05
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    48   2e-05
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    48   2e-05
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    48   3e-05
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    48   3e-05
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    48   3e-05
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    48   3e-05
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    48   3e-05
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    48   4e-05
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    47   5e-05
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    47   6e-05
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    47   6e-05
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    47   6e-05
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    47   7e-05
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    45   7e-05
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    47   7e-05
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    45   7e-05
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    46   9e-05
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    46   1e-04
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    46   1e-04
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    46   1e-04
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    46   1e-04
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    46   1e-04
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    45   2e-04
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    45   2e-04
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    45   2e-04
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    45   2e-04
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    43   2e-04
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    44   2e-04
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    45   3e-04
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    45   3e-04
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    43   3e-04
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    45   4e-04
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    44   4e-04
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    44   5e-04
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    44   5e-04
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    44   5e-04
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    44   6e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    43   7e-04
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    44   8e-04
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    43   0.001
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    43   0.001
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    43   0.001
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    43   0.002
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    42   0.002
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    42   0.002
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    40   0.002
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    40   0.002
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    42   0.002
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    41   0.003
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    42   0.003
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    40   0.003
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    40   0.003
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    40   0.003
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    40   0.003
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    40   0.003
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       42   0.004
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    41   0.004
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    39   0.006
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    40   0.007
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    40   0.008
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    40   0.008
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    40   0.012
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    39   0.013
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    40   0.014
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    38   0.017
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    39   0.026
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    38   0.028
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    39   0.030
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    38   0.040
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    38   0.042
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    38   0.051
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    38   0.053
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    38   0.053
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    37   0.063
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    37   0.067
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    37   0.067
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    37   0.074
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.075
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    37   0.077
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    37   0.082
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    36   0.087
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    36   0.11 
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    36   0.12 
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    36   0.13 
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         36   0.15 
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    36   0.19 
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    35   0.25 
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    35   0.30 
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    35   0.34 
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    35   0.37 
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    34   0.44 
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    34   0.48 
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    34   0.60 
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    34   0.63 
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    33   0.65 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    34   0.71 
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    33   1.3  
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    33   1.6  
CAGL0D05478g Chr4 (522559..524733) [2175 bp, 724 aa] {ON} simila...    33   1.6  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    32   1.8  
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    33   1.8  
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    32   2.4  
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    32   2.5  
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    32   3.6  
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    31   4.3  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    31   4.4  
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    32   4.6  
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    32   4.6  
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    32   4.7  
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    31   5.2  
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    31   5.5  
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    31   6.0  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    31   6.2  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    31   6.3  
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    31   6.8  
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    31   6.9  
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    31   7.1  
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    31   7.3  
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    30   7.5  
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    31   7.8  
KAFR0H01520 Chr8 complement(280214..282796) [2583 bp, 860 aa] {O...    31   9.3  
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    30   9.5  

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/432 (93%), Positives = 403/432 (93%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
           MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL
Sbjct: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60

Query: 61  SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQIEIEV 120
           SN                             EGRNAHPMGGHPQREDESTNEATQIEIEV
Sbjct: 61  SNGEYVEEMEEEYEGQGYGFNFGDDFMNFFNEGRNAHPMGGHPQREDESTNEATQIEIEV 120

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD
Sbjct: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
           SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT
Sbjct: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT
Sbjct: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
           QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD
Sbjct: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360

Query: 361 NWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASR 420
           NWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASR
Sbjct: 361 NWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASR 420

Query: 421 PPAQGLYKCSIQ 432
           PPAQGLYKCSIQ
Sbjct: 421 PPAQGLYKCSIQ 432

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  335 bits (858), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 175/419 (41%), Positives = 255/419 (60%), Gaps = 9/419 (2%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
           MA L  Y ILGV   +TD EI+KAYRKLAL++HPDKV+DP ++  NE+KFKEIT+AYEIL
Sbjct: 1   MADL--YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEIL 58

Query: 61  SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQIEIEV 120
           S+                             E  +      +    D+S +   +I +++
Sbjct: 59  SDEEKRAHYDLYGDANENEYNNQNANDFFNFE-TDQPDYDSYAFDNDKSKD--VKIPLKL 115

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           ++++LYNGK  KFQ  RN+IC  C+G  WRRRKNG++  P  + C KC G GY ER    
Sbjct: 116 SIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRML 175

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P F    +I C  C GKGE  AKP S+KNKCK CHG+GL+ E +QLLV++PRG +N +T
Sbjct: 176 IPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKDT 235

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           I  + + D+++   + GDI+  +   +E      D+   ++GTD  M + + L EA++G 
Sbjct: 236 IRIENEADQEIGKSKTGDIILVI---EEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
           + +FL+K+ D R+L L++P GKV+RPG+ I IK EGWP  P  ++FGD++V + +EFPPD
Sbjct: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPD 352

Query: 361 NWISERNDITTLTNVLPAGKSDDGHA-QTGDANNAEFVKDYEILKATDEGTRSSNTKTA 418
           NW SE++DI  L NVLP+G +   ++ +  D  N E V  ++IL+   +    SN ++A
Sbjct: 353 NWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEELPDTLNESNNRSA 411

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  309 bits (792), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/426 (37%), Positives = 252/426 (59%), Gaps = 11/426 (2%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDP--EEKASNEMKFKEITTAYEILSNXX 64
           Y +LGV  ++TD +I+KAYRKLAL+ HPDKV++   +++ ++E+KFKEI+ AYEILS+  
Sbjct: 5   YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64

Query: 65  XXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQR--EDESTNEATQIEIEVTL 122
                                      E          P R  ED   +   +I +++T+
Sbjct: 65  KRAHYDLYGSEEEQQRQQRQYDPF---ESFFNFEQDEEPSRHYEDPKRSPDVKIPLKMTI 121

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSP 182
           ++LYNGK  KF+  RNVIC  C+G  WRRRKNG +  PP + C  CKG G+ E++   +P
Sbjct: 122 QELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRMLAP 181

Query: 183 FFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTII 242
            F   ++  C++C GKG++ AK  S+KNKCK CHGEGL  E + L V++PRG  + +TI 
Sbjct: 182 GFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDTIK 241

Query: 243 FKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQG 302
              + D++L   + GD++F +   +E      D+ + ++G++    + I L EA++G + 
Sbjct: 242 VVNEADQELGKPKTGDLIFSI---EEDQRCPKDVQLERKGSNFMTELNISLAEALTGFKD 298

Query: 303 RFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNW 362
           +F+TKTFD R+L L++P GKV+RPG+ I I+ EGWP     T+FGD+++ VN+EFPPDNW
Sbjct: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNW 358

Query: 363 ISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASRPP 422
            +E++D+T + N+LP   SD     + D  N E +  +E+L+   +  +    +  +   
Sbjct: 359 FTEKSDLTQIKNILPRSTSDKTKL-SDDPLNTELLLKFEVLETLPDTLKEGQDQGENNAE 417

Query: 423 AQGLYK 428
           + G Y+
Sbjct: 418 SHGEYR 423

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  301 bits (772), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 162/415 (39%), Positives = 236/415 (56%), Gaps = 19/415 (4%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y+ILGV  D+T +EI+K YRKLAL++HPDK ID  +K  NE+KFK+IT AY+ LS+    
Sbjct: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQIEIEVTLKDLY 126
                                    E   A+   G+      S ++  ++E+ +   +LY
Sbjct: 74  NEYDNKKNFEPYF------------ESDFANNHDGNYNSRYRSRSKDIKVELSLKTSELY 121

Query: 127 NGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSPFFQY 186
           NGK +KF  +RN IC  C+G  WR +K+G  Y PP + C KC G GY    V  +P F  
Sbjct: 122 NGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYT 181

Query: 187 VQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEK 246
            Q + C  C G G+Y  KP S KN CK C+G+ LIK    ++V+IPRGS N + II K +
Sbjct: 182 TQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGE 241

Query: 247 GDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLT 306
            DE+L  + AGD++F +    + N       + + G  L  +  I L EAI+G + +F+ 
Sbjct: 242 ADEELGKKNAGDLIFEINEIIDSNND-----LERYGNHLINHTHISLAEAITGFENKFIV 296

Query: 307 KTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISER 366
           KTFDDR L L+ P+GKV+RPGD + +K EGWP    G  FG+++V + +EFPPDNWI+E+
Sbjct: 297 KTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEK 356

Query: 367 NDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTASRP 421
           NDI  + N+LP  K+   +    D  N+E++  +EI+K+  +      T+  + P
Sbjct: 357 NDIIKIRNILPNEKTKRNNIV--DPINSEYISTFEIVKSLPQEEGEEQTEHDTNP 409

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  290 bits (743), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 242/431 (56%), Gaps = 17/431 (3%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNX 63
           ++ YD LGV +D+T  EI+KAYRKLAL+ HPDKV D   +  +E++FKEIT AYE+LS+ 
Sbjct: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60

Query: 64  XXXXXXXXXXXXX-------XXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQI 116
                                                          Q  D+ +++  Q+
Sbjct: 61  EKRSKYDTYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDD-VQV 119

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVER 176
            ++V++ D YNGK  KFQ  R ++C  C+G+ WRRR  G    PP  +C  C+G GY E+
Sbjct: 120 PLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGG---PPPQTNCKSCQGRGYKEQ 176

Query: 177 LVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSE 236
           L   +P     Q +SC  C GKG+Y +KPTS+KN+CK C G+G+I+E + L V+IPRGS 
Sbjct: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236

Query: 237 NSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEA 296
           + + I+F+ + D+++   + GD++F +    EP  G   + + + G DL  NI I L EA
Sbjct: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEG---VRLERRGYDLITNISISLAEA 293

Query: 297 ISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVE 356
           I+G   R LTKT D RVLKL+ P GKV+ PG  I ++ EGWP   + T+FGD++V V++ 
Sbjct: 294 ITGLD-RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352

Query: 357 FPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTK 416
           FP DNW +E++D+  + N+LP+  +++      D  N E V D +++    +   S+  +
Sbjct: 353 FPRDNWFAEKSDLLKIRNILPSEAANND--VKADPGNTEQVSDMKLVDQLPDYMGSNGDQ 410

Query: 417 TASRPPAQGLY 427
            A    A G +
Sbjct: 411 YAHEGHASGAF 421

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  278 bits (712), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 160/434 (36%), Positives = 239/434 (55%), Gaps = 17/434 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y+ILGV+ D+T  EI+KAYRK AL+ HPDKV D   +  +E++FKEI  AYE+L +    
Sbjct: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEA-------TQIEIE 119
                                         H  G +PQ   +   E         Q+ + 
Sbjct: 65  ARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVPLN 124

Query: 120 VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVG 179
           V++ D YNGK+ KFQ  R ++C  C G+ WRRR N  +  PP + C KC G G+ +R+  
Sbjct: 125 VSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRR-NDHVVPPPQVECKKCGGQGFKQRIRR 183

Query: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239
            +P F   + I+C  C GKG+  +KP +DKNKCK C G G+  E + L V++PRGS   +
Sbjct: 184 LAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSRQDD 243

Query: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDE-PNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
            I+ K + D+++   + G++VF +K   E P G D    + + G DL  ++ + L EAI+
Sbjct: 244 QIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVD----LQRHGFDLITHLTLSLAEAIT 299

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G   + LTKT D R+L+L +P GKV+RPG+ I I  EGWP   + T  GD++V V++EFP
Sbjct: 300 GF-SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYVVVHIEFP 356

Query: 359 PDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTA 418
           PDNW SER+D+T + NVLP G++++  A   D  N E V +  I++   + ++    ++ 
Sbjct: 357 PDNWFSERSDLTQVKNVLP-GETNNNAAVEDDPGNTETVTNINIVEEIPDPSQDDRFRSR 415

Query: 419 SRPPAQGLYKCSIQ 432
               A     C+ Q
Sbjct: 416 DDDKANDFPGCAQQ 429

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  273 bits (699), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 238/419 (56%), Gaps = 25/419 (5%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
           M KL  Y++LGV  D++  EI+KAYRKLAL+ HPDKV D   +  +EMKFKEIT AYEIL
Sbjct: 1   MTKL--YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEIL 58

Query: 61  SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE----------GRNAHPMGGHPQREDEST 110
           S+                                        G    P   +P+ E+ S 
Sbjct: 59  SDEDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSV 118

Query: 111 NEA-TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCK 169
             +  +I +++++K+LYNGK  KF+  RNV+C  C G+  R++       P V  C  C+
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVV--CQSCE 176

Query: 170 GAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLV 229
           G G+ ER+   +  F   + + C +C GKG  T  PT  ++ CK CHG+ +I E++ L V
Sbjct: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTV 234

Query: 230 TIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNI 289
            IPRGS N + +  + + D++   +  GD++F ++ + E +       + + G DLH  +
Sbjct: 235 YIPRGSRNGDIVKLEGEADQE-PDKVTGDLLFVIEENPETSTN-----LERRGDDLHTRL 288

Query: 290 EIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDM 349
           +I L EAI+G + + +T T DDR+LKL +PQGKV+RPG+ I ++ EGWP   +G +FGDM
Sbjct: 289 KISLSEAITGFE-KVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDM 347

Query: 350 FVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDE 408
           +V V++EFPPDNW SE++D+  L  +LP    +   A TGD NN E V DY ++K+ DE
Sbjct: 348 YVQVHIEFPPDNWFSEKSDVEVLRTLLPE-VPNARVADTGDLNNTETVIDYSVVKSADE 405

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  273 bits (697), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 163/413 (39%), Positives = 226/413 (54%), Gaps = 39/413 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKV--IDPEE---KASNEMKFKEITTAYEILS 61
           Y IL VD   T DE++K YRKLALK+HPDKV   D +E   K   E+KFKEI +AYEILS
Sbjct: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72

Query: 62  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQIEIEVT 121
           +                              G   +   G+   +D S      I ++VT
Sbjct: 73  DEEKRKQYDLQKNFRDANQGSDY--------GDGINTAFGNQTSKDIS------IPLKVT 118

Query: 122 LKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDS 181
           +KDLYNGK +++ + RNVIC  C G  WR RKNG  Y PP+  C  C GAGY +     +
Sbjct: 119 IKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIA 178

Query: 182 PFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTI 241
           P F   Q + C+ C GKG Y  KP S KN C  C+G+G+I+  + + V IPRGS + +TI
Sbjct: 179 PGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTI 238

Query: 242 IFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG-TDLHMNIEIPLIEAISGT 300
           I   K D++L   + GD++F L+  D     D    + + G  DL   + I L +AI+G 
Sbjct: 239 IIDNKADQELGKFKTGDLIFVLEEID-----DEQTALKRYGDKDLITELTISLADAITGF 293

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
           + + + KT D R+L+L++P GKV+R GD + ++GEGWP   N T  GD+++  N+EFP D
Sbjct: 294 KEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPAD 353

Query: 361 NWISERNDITTLTNVLPA---GKSD-----------DGHAQTGDANNAEFVKD 399
           NW SE NDI  + N+LPA    K+D           +    + D +N +FVKD
Sbjct: 354 NWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKD 406

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  257 bits (657), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 163/452 (36%), Positives = 240/452 (53%), Gaps = 32/452 (7%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV R+++  EI+ AYRKLALK HPDK +D + K  NE KFKEIT AYEILS+    
Sbjct: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHP------QREDESTNEATQ----- 115
                                       N    G H       + E    NE T      
Sbjct: 71  SHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDID 130

Query: 116 IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVE 175
           I++  T+KDLY GK +KF+L R +IC  C G+ W+ +K   ++    + C  C G G  E
Sbjct: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKK--VHVTHEMECESCGGKGSKE 188

Query: 176 RLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGS 235
           RL    P     Q + C KC GKG+YT +P + KN C  C   GL  +K+ + V +P G 
Sbjct: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248

Query: 236 ENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG----TDLHMNIEI 291
             ++ +  K   DE++     GD++F L +    +     +L+ K G     DL+++I +
Sbjct: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHL-VEKPEDLQQKQVLMKKFGGGNLQDLYVSITV 307

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KTPNGTEFGDM 349
            L EA++G + +FLT+TFDDR+L L++  GKV+RPGD I I  EGWP    P G + GD+
Sbjct: 308 SLSEALTGFE-KFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRG-QCGDL 365

Query: 350 FVHVNVEFPPDNWISERNDITTLTNVLPAGKS--DDGHAQTGDAN---NAEFVKDYEILK 404
           +V V++EFPPDNW +E++++  +   LP+  S   +    TG  N   N+E V +++I+ 
Sbjct: 366 YVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIH 425

Query: 405 ATD--EGTRSSNTK--TASRPPAQGLYKCSIQ 432
           + D  EG ++ N K  T++   A   Y C +Q
Sbjct: 426 SDDLPEGMKTFNPKPQTSAHQKASSSY-CPMQ 456

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  256 bits (653), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 166/455 (36%), Positives = 236/455 (51%), Gaps = 35/455 (7%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS----- 61
           YD+LGV RD+T  EI+ AYRKLALK HPDK +D + K  NE+KFKEIT AYEILS     
Sbjct: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 62  ---------NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNE 112
                    N                             +G N        +  + ++++
Sbjct: 71  SHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSSK 130

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
              I+I +TLKDLY GK +KF L R VIC  C G+ W+ ++   ++    + C  C G G
Sbjct: 131 DIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRK--IHVTHDVECESCAGKG 188

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
             ERL    P     Q + C KC GKG+YT +P + KN C  C G GL+ +K+ + V + 
Sbjct: 189 SKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVA 248

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTK----EGTDLHMN 288
            G   ++ I  K   DE++     GD+ F L    E N     I +       G DL+ +
Sbjct: 249 PGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE-NLEQKQIFLKNFDDGAGEDLYTS 307

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KTPNGTEF 346
           I I L EA++G + +FLTKTFDDR+L L++  G+V+RPGDTI I  EGWP    P+G   
Sbjct: 308 ITISLSEALTGFE-KFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RC 365

Query: 347 GDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTG---DAN--NAEFVKDYE 401
           GD++V V++EFPPDNW +E++++  +   LP+  S   HA      D+N  N E + ++ 
Sbjct: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFR 425

Query: 402 ILKATD--EGTR--SSNTKTASRPPAQGLYKCSIQ 432
           I+   D  EG R      + ++   A+  Y C IQ
Sbjct: 426 IIHTDDLPEGIRPFKPEAQDSAHQKARSSY-CCIQ 459

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  256 bits (653), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 220/418 (52%), Gaps = 32/418 (7%)

Query: 6   PYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXX 65
           PYD+LGV++D+T+ EIRKAYRKLALK+HPDK+ID  E+ ++E  FKE+T AYEILS+   
Sbjct: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132

Query: 66  XXXXXXXXXXXXXX--------------XXXXXXXXXXXXEGRNAHPMGGHPQREDESTN 111
                                                    G +A     H   E ES  
Sbjct: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKR 192

Query: 112 EA-TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKG 170
              ++I  ++T + LY GK V FQL R  +C  C G   R++     +  P +SCT C G
Sbjct: 193 TPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH----FQKPEISCTSCNG 248

Query: 171 AGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVT 230
            G+ ER+   +  +       C  C GKG Y  K  SD   CK C G+GLI E++   V 
Sbjct: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDT--CKHCSGKGLINEEKSQTVY 306

Query: 231 IPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIE 290
           IPRGS + +     +  D +   +  GD++  +   DE +       + ++  DLH  + 
Sbjct: 307 IPRGSRHGDEFRLPQMADMEY-GKETGDVIIVI---DEDSSKSH---LERKSNDLHTTLN 359

Query: 291 IPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMF 350
           I L++A++G     + +T+D+R L++ +P GKV+RPG+    KGEGWP + NG  FGDM+
Sbjct: 360 ISLVDALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLS-NGDSFGDMY 417

Query: 351 VHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDE 408
           V +N+EFP DNW +E+++IT L N+LP  KS D   +  D  N E V  Y +L + DE
Sbjct: 418 VQINIEFPKDNWFNEKSEITALRNILPGLKSKD--TKDPDPLNTEDVLSYSVLHSHDE 473

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  250 bits (639), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/446 (34%), Positives = 246/446 (55%), Gaps = 37/446 (8%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y +LG+  ++T+ E+++AYR LAL +HPDK+ D  ++A +E KFKEI+ AY+ILS+    
Sbjct: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN-----AHPMGGHPQRED--ESTNEATQ---I 116
                                       +      +  G + Q ED  + T++ T+   +
Sbjct: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFVV 125

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVER 176
            ++++ K LY GK  +F+L RNV+C+ C+G   R+R     +  P + C  C G G+ ER
Sbjct: 126 PLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRA---AHCMP-MKCGICDGRGFKER 181

Query: 177 LVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSE 236
           +   SP F   +R+ C +C GKG   ++  SD   CK CHG+ +I E   L + +PRG  
Sbjct: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDN--CKKCHGKCVIVENSILTLYVPRGHR 239

Query: 237 NSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEA 296
           +++TI    + D +   +  GD+VF +   DE    DPD  + ++GTDLH +I I L EA
Sbjct: 240 HADTIRIDGQADMEA-GKETGDLVFEI---DEIT--DPDAELERKGTDLHCSITISLAEA 293

Query: 297 ISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVE 356
           ++G   R + +TFDDR+L++T+P GKVLRPG+ +    EGWP   NG+ FGD++V VN+E
Sbjct: 294 LTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP-INNGSRFGDLYVKVNIE 351

Query: 357 FPPDNWISERNDITTLTNVLPAGK-SDDGHAQTG-DANNAEFVKDYEILKATD------- 407
           FP DNW++E++++  + ++LP  K S + H   G D  N E +  Y +++ +        
Sbjct: 352 FPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLA 411

Query: 408 -EGTRSSNTKTASRPPAQGLYKCSIQ 432
            EG + SN +   R  A    +C +Q
Sbjct: 412 QEGQQRSNQQYGERNTAS---ECPVQ 434

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  248 bits (634), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 145/419 (34%), Positives = 223/419 (53%), Gaps = 37/419 (8%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNX 63
           ++PY+ LGV  D+T DEI+KAYR+LAL+ HPDKV D   +  +E+KFKE+  AYE+LSN 
Sbjct: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEA---------- 113
                                       +G  A   G       +   EA          
Sbjct: 61  EKRQNYDTYGDTNGFSGDYSGFQ-----DGDFASFFGNFASNRYQDEYEAQSPPSPRTDD 115

Query: 114 TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGY 173
             + I +T+++LYNGK ++FQ  RNV+C  C+G   RRR           +C++C+G G 
Sbjct: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARH------ASACSQCEGHGV 169

Query: 174 VERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPR 233
            +RL    P F   + + C KC G G    K    ++ CK CHG+ +  E + L V IPR
Sbjct: 170 KQRLRRLGPGFVTREIVQCDKCKGLG----KNLRSEDMCKKCHGKRVTPESKNLNVYIPR 225

Query: 234 GSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPL 293
           GS + + ++ K + DE+   +  GD+VF +  +   +       + + G+DL+  I I L
Sbjct: 226 GSRHGDRVVLKGEADEEP-GKIPGDLVFDIAENSASSS------LERRGSDLYAKITISL 278

Query: 294 IEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHV 353
            +A++G +    T T D R+LKL +P G+V+RPG+ + I  EGWP    G++FGDM+V +
Sbjct: 279 SDALTGFEKEVCT-TLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQI 337

Query: 354 NVEFPPDNWISERNDITTLTNVLP----AGKSDDGHAQTGDANNAEFVKDYEILKATDE 408
           ++EFPPD+W SER+D+ +L N+LP    +  + D +A   D  N E    + I+K+ +E
Sbjct: 338 DIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEE 396

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  243 bits (620), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 205/379 (54%), Gaps = 23/379 (6%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNX 63
           ++PYD LGV  D+T DEI+KAYR+LAL+ HPDKV D   +  +E+KFKE+  AYE+LSN 
Sbjct: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTN-----EATQIEI 118
                                               G +   ED   +     +   + +
Sbjct: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120

Query: 119 EVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLV 178
            +T++DLYNGK V+FQ TRNV+C  C+G   R+R      +    +CT C+G G  +RL 
Sbjct: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR------ARHASACTHCEGHGVKQRLR 174

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
              P F   + + C KC G G    K    ++ CK CHG+ +  E + L V IPRGS ++
Sbjct: 175 RLGPGFVTRETVQCTKCRGLG----KNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHN 230

Query: 239 NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
           + I+ + + DE+   +  GD+VF +      +       + + G+DLH  I I L +A++
Sbjct: 231 DRIVLEGEADEEP-GKLTGDLVFDISEDSTTSN------LERRGSDLHTKIIISLSDALT 283

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G +    T T D R L+L +P G+V+RPG+ I +K EGWP    G +FG+M+V +N+EFP
Sbjct: 284 GFEKEVCT-TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342

Query: 359 PDNWISERNDITTLTNVLP 377
           PD+W SER +I  L N++P
Sbjct: 343 PDHWYSERGEIEALRNIIP 361

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  241 bits (616), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/457 (34%), Positives = 241/457 (52%), Gaps = 38/457 (8%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D++  EI+ AYRKLALK HPDK +D   K  NE+KFKEIT AYEILS+    
Sbjct: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 67  XXXXXXXXXXXXXXXXXX--------------XXXXXXXEGRNAHPMGGHPQREDE-STN 111
                                                  EG N  P       ED+  ++
Sbjct: 71  SHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEG-NDFPREYDTYEEDKCKSS 129

Query: 112 EATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGA 171
           +   I+I +T+KDLY GK +KF+L R ++C +C G+ W+ +K   ++    + C  C G 
Sbjct: 130 KDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKK--IHVTHEVECESCGGK 187

Query: 172 GYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
           G  ERL    P     Q ++C KC GKG+Y  +P + KN C  C G GL  +K+ + V +
Sbjct: 188 GSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNV 247

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTK--EGT--DLHM 287
             G   ++ I  K   DE+L     GD+ F L +  + N     I +    EG+  DL+ 
Sbjct: 248 APGHHFNDVITIKGMADEELDKSACGDLKFHL-VEKQENLEQKQIFLKNFDEGSAEDLYT 306

Query: 288 NIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KTPNGTE 345
           +  I L EA++G + +FLT+TFDDR+L L++  G+V+RPGD I I  EGWP    P G  
Sbjct: 307 SATISLSEALTGFE-KFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365

Query: 346 FGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGH--AQTGDAN----NAEFVKD 399
            GD++V +++EFPPDNW +E++++  +  +LP+  S      A TG+ +    N E + +
Sbjct: 366 -GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISN 424

Query: 400 YEILKATD--EGTR--SSNTKTASRPPAQGLYKCSIQ 432
           ++I+   +  EG +  +S ++ ++   A+  Y C +Q
Sbjct: 425 FQIINMEELPEGMKIFNSESQNSAHQKAKSSY-CPMQ 460

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  239 bits (610), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 225/403 (55%), Gaps = 21/403 (5%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y++LG+   +++ E+++AYR+LAL++HPDK+ D  E+ ++E KFKEI+ AY +LS+    
Sbjct: 6   YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEA------TQIEIEV 120
                                         +  G H  + +E   E       + + +++
Sbjct: 66  AEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGRTADSTVPLKL 125

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           T K LY GK  +F+  R V+C  C G+  R+R      + P++ C  C+G GY ER+   
Sbjct: 126 TTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAA----ARPMIRCEGCEGQGYKERISRI 181

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P     +R+SC  C GKG+    PT+  + CK C G+ +++E+  + V +PRGS++ + 
Sbjct: 182 GPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDR 239

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           + +  + D +   +  GD+VF +   DE    D    + ++GTDL+  ++I L EA++G 
Sbjct: 240 LRYPGQSDMEP-GKETGDLVFVI---DEQT--DVSSSLERKGTDLYCTMKISLAEALTGF 293

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
             R +T+TFD+RVL++ +P+GKVLRPG+ +    EGWP   +G  FGDM+V V +EFP D
Sbjct: 294 T-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP-IEDGARFGDMYVQVLIEFPKD 351

Query: 361 NWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEIL 403
           NW +E+ ++  + N+LP G +D    +T D +N E V+ Y I+
Sbjct: 352 NWFNEKAELDAIRNILP-GLADAPSTKTEDPSNTEEVRAYSII 393

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  234 bits (597), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 151/439 (34%), Positives = 224/439 (51%), Gaps = 40/439 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y +LGV RD+   EI+ AYRKLALK HPDK +D + K  NE+KFKEIT AYEILS+    
Sbjct: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70

Query: 67  XXXXXXXXXXXXXX---XXXXXXXXXXXEGRNAHPMGGHP-----------QREDESTNE 112
                                          N    GGH            +  D ++++
Sbjct: 71  SHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSASSK 130

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
              I+I +T+KDLY GK ++F L R V+C  C G+ W+ +K   ++    + C  C G G
Sbjct: 131 DIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKR--VHVTHEVECESCGGKG 188

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
             ERL    P     Q + C KC GKG+Y   P + KN C  C G GL  +K+ + V + 
Sbjct: 189 SKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVA 248

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDE---------PNGGDPDILVTKEGT 283
            G   ++ I  +   DE++     GD+ F L    E          N GD ++       
Sbjct: 249 PGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNM------E 302

Query: 284 DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNG 343
           D ++++ I L EA++G + +FLTKTFDDR+L L++  G+V+RPGD + I  EGWP   + 
Sbjct: 303 DSYVSVTISLSEALTGFE-KFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDA 361

Query: 344 T-EFGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDAN---NAEFVKD 399
               GD++V +++EFPPDNW +E++++  +   LP+  S      +GDAN   N E V +
Sbjct: 362 RGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSS--SCASGDANDLINNETVSN 419

Query: 400 YEILKATD--EGTRSSNTK 416
           ++I+   D  EG ++   K
Sbjct: 420 FQIIHTDDLPEGVKTFKPK 438

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  211 bits (538), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 219/428 (51%), Gaps = 37/428 (8%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPE--EKASNEM---KFKEITTAYE 58
           ++ Y +LGV +D++ DEI++AYRKLAL+ HPDK    E  E +S+++    FKE+T AY+
Sbjct: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60

Query: 59  ILSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDES------TNE 112
           +LS+                                 +HP  GH    D         ++
Sbjct: 61  VLSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHP--GHRSGFDSGRGARRYKSD 118

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWR------RRKNGDLYSPPVLSCT 166
             +I+++V   +LY GK V F L R   C  CDG  W+      ++K    +      C 
Sbjct: 119 DIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWN---VCE 175

Query: 167 KCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEG---LIKE 223
            C+G G  +RL   +P F   + I CR+C GKG+    P S+KNKC  C   G   +++E
Sbjct: 176 GCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEE 235

Query: 224 KQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGT 283
            + + + I +G+ + + I+ K + DEDL +   GD+V +++   EP        + + G 
Sbjct: 236 NKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQ-----YDIVRNGY 290

Query: 284 DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNG 343
           DL +  +I L +AI G   + L +T+D RVLK +  +GKV+RP D + I+ EGWP+  + 
Sbjct: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350

Query: 344 TE------FGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDAN-NAEF 396
            +       GD++V V++ FPPDNW  E ND   + N++P+  +    + +G++  N E 
Sbjct: 351 NDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVEN 410

Query: 397 VKDYEILK 404
           +   EI+K
Sbjct: 411 INVSEIVK 418

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  167 bits (424), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 122/375 (32%), Positives = 182/375 (48%), Gaps = 35/375 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV   + D++I+KAYRK ALKFHPDK  +P E+A+   KFKEIT+AYEILS+    
Sbjct: 8   YDLLGVSPGADDNQIKKAYRKSALKFHPDK--NPSEEAAE--KFKEITSAYEILSDSQKR 63

Query: 67  XXXXX-XXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQR-EDESTNEATQIEIEVTLKD 124
                                     E   +   GG   R          + EI  TL+ 
Sbjct: 64  EVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHEIPATLEQ 123

Query: 125 LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGY--VERLVGDSP 182
           L+ G+  K  L + +IC  C+G   R  K G      V  CT C G G+  V R +G  P
Sbjct: 124 LFKGRTAKLALNKQLICKSCEG---RGGKEGS-----VKKCTACSGQGFKFVTRQMG--P 173

Query: 183 FFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTII 242
             Q  Q + C  C G GE        K +CK+C G+ ++ E++ L V I  G ++   I+
Sbjct: 174 MIQRFQ-VECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIV 228

Query: 243 FKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQG 302
           F+ + D+       GD+VF +     P       +  ++G DLH + EI L+ AI+G  G
Sbjct: 229 FQGEADQSPGI-IPGDVVFVVSEQPHP-------VFKRDGNDLHYDAEIDLLSAIAG--G 278

Query: 303 RFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNW 362
           +F  K      LK+ +  G+V+ PG   VI+G+G P  P    +G++ +  N++FPP ++
Sbjct: 279 QFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMP-IPKYGGYGNLLIKFNIKFPPAHF 337

Query: 363 ISERNDITTLTNVLP 377
             +   +  L  +LP
Sbjct: 338 TDDET-LKKLEEILP 351

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  153 bits (387), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 182/379 (48%), Gaps = 39/379 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D+ D +I+KAYRK ALK+HPDK  +P E+A++  KFK+IT AYEILS+    
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKSALKYHPDK--NPSEEAAD--KFKQITGAYEILSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPM------GGHPQREDESTNEATQIEIEV 120
                                     G            GG  +          + +I  
Sbjct: 64  EMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIRHDISC 123

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLV 178
           TL++LY G+  K  L + V+C  C+G   R  K G      V  CT C G G  +V R +
Sbjct: 124 TLENLYKGRAAKLALNKTVLCKRCEG---RGGKAGS-----VKKCTSCNGQGVKFVTRHM 175

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
           G  P  Q  Q  +C  C G+G+    P +D  +CK C G+ +  E++ L V I  G ++ 
Sbjct: 176 G--PMIQRFQ-TTCEVCNGEGDVI--PAAD--RCKDCDGKKIASERKILEVNIQPGMKHG 228

Query: 239 NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
             I+F+ + D+    +  GD+VF +   + P          + G +LH   EI L+ AI+
Sbjct: 229 QKIVFQGEADQQ-PGQIPGDVVFVVNEQEHPR-------FVRNGDNLHYEAEIDLLTAIA 280

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G  G+F  +      LK+ +  G+V+ PG   VI+G+G P    G+ +GD+ +  NV+FP
Sbjct: 281 G--GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKFP 337

Query: 359 PDNWISERNDITTLTNVLP 377
             ++  E   +  L  +LP
Sbjct: 338 KSHFADEEA-LKKLEAILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  151 bits (382), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 183/378 (48%), Gaps = 38/378 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D+ D +I+KAYRK ALK+HPDK  +P  +A++  KFK++T AYEILS+    
Sbjct: 8   YDLLGVSADANDAQIKKAYRKAALKYHPDK--NPSSEAAD--KFKQMTAAYEILSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN---AHPMGGHPQREDESTNEATQI--EIEVT 121
                                           +   GG          +   I  +I  T
Sbjct: 64  EVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIKHDISCT 123

Query: 122 LKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVG 179
           L++LY G+  K  L + V+C  C+G   R  K+G      V  C+ C G G  +V R +G
Sbjct: 124 LENLYKGRTAKLALNKTVLCKSCEG---RGGKSGS-----VKKCSSCGGHGVKFVTRQMG 175

Query: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239
             P  Q  Q  +C  C G+G+        K++C+ C G+ +  E++ L V I  G +N  
Sbjct: 176 --PMIQRFQ-TTCEACNGEGDV----IDPKDRCRECSGKKISNERKILEVNIEPGMKNGQ 228

Query: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299
            ++F+ + D+    +  GD+VF +   + P          + G +LH   +I L+ A++G
Sbjct: 229 KVVFQGEADQQ-PGQIPGDVVFVVNEQEHPK-------FVRNGDNLHYEAQIDLLTAVAG 280

Query: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPP 359
             G+F  +      LK+ +  G+V+ PG   VI+G+G P    G+ +G++ +  NV+FP 
Sbjct: 281 --GQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNVKFPK 337

Query: 360 DNWISERNDITTLTNVLP 377
            ++ S+  D+  L  +LP
Sbjct: 338 SHFASDA-DLKKLEEILP 354

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 178/377 (47%), Gaps = 37/377 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV   +TD EI+KAYRK+ALKFHPDK  +P E+A+   KFKE ++AYE+LS+    
Sbjct: 8   YDVLGVSVTATDVEIKKAYRKMALKFHPDK--NPSEEAAE--KFKEASSAYEVLSDADKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN--AHPMGGHPQREDESTNEATQI--EIEVTL 122
                                     G +  +   GG   +          I  EI VTL
Sbjct: 64  DTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQRGRDIKHEINVTL 123

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVGD 180
           ++LY GK  K  L + ++C  C+G   R  K G      V  C+ C G G  +V R +G 
Sbjct: 124 EELYRGKTSKLALNKQILCKTCEG---RGGKKG-----AVKKCSSCNGQGIKFVTRQMG- 174

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V +  G +N   
Sbjct: 175 -PMIQRFQ-TECDVCHGAGDI----VDPKDRCKSCNGKKVASERKILEVHVDPGMKNGQK 228

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           ++FK + D+       GD+VF +          P     + G +L    E+ L+ AI+G 
Sbjct: 229 VVFKGEADQAPDV-IPGDVVFVINEK-------PHKHFQRSGDNLVYEAEVDLLTAIAG- 279

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
            G F  +      LK+ +  G+V+ PG   VI G+G P    G  +G++ +   V+FP  
Sbjct: 280 -GEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPEP 337

Query: 361 NWISERNDITTLTNVLP 377
           ++ +E N +  L  +LP
Sbjct: 338 HFTTEEN-LKKLEEILP 353

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  146 bits (369), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 179/380 (47%), Gaps = 37/380 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDILGV   ++D EI+KAYRK ALK+HPDK  +P E+A+   KFKE ++AYE+LS+    
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDK--NPSEEAAE--KFKEASSAYEVLSDSEKR 63

Query: 67  XXXXX--XXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQI--EIEVTL 122
                                      E   +   GG              I  EI V+L
Sbjct: 64  DIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRDIKHEISVSL 123

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVGD 180
           ++LY GK  K  L + ++C  C+G   R  K G      V  C+ C G G  +V R +G 
Sbjct: 124 EELYKGKTSKLALNKQILCKTCEG---RGGKKG-----AVKKCSSCNGQGIKFVTRQMG- 174

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P  Q  Q   C  C G G+        K++CK CHG+ +  E++ L V +  G +N   
Sbjct: 175 -PMIQRFQ-TECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQK 228

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           ++FK + D+       GD++F +          P     + G DL    EI L+ A++G 
Sbjct: 229 VVFKGEADQAPDI-IPGDVIFVISEK-------PHKHFQRVGDDLIYEAEIDLLTAVAG- 279

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
            G F  +      LK+++  G+V+ P    V++G+G P    G  +G++ +  +++F P+
Sbjct: 280 -GEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLIIKFSIKF-PE 336

Query: 361 NWISERNDITTLTNVLPAGK 380
           N  ++ + +  L  +LPA K
Sbjct: 337 NHFADEDTLKKLEEILPARK 356

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  145 bits (367), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 117/378 (30%), Positives = 178/378 (47%), Gaps = 38/378 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDILGV   +TD EI+KAYRK ALKFHPDK  +P E+A+   KFKE ++AYE+LS+    
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKFHPDK--NPSEEAAE--KFKEASSAYEVLSDSEKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN-----AHPMGGHPQREDESTNEATQIEIEVT 121
                                       +         GG  + +        + EI  +
Sbjct: 64  EVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRGRDIKHEISAS 123

Query: 122 LKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVG 179
           L++LY G+  K  L + ++C  C+G   R  K G      V  CT C G G  +V R +G
Sbjct: 124 LEELYKGRTAKLALNKQILCKECEG---RGGKKG-----AVKKCTGCNGQGIKFVTRQMG 175

Query: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239
             P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V +  G ++  
Sbjct: 176 --PMIQRFQ-TECDACHGTGDI----VDPKDRCKSCNGKKIENERKILEVHVEPGMKDGQ 228

Query: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299
            I+FK + D+       GD+VF +          P     ++G DL    EI L+ AI+G
Sbjct: 229 KIVFKGEADQAPDV-IPGDVVFLVSER-------PHKHFKRDGDDLVYEAEIDLLTAIAG 280

Query: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPP 359
             G F  +      LK+ +  G+V+ PG   VI+G+G P  P    +G++ V   ++FP 
Sbjct: 281 --GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMP-VPKYGGYGNLIVKFTIKFPE 337

Query: 360 DNWISERNDITTLTNVLP 377
           +++ +E N +  L  +LP
Sbjct: 338 NHFTTEEN-LKKLEEILP 354

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  144 bits (363), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 182/386 (47%), Gaps = 53/386 (13%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD++GV   + D +I+KAYRK ALK+HPDK  +P E+A+   KFKEI++AYEILS+    
Sbjct: 8   YDLIGVSPGADDAQIKKAYRKAALKYHPDK--NPTEEAAE--KFKEISSAYEILSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXE-------------GRNAHPMGGHPQREDESTNEA 113
                                                  G ++ P G    R+       
Sbjct: 64  EMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRD------- 116

Query: 114 TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG- 172
            + EI  TL++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G 
Sbjct: 117 IRHEISATLEELYKGRTAKLALNKQILCKSCEG---RGGKAG-----AVKKCSSCNGQGF 168

Query: 173 -YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
            ++ R +G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V I
Sbjct: 169 KFITRQMG--PMIQRFQ-AECDACNGTGDI----IDAKDRCKACNGKKIANERKILEVHI 221

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
             G ++   I+F+ + D+      A D+V    +        P     ++G DL+   E+
Sbjct: 222 EPGMKDGQKIVFQGEADQ------APDVVPGDVVFVVSE--RPHERFNRKGDDLYYEAEV 273

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFV 351
            L+ AI+G  G F  +      LK+ +  G+V+ PG T +I+G+G P    G  FG++ V
Sbjct: 274 DLLTAIAG--GEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIV 330

Query: 352 HVNVEFPPDNWISERNDITTLTNVLP 377
              ++FPP+++  E + +  L N+LP
Sbjct: 331 KFKIKFPPNHFADEAS-LKQLENILP 355

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  144 bits (362), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 115/379 (30%), Positives = 180/379 (47%), Gaps = 39/379 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D+ D +I+KAYRK ALKFHPDK  +P E+A++  KFKE+T AYEILS+    
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKQALKFHPDK--NPSEEAAD--KFKELTVAYEILSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN----AHPMGGHPQREDESTNEATQI--EIEV 120
                                     G      +   GG   +      +   I  E+  
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIKHEMSA 123

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLV 178
           +L++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  ++ R +
Sbjct: 124 SLEELYKGRTAKLALNKQILCKTCEG---RGGKAG-----AVKKCSSCNGQGIKFITRQM 175

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
           G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V I  G ++ 
Sbjct: 176 G--PMIQRFQ-AECDVCSGTGDI----IDPKDRCKSCNGKKIDNERKILEVHIEPGMKDG 228

Query: 239 NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
             I+F+ + D+       GD+VF +          P     ++G DL    E+ L+ AI+
Sbjct: 229 QKIVFQGEADQAPGI-IPGDVVFVISQR-------PHKHFERKGDDLLYQAEVDLLSAIA 280

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G  G F  +      LK+++  G+V+ PG T VI+G+G P    G  +G++ V   + FP
Sbjct: 281 G--GEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIVTFKINFP 337

Query: 359 PDNWISERNDITTLTNVLP 377
            +++  E + +  L  +LP
Sbjct: 338 TNHFADEES-LKKLEEILP 355

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  143 bits (361), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 180/386 (46%), Gaps = 53/386 (13%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDILGV   +TD EI+KAYRK ALK+HPDK  +P E+A+   KFKE ++AYEILS+    
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDK--NPSEEAAE--KFKEASSAYEILSDSEKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXE-------------GRNAHPMGGHPQREDESTNEA 113
                                                  G    P G  PQR      + 
Sbjct: 64  DVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRG--PQR-----GKD 116

Query: 114 TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG- 172
            + EI  +L++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G 
Sbjct: 117 IKHEISASLEELYKGRTAKLALNKQILCKGCEG---RGGKKG-----AVKKCSSCNGQGI 168

Query: 173 -YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
            +V R +G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V +
Sbjct: 169 KFVTRQMG--PMIQRFQ-TECDVCHGTGDI----VDPKDRCKSCNGKKVENERKILEVHV 221

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
             G ++   I+FK + D+       GD+VF +          P     ++G DL    EI
Sbjct: 222 EPGMKDGQRIVFKGEADQAPDV-IPGDVVFLVSER-------PHKSFKRDGDDLVYEAEI 273

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFV 351
            L+ AI+G  G F  +      LK+ +  G+V+ PG   VI+G+G P  P    +G++ +
Sbjct: 274 DLLTAIAG--GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMP-VPKYGGYGNLII 330

Query: 352 HVNVEFPPDNWISERNDITTLTNVLP 377
              V+FP +++ +E N +  L  +LP
Sbjct: 331 KFTVKFPENHFTAEEN-LKKLEEILP 355

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  143 bits (360), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 122/420 (29%), Positives = 192/420 (45%), Gaps = 43/420 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D+ D +I+K YRK ALKFHPDK  +P  +A++  KFKE+T AYE+LS+    
Sbjct: 8   YDLLGVPVDANDAQIKKGYRKQALKFHPDK--NPSAEAAD--KFKELTVAYEVLSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPM-----GGHPQREDESTNEATQIEIEVT 121
                                     G           GG  +          + E+  +
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIKHEMSAS 123

Query: 122 LKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVG 179
           L++LY G+  K  L + V+C  C+G   R  K G      V  C  C G G  ++ R +G
Sbjct: 124 LEELYKGRTAKLALNKQVLCKTCEG---RGGKEG-----AVKKCASCNGQGVKFITRQMG 175

Query: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239
             P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V I  G ++  
Sbjct: 176 --PMIQRFQ-AECDACNGTGDI----VDPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQ 228

Query: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299
            I+F+ + D+       GD++F +          P     ++G +L+   E+ L+ AI+G
Sbjct: 229 KIVFQGEADQAPGV-IPGDVIFVISQR-------PHKHFERKGDNLYYQAEVDLLSAIAG 280

Query: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPP 359
             G F  +      LK+ +  G+V+ PG T VI+G+G P    G  FGD+ V   V FP 
Sbjct: 281 --GEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPT 337

Query: 360 DNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNTKTAS 419
           +++  E + +  L  +LP  ++     ++ D      + DY+  K +    R SN + AS
Sbjct: 338 NHFADEES-LKKLEEILPP-RAKPSFPKSADVEEC-VMNDYDPAKHS---GRQSNGRGAS 391

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  142 bits (359), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 186/397 (46%), Gaps = 38/397 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD LGV   ++D EI+KAYRK ALK+HPDK  +P E+A+   KFKE+++AYEILS+    
Sbjct: 8   YDTLGVSPGASDAEIKKAYRKSALKYHPDK--NPSEEAAE--KFKEVSSAYEILSDSQKR 63

Query: 67  XXXXX-XXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQI--EIEVTLK 123
                                     E   +   GG              I  E+  +L+
Sbjct: 64  EVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHEMAASLE 123

Query: 124 DLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVGDS 181
           +LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  +V R +G  
Sbjct: 124 ELYKGRTAKLALNKQILCKSCEG---RGGKEG-----AVKKCSSCNGQGIKFVTRQMG-- 173

Query: 182 PFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTI 241
           P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V I  G ++   I
Sbjct: 174 PMIQRFQ-TECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKI 228

Query: 242 IFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQ 301
           +FK + D+       GD+VF +          P     + G DL    EI L+ A++G  
Sbjct: 229 VFKGEADQAPDV-IPGDVVFVISEK-------PHKHFQRAGDDLIYEAEIDLLTALAG-- 278

Query: 302 GRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDN 361
           G+F  +      LK+ +  G+V+ PG   +++G+G P    G  +G++ +  N++FP ++
Sbjct: 279 GQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKFNIKFPENH 337

Query: 362 WISERNDITTLTNVLPAGKSDD--GHAQTGDANNAEF 396
           + SE N +  L  +LP  +  +    AQ  D   +EF
Sbjct: 338 FTSEEN-LKKLEEILPPRRQINIPAKAQVDDCVLSEF 373

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  142 bits (358), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 179/385 (46%), Gaps = 52/385 (13%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXX- 65
           YDILGV   +TD EI+KAYRK ALK+HPDK  +P E+A+   KFKE + AYEILS+    
Sbjct: 8   YDILGVPVTATDVEIKKAYRKCALKYHPDK--NPSEEAAE--KFKEASAAYEILSDPEKR 63

Query: 66  -----------XXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEAT 114
                                                 G    P G  PQR      +  
Sbjct: 64  DIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRG--PQR-----GKDI 116

Query: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG-- 172
           + EI  +L++LY G+  K  L + ++C  C+G   R  K G      V  CT C G G  
Sbjct: 117 KHEISASLEELYKGRTAKLALNKQILCKECEG---RGGKKG-----AVKKCTSCNGQGIK 168

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
           +V R +G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V + 
Sbjct: 169 FVTRQMG--PMIQRFQ-TECDVCHGTGDI----IDPKDRCKSCNGKKVENERKILEVHVE 221

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
            G ++   I+FK + D+       GD+VF +          P     ++G DL    EI 
Sbjct: 222 PGMKDGQRIVFKGEADQAPDV-IPGDVVFIVSER-------PHKSFKRDGDDLVYEAEID 273

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
           L+ AI+G  G F  +      LK+ +  G+V+ PG   VI+G+G P  P    +G++ + 
Sbjct: 274 LLTAIAG--GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMP-IPKYGGYGNLIIK 330

Query: 353 VNVEFPPDNWISERNDITTLTNVLP 377
             ++FP +++ SE N +  L  +LP
Sbjct: 331 FTIKFPENHFTSEEN-LKKLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  142 bits (357), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 119/385 (30%), Positives = 180/385 (46%), Gaps = 52/385 (13%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDILGV   +TD EI+KAYRK ALK+HPDK  +P E+A+   KFKE ++AYEILS+    
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDK--NPSEEAAE--KFKEASSAYEILSDSEKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXE------------GRNAHPMGGHPQREDESTNEAT 114
                                                 G    P G  PQR      +  
Sbjct: 64  EVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRG--PQR-----GKDI 116

Query: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG-- 172
           + EI  +L++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  
Sbjct: 117 KHEISASLEELYKGRTAKLALNKQILCKGCEG---RGGKKG-----AVKKCSSCNGQGIK 168

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
           +V R +G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V + 
Sbjct: 169 FVTRQMG--PMIQRFQ-TECDVCHGTGDI----IDPKDRCKSCNGKKVENERKILEVHVE 221

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
            G ++   I+FK + D+       GD+VF +      N         ++G DL    EI 
Sbjct: 222 PGMKDGQRIVFKGEADQAPDV-IPGDVVFIVSERPHKN-------FKRDGDDLVYEAEID 273

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
           L+ AI+G  G F  +      LK+ +  G+V+ PG   VI+G+G P  P    +G++ + 
Sbjct: 274 LLTAIAG--GEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMP-IPKYGGYGNLVIK 330

Query: 353 VNVEFPPDNWISERNDITTLTNVLP 377
             ++FP +++ +E N +  L  +LP
Sbjct: 331 FTIKFPENHFTTEEN-LKKLEEILP 354

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  141 bits (356), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 135/449 (30%), Positives = 206/449 (45%), Gaps = 67/449 (14%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV   +++ EI+KAYRK ALK+HPDK  +P E+A+   KFKE ++AYE+L +    
Sbjct: 8   YDLLGVSATASETEIKKAYRKTALKYHPDK--NPSEEAAE--KFKEASSAYEVLMDAEKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXE--------------GRNAHPMGGHPQREDESTNE 112
                                                   G  + P G  PQR       
Sbjct: 64  EAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRG--PQR-----GR 116

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
             + EI VTL++LY G+  K  L + ++C  C+G   R  K G      V  CT C G G
Sbjct: 117 DIKHEITVTLEELYKGRTSKLALNKQILCKTCEG---RGGKEG-----AVKKCTSCNGQG 168

Query: 173 --YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVT 230
             ++ R +G  P  Q  Q   C  C G G+      + K++CK C G+ +  E++ L V 
Sbjct: 169 VKFITRQMG--PMIQRFQ-TECDACDGTGDI----INPKDRCKACSGKKVANERKILEVH 221

Query: 231 IPRGSENSNTIIFKEKGDE--DLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMN 288
           +  G ++   I+FK + D+  D+     GD++F +          P     ++  DL   
Sbjct: 222 VDPGMKDGQKIVFKGEADQAPDI---IPGDVIFVVSER-------PHKHFRRDSDDLVYE 271

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGD 348
            +I L+ AI+G  G F  +      LK+ +  G+V+ PG   VI+G+G P    G  FG+
Sbjct: 272 ADIDLLTAIAG--GEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGN 328

Query: 349 MFVHVNVEFPPDNWISERNDITTLTNVLPAGK--SDDGHAQTGDANNAEFVKDYEILKAT 406
           + V  N+ FP D++ S  N +  L  +LP  K  S    A   D   +EF  D     +T
Sbjct: 329 LLVKFNIVFPKDHFTSLEN-MKKLEEILPPRKKTSIPSKAHVDDCVLSEF--DAAKYSST 385

Query: 407 DEGTRSSNT---KTASRPPAQGLYKCSIQ 432
             G RS+N+       +P A+G+ +C+ Q
Sbjct: 386 -RGGRSANSYDEDDEDQPGAEGV-QCASQ 412

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  141 bits (356), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/379 (29%), Positives = 173/379 (45%), Gaps = 39/379 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDILGV   +++ EI+K YRK ALK+HPDK  +P  +A+   KFKE + AYE+LS+    
Sbjct: 8   YDILGVSPTASESEIKKGYRKAALKYHPDK--NPTAEAAE--KFKECSAAYEVLSDPEKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN----AHPMGGHPQREDESTNEATQI--EIEV 120
                                     G      +   GG   +      +   I  EI  
Sbjct: 64  DVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDIKHEIAA 123

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLV 178
           TL++LY G+  K  L + ++C  C+G   +        +  V  C+ C G G  +V + +
Sbjct: 124 TLEELYKGRTAKLALNKQILCKSCEGRGGK--------ADAVKKCSSCGGQGIKFVTKQM 175

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
           G  P  Q  Q   C  C G G+        K +CK CHG+ +  E++ L V I  G ++ 
Sbjct: 176 G--PMIQRFQ-TECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPGMKDG 228

Query: 239 NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
             I+FK + D+       GD+VF +          P     + G DL    EI L+ AI+
Sbjct: 229 QRIVFKGESDQAPDI-IPGDVVFVVNEK-------PHKHFQRSGNDLVYLAEIDLLTAIA 280

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G  G F  +      LK+ +  G+V+ PG   VI+G+G P    G  +G++ +  N++FP
Sbjct: 281 G--GEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLIIQFNIKFP 337

Query: 359 PDNWISERNDITTLTNVLP 377
            +++  E N +  L  +LP
Sbjct: 338 ENHFTDESN-LKKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  140 bits (353), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/378 (30%), Positives = 176/378 (46%), Gaps = 37/378 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  ++++ EI+K YRK ALK+HPDK  +P E+A+   KFKE + AYE+LS+    
Sbjct: 8   YDLLGVSPNASETEIKKGYRKQALKYHPDK--NPSEEAAE--KFKECSAAYEVLSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN--AHPMGGHPQREDESTNEATQI--EIEVTL 122
                                     G +  +   GG   +          I  EI+ TL
Sbjct: 64  EVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQRGRDIKHEIQNTL 123

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVGD 180
           ++LY G+  K  L + ++C  C+G   R  K G      V  CT C G G  +V R +G 
Sbjct: 124 EELYKGRTAKLALNKQILCKTCEG---RGGKAG-----AVKKCTSCNGQGIKFVTRQMG- 174

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P  Q  Q   C  C G G+        K++CK C G+ +  E++ L V +  G      
Sbjct: 175 -PMIQRFQ-TECDVCHGSGDI----IDPKDRCKDCKGKKIANERKVLEVHVEPGMREGQK 228

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           I+FK + D+       GD++F +          P     + G DL    EI L+ AI+G 
Sbjct: 229 IVFKGEADQAPDV-IPGDVIFVVVEK-------PHKHFKRAGDDLLYEAEIDLLTAIAG- 279

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
            G F  +      LK++   G+V+  G   VI+G+G P  P    +G++ V   ++FP +
Sbjct: 280 -GEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMP-VPKYGGYGNLIVTFKIKFPEN 337

Query: 361 NWISERNDITTLTNVLPA 378
           N+ +E + +  L N+LPA
Sbjct: 338 NFATE-DKLKELENILPA 354

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  129 bits (324), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 109/377 (28%), Positives = 171/377 (45%), Gaps = 37/377 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  ++++ EI+K YRK ALK+HPDK  +P ++A+   KFKE + AYE+LS+    
Sbjct: 8   YDLLGVSPNASESEIKKGYRKAALKYHPDK--NPTDEAAE--KFKECSGAYEVLSDSQKR 63

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRN--AHPMGGHPQREDESTNEATQI--EIEVTL 122
                                     G +  +   GG              I  EI+ TL
Sbjct: 64  EIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGKDIRHEIQNTL 123

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YVERLVGD 180
           ++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  +V R +G 
Sbjct: 124 EELYKGRTAKLALNKQILCKGCEG---RGGKEG-----AVKKCSSCGGQGVKFVTRQMG- 174

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P  Q  Q   C  C G G+        K++CK C G  +  E++ L V +  G      
Sbjct: 175 -PMIQRFQ-TECDVCHGSGDI----IDPKDRCKECKGNKVANERKVLEVHVEPGMREGQK 228

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           + FK + D+       GD++F +          P     + G DL    E+ L+ AI+G 
Sbjct: 229 VTFKGEADQAPDI-IPGDVIFVVTEK-------PHKHFKRSGDDLLYEAEVDLLTAIAG- 279

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPD 360
            G F  +      LK+T+  G+V+ PG   VI G+G P    G  +G++ +   ++F P+
Sbjct: 280 -GDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKF-PE 336

Query: 361 NWISERNDITTLTNVLP 377
           N  ++   +  L ++LP
Sbjct: 337 NHFADEAKLKALEDILP 353

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  121 bits (303), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 103/377 (27%), Positives = 169/377 (44%), Gaps = 42/377 (11%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDP-EEKASNEMKFKEITTAYEILSNXXX 65
           Y ILGV R ++D +I+ AYR+L+ K+HPDK  +P +E A N  +F E+  AYE LS+   
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDK--NPGDEDAHN--RFIEVGEAYEALSDPEK 78

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXE--------------GRNAHPMGGHPQREDESTN 111
                                                    G  +   GG  QR  +   
Sbjct: 79  RKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQR-G 137

Query: 112 EATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGA 171
           ++ Q++ E+ LK  Y+G +++F ++ N  C  CDG+  +  K        V  C +C G 
Sbjct: 138 QSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGK--------VEKCGQCGGR 189

Query: 172 GYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
           G V +++      Q +Q++ C+KC G+GE        KNKCK CHG  ++K+ +   V +
Sbjct: 190 GMVVQVIRQGFITQQIQQM-CQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFHVDV 242

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
           P G+      + + + ++   T   GDI  ++      N G       + G DL     +
Sbjct: 243 PAGAPRDFVAVIRGEAEKSPDT-EPGDIYVKVVESPVQNMG-----YRRRGPDLFRTEVL 296

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFV 351
            L EA+ G   R L      + + L+  +G  ++ G+   IKG G P   +GT++GD++V
Sbjct: 297 SLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMP-LESGTKYGDLYV 355

Query: 352 HVNVEFPPDNWISERND 368
              +  P     +  ND
Sbjct: 356 DYVIVMPSKYKPAPLND 372

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  109 bits (273), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 155/370 (41%), Gaps = 41/370 (11%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDP-EEKASNEMKFKEITTAYEILSNXXX 65
           Y ILGV++D+ D EI+ AYR+L+ K+HPDK  +P +E+A N  KF E+  AY++LS+   
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDK--NPGDEEAHN--KFIEVGEAYDVLSDSEK 79

Query: 66  XXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPM-----GGHP---------QREDESTN 111
                                        +   M      G+P                 
Sbjct: 80  RNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRPRG 139

Query: 112 EATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGA 171
           +   +  EV+L D YNG+  K+ L  N  C  C G   +  K        V  C  C+G 
Sbjct: 140 QNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGK--------VTRCPDCQGR 191

Query: 172 GYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
           G + +++      Q +Q + C +C G GE        KN C  CHG  + K  ++  V +
Sbjct: 192 GVIVQVIQMGIMTQQIQHV-CDRCSGSGEII------KNPCPHCHGHKVAKMDKEFTVKL 244

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
           P G++  N +  K    E      AGD++F  + +   N G       + G  L+    +
Sbjct: 245 PNGAQ-RNYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMG-----YRRRGDHLYRTEVL 298

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP-KTPNGTEFGDMF 350
            + EA+ G   R L     D+ +KL     +V+  G+   + G G P     G +FGD+F
Sbjct: 299 SVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLF 358

Query: 351 VHVNVEFPPD 360
           +   +  P +
Sbjct: 359 IDYVILMPQE 368

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 157/370 (42%), Gaps = 39/370 (10%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
           +A  + Y ILGV +D++D EI+ AYR+L+ KFHPDK  +P ++ ++  KF E+  AYE+L
Sbjct: 21  VAAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDK--NPGDEDAHH-KFIEVGEAYEVL 77

Query: 61  SNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAH-PMGGHPQ---------REDEST 110
           S+                              G   H PM    Q               
Sbjct: 78  SDDQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRPR 137

Query: 111 NEATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKG 170
               +   E+TLK  Y G ++ F L  N  C  C G+  +  K           C++C+G
Sbjct: 138 GHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKT--------THCSECRG 189

Query: 171 AGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVT 230
            G V ++V   P  Q +Q++ C  C GKG+        KNKCK CHG  + ++ +   V 
Sbjct: 190 QGVVIQVVRMGPLTQKIQQM-CGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVD 242

Query: 231 IPRGSENSNTIIFKEKGDE--DLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMN 288
           +P G+      +   + D+  D  +   GD+  +       N G       + G  L+  
Sbjct: 243 VPAGAPRDFVDVKAGEADKGPDFDS---GDVFIKFSESSRDNMG-----YRRRGPHLYRT 294

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGD 348
             + L EA+ G   R +     ++ LKL   QG  +R G+   + G G P   +G   GD
Sbjct: 295 EVLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKH-GD 353

Query: 349 MFVHVNVEFP 358
           +FV   V  P
Sbjct: 354 LFVDYVVVIP 363

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  107 bits (268), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 128/263 (48%), Gaps = 29/263 (11%)

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGY--V 174
           EI VTL++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G GY  V
Sbjct: 120 EIAVTLEELYKGRTAKLALNKQILCKGCNG---RGGKEG-----AVKKCSSCNGQGYKFV 171

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            R +G  P  Q  Q   C  C G G+        K++CK C+G+ +  E++ L V +  G
Sbjct: 172 TRQMG--PMIQRFQ-TECEACAGTGDI----IDPKDRCKSCNGKKVANERKILEVHVDPG 224

Query: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294
            ++   I+FK + D+       GD++F +      N         + G DL    EI L+
Sbjct: 225 MKDGQKIVFKGEADQAPDV-IPGDVIFVVSEKPHKN-------FQRVGDDLVYEAEIDLL 276

Query: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354
            A++G  G F  +      LK+ +  G+V+ PG   V++G+G P    G  +G++ V   
Sbjct: 277 TAVAG--GEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLVTFK 333

Query: 355 VEFPPDNWISERNDITTLTNVLP 377
           + FPP+++ S+ N +  L  +LP
Sbjct: 334 INFPPNHFTSDEN-LKKLEEILP 355

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (78%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   +T+ EI+KAYRK ALK+HPDK  +P  +A+   KFKE+++AYE+LS+
Sbjct: 8  YDLLGVSVSATEIEIKKAYRKSALKYHPDK--NPSAEAAE--KFKEVSSAYEVLSD 59

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 125/263 (47%), Gaps = 29/263 (11%)

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YV 174
           E+  TL++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  +V
Sbjct: 121 ELSATLEELYKGRTAKLALNKQILCKTCEG---RGGKKG-----AVKKCSSCNGQGVKFV 172

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            R +G  P  Q  Q   C  C G G+        K++CK C+ + +  E++ L V I  G
Sbjct: 173 TRQMG--PMLQRFQ-AECEVCHGTGDI----IDPKDRCKTCNAKKVTNERKILEVHIEPG 225

Query: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294
            ++   ++FK + D+       GD++F +          P     + G DL    EI L+
Sbjct: 226 MKDGQKVVFKGEADQAPDI-IPGDVIFVVSQK-------PHEHFQRAGDDLVYEAEIDLL 277

Query: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354
            AI+G  G F  K      LK+ +  G+V+ PG   +I  +G P  P    +G++ V  N
Sbjct: 278 TAIAG--GEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMP-IPKYGGYGNLIVKFN 334

Query: 355 VEFPPDNWISERNDITTLTNVLP 377
           ++FPP+++  E + +  L  +LP
Sbjct: 335 IKFPPNHFTDEES-LKKLEEILP 356

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDILGV   ++  EI+KAYRK ALK+HPDK  +P E+A+   KFKE + AYE+LS+
Sbjct: 8  YDILGVSPSASSSEIKKAYRKFALKYHPDK--NPSEEAAE--KFKEASAAYEVLSD 59

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  105 bits (263), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 125/263 (47%), Gaps = 29/263 (11%)

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG--YV 174
           EI  TL++LY G+  K  L + ++C  C+G   R  K G      V  C+ C G G  +V
Sbjct: 122 EIAATLEELYKGRTAKLALNKQILCKTCEG---RGGKKG-----AVKKCSSCNGQGVKFV 173

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            R +G  P  Q  Q   C  C G G+        K++CK C+ + +  E++ L V I  G
Sbjct: 174 TRQMG--PMIQRFQ-AECDVCSGTGDI----IDPKDRCKTCNAKKVTNERKILEVHIEPG 226

Query: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294
            ++   I+FK + D+       GD++F +          P     + G DL    EI L+
Sbjct: 227 MKDGQNIVFKGEADQAPDV-IPGDVIFVV-------AQKPHKHFQRSGDDLVYEAEIDLL 278

Query: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354
            AI+G  G F  +      LK+++  G+V+ PG   VI+G+G P  P     G++ VH  
Sbjct: 279 TAIAG--GEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMP-IPKYGGHGNLIVHFT 335

Query: 355 VEFPPDNWISERNDITTLTNVLP 377
           V+FP  ++  E + +  L  +LP
Sbjct: 336 VKFPQKHFADE-DSLKKLEEILP 357

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + D EI+KAYRK ALK+HPDK  +P E+ +   KFKE++ AYEILS+
Sbjct: 8  YDVLGVSPTAGDSEIKKAYRKSALKYHPDK--NPTEEGAE--KFKEVSAAYEILSD 59

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 97/364 (26%), Positives = 155/364 (42%), Gaps = 37/364 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y ILG+++D++D EI+ +YR+L+ KFHPDK  +P ++ ++  KF EI  AYE+LS+    
Sbjct: 23  YAILGLNKDASDKEIKSSYRQLSKKFHPDK--NPGDEEAHH-KFIEIGEAYEVLSDPEKR 79

Query: 67  XXXXXXXXXXXXXXXXXXXXXX-----------XXXEGRNAHPMGGHPQREDESTNEATQ 115
                                                 R     GG   R         +
Sbjct: 80  KIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRGHNLK 139

Query: 116 IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVE 175
           +  +++LK+ Y G  ++F L  N IC  CDG      K        V  C+ C+G G V 
Sbjct: 140 VREQLSLKEYYTGATLEFTLALNDICDHCDGTGSADGK--------VAKCSDCQGRGVVI 191

Query: 176 RLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGS 235
           +++      Q +Q++ C +C GKG         KN CK CHG  ++K+++   V +P G+
Sbjct: 192 QVIRMGMMTQQIQQM-CGRCGGKGSVI------KNHCKTCHGSKVVKKQKPFHVEVPPGA 244

Query: 236 ENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIE 295
               T     + D+      AGD+          N G       + G  L+    +   E
Sbjct: 245 ARHYTETRSGESDKGADF-DAGDVFIEFNEKTTNNLG-----YRRRGPHLYRTEVLSARE 298

Query: 296 AISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE-FGDMFVHVN 354
           A+ G   R +    + + +K+   +  V+  G+   I G G P+ PNG   FGD+F+   
Sbjct: 299 ALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQ-PNGKHAFGDLFIEYV 357

Query: 355 VEFP 358
           V  P
Sbjct: 358 VVMP 361

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 117/256 (45%), Gaps = 26/256 (10%)

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           + ++  E++LKD Y+G  V+F+L  N IC  C+G+     K        V +C  C G G
Sbjct: 139 SLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGK--------VETCPDCGGQG 190

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
            + +++      Q +Q+  C +C G+G         KN+CK C G  ++K+ +   V +P
Sbjct: 191 ILIQIIRMGIMTQRIQQ-PCGRCSGRGHII------KNQCKACGGHKVVKKPKSFQVEVP 243

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
            G+   +  +  ++ D+      AGDI       D+ N G       + G  L     + 
Sbjct: 244 AGAPRDHVEVRHQEADQSTDME-AGDIFVEFTESDKNNMG-----YRRRGDHLFRTEVLS 297

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
             EA++G   R +    D + +KL  P+G ++  G+   I G G PK  +G  FGD+FV 
Sbjct: 298 AREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFVE 357

Query: 353 VNVEFPP-----DNWI 363
             V  P      + WI
Sbjct: 358 YAVVMPAQFKQTNQWI 373

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 45/56 (80%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILG+++D++D +++ AYR+L+ K+HPDK  +P ++++++ +F E+  AYE+LS+
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDK--NPGDESAHQ-RFIEVGEAYEVLSD 73

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 154/357 (43%), Gaps = 33/357 (9%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y ILG+ +D++D EI+ AYR+L+ K+HPDK    EE      KF E+  AY+IL +    
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEA---HHKFIEVGEAYDILGDPEKR 78

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPM----GGHPQREDESTNEATQIEIEVTL 122
                                           M    GG  ++   S N   Q+  +V+L
Sbjct: 79  KTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQRSQN--YQVRNQVSL 136

Query: 123 KDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSP 182
           K+ Y+G  V+F++  N IC  C G+     K        V  C  C+G G V +++   P
Sbjct: 137 KEFYSGGEVEFEIPLNDICDSCHGSGSADGK--------VKVCPACQGRGVVVQVIRMGP 188

Query: 183 FFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTII 242
                  I+ +     G+   K  + +N CK C G  ++++ +      P G   ++  I
Sbjct: 189 -------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNH--I 239

Query: 243 FKEKGDEDLR-TRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQ 301
            K+ G+ D      +GDI+      ++ N G       + G +L+    I   EAI+G  
Sbjct: 240 DKKSGESDKSPDMESGDIIIEYNESEKENLG-----YRRRGNNLYRTEIITANEAINGGW 294

Query: 302 GRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
            R +    + + +KL+ P+G ++  GD   IKG G P       FGD+++   V  P
Sbjct: 295 TREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMP-IMGSKNFGDLYIDYVVLVP 350

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 118/253 (46%), Gaps = 36/253 (14%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TLK+LY GK  K  L R  IC +CDG+   R+           +C  CKG G   + 
Sbjct: 190 LKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRK----------YTCKPCKGQGIQTQT 239

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +      +K+ C+ C G G IK+++ L VT+  GS +
Sbjct: 240 KRMGPLVQSWSQ-TCADCGGAGTFV----KNKDICEQCQGLGFIKQRKILQVTVQPGSCH 294

Query: 238 SNTIIFKEKGDEDLRTRRA-------GDIV---FRLKLHDEPNGGDPDILVTKEGTDLHM 287
           +  I+   +GDE + T+         GD+V    RLK        DP   +T     +  
Sbjct: 295 NQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLK--------DPKFQITDNCDLICK 346

Query: 288 NIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE-- 345
             E+ L+ ++ G    ++      +++K+ +  G+VL+PG    ++  G PK  NG    
Sbjct: 347 KCEVDLMTSLCGGI-VYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSG 405

Query: 346 FGDMFVHVNVEFP 358
           FG ++V  +V +P
Sbjct: 406 FGHLYVKFDVTYP 418

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD L V   ++  EI+KAYR  ALK+HPDK    EE   ++ KF+EI  AYE+L
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEE---SKRKFQEICQAYEVL 58

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 118/253 (46%), Gaps = 36/253 (14%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TLK+LY GK  K  L R  IC++CDG+   ++           +C  CKG G   + 
Sbjct: 183 LKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK----------CTCKTCKGQGIQTQT 232

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +      +K+ C+ C G G IKE++ L VT+  GS +
Sbjct: 233 RRMGPLVQSWSQ-TCADCGGAGVFV----KNKDICQQCQGLGFIKERKILQVTVQPGSCH 287

Query: 238 SNTIIFKEKGDEDLRTRRA-------GDIV---FRLKLHDEPNGGDPDILVTKEGTDLHM 287
           +  I+   +GDE + T+         GD+V    RLK        DP+  V      +  
Sbjct: 288 NQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLK--------DPNFQVINYSNLICK 339

Query: 288 NIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE-- 345
             +I  + ++ G    ++      +++KL +  G++L+PG    ++  G PK  NG    
Sbjct: 340 KCKIDFMTSLCGGV-VYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSG 398

Query: 346 FGDMFVHVNVEFP 358
           FG ++V  +V +P
Sbjct: 399 FGHLYVKFDVTYP 411

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD L V   ++  EI+KAYR  ALK+HPDK    EE   ++ KF+EI  AYEIL
Sbjct: 8  YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEE---SKRKFQEICQAYEIL 58

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 110/242 (45%), Gaps = 23/242 (9%)

Query: 119 EVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLV 178
           E+TLK+ Y G ++ F L  N  C  C+G+  +  K        V  C  CKG G V ++V
Sbjct: 140 ELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGK--------VTKCPDCKGHGVVVQIV 191

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
              P  Q +Q++ C KC G+G      ++ KNKCK CHGE ++++ +   V +P G+   
Sbjct: 192 RMGPVTQQIQQM-CGKCQGRG------STIKNKCKHCHGEKVVRKPKSFHVDVPPGAPR- 243

Query: 239 NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAIS 298
           N +  K+   +      AGD+  +       N G       + G DL     + L EA+ 
Sbjct: 244 NFVEVKQGESDKGPDFDAGDLFIKFSETSRDNLG-----YRRRGDDLFRTEALSLREALK 298

Query: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           G   R +      R +K+      V   G+   I G G PK  N  +FGD+++   V  P
Sbjct: 299 GGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEHN--KFGDLYIDYVVIVP 356

Query: 359 PD 360
            D
Sbjct: 357 DD 358

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILGV + + D +I+ AYR+L+ K+HPDK  +P++ +++  KF E+  AYE+LS+
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDK--NPDDDSAHN-KFIEVGEAYEVLSD 74

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 88/363 (24%), Positives = 148/363 (40%), Gaps = 41/363 (11%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y ILGVD+ +++ EI+ AYR+L+ K+HPDK    +E   +   F E+  AY++LS+    
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHH---FIEVGEAYDVLSDPEKR 78

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXE----------GRNAHPMG-GHPQREDESTNEATQ 115
                                               G N +    G P+ ++       Q
Sbjct: 79  QIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQN------LQ 132

Query: 116 IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVE 175
           +  +++LK  Y G   +F L  N IC  CDG+     K          +C  C G+G + 
Sbjct: 133 VNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTE--------TCPDCGGSGQIM 184

Query: 176 RLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGS 235
           ++    P  Q V R  C +C G+G+        K+ CK C G  ++++ +     +  G 
Sbjct: 185 KVFRAGPIEQRV-RQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPGM 237

Query: 236 ENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIE 295
           E  N I   +   E       GD+    +  ++ + G       + G  L+    +   E
Sbjct: 238 ER-NHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMG-----YRRRGNTLYRTEILSFKE 291

Query: 296 AISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNV 355
           A+ G   R +     ++ L L+ P G  ++ G+T VIK  G P      +FGD+ +   +
Sbjct: 292 ALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVI 351

Query: 356 EFP 358
             P
Sbjct: 352 LLP 354

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 156/364 (42%), Gaps = 39/364 (10%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTA---------- 56
           Y IL +D+ +++ EI+ AYR+L+ KFHPDK    EE      KF E+  A          
Sbjct: 25  YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSEEA---HQKFIEVGEAYDVLSDPEKK 81

Query: 57  --YEILSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEAT 114
             Y+                                 +G +    GG  QR+ +      
Sbjct: 82  KIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQR-GPMI 140

Query: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYV 174
           +++ +++LK  Y+G +++F L+ N  C +C G+     K        +  C  C+G G +
Sbjct: 141 KVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGK--------LAQCPDCQGRGVI 192

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            +++      Q +Q++ C +C G G+        KN+CK CHG  + K  +   V +P G
Sbjct: 193 IQVLRMGIMTQQIQQM-CGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVPPG 245

Query: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294
           +   N +  +    E      AGD+V   K  D  N G       + G +L+    + + 
Sbjct: 246 APR-NYMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMG-----YRRRGDNLYRTEVLSIE 299

Query: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354
           EA+ G   R +    +++ +KL+ P    +  G+  V+KG G PK   G  +GD+++   
Sbjct: 300 EALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMPK--GGKGYGDLYIDYV 357

Query: 355 VEFP 358
           V  P
Sbjct: 358 VIMP 361

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 150/358 (41%), Gaps = 30/358 (8%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           Y ILGVDR++T+ +I+ AYR+L+ K+HPDK  +P +  ++   F E+  AYE LS+    
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDK--NPGDTTAHH-NFIEVGEAYEALSDPEKR 79

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXX------EGRNAHPMGGHPQREDESTNEATQIEIEV 120
                                          E            +     +++ Q++ E+
Sbjct: 80  RIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQEEL 139

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           TL+  Y+G  V+F L+ N  C  C     +  K        V  CT+C   G + ++   
Sbjct: 140 TLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGK--------VERCTQCSVRGVIVQVGRQ 191

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
               Q  Q++ C +  G       P +   KCK+C G   IK+ +   V +P G+   + 
Sbjct: 192 GFMTQQFQQV-CPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAPR-DF 244

Query: 241 IIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGT 300
           +  ++   E +     GDI  ++  +   N G       ++G +L     + L EA+ G 
Sbjct: 245 VAVQQGEAEKVPDMDPGDIYVKVFENTRDNMG-----YRRQGANLFRTEVLSLKEALHGD 299

Query: 301 QGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
             R L      + +  +  +G+ ++ G+   + G G P  P+   FGD++V   V  P
Sbjct: 300 WKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMP-LPDSAGFGDLYVDYVVILP 356

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/393 (22%), Positives = 158/393 (40%), Gaps = 75/393 (19%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEI------------- 53
           YDILGV   ++  +I+KAYR  ALK HPDK    EE   +++KF++I             
Sbjct: 10  YDILGVSASASRQDIKKAYRVNALKHHPDKNGHSEE---SKLKFQQICKAYEILKDERKR 66

Query: 54  -----------------TTAYEILSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNA 96
                            +T+Y+  S                              + + A
Sbjct: 67  EMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQGA 126

Query: 97  HPMGGHPQREDESTNEATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGD 156
           H     P R +       +  ++ TL+++Y+GK  K  L R  +C  C G        G 
Sbjct: 127 HTA---PSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGE-------GG 176

Query: 157 LYSPPVLSCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCH 216
           L +     C  C G G         P  Q     +C  C G+G +  +    K+ C+ C+
Sbjct: 177 LKAS---QCYTCGGRGIRTETKRHGPMVQ-TWSSTCSDCAGRGSFMKQ----KDICRDCN 228

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPN 270
           G+G I+E++   + + +G EN   ++   + DE + +         GD++  + L   P+
Sbjct: 229 GQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVI--IILEQLPH 286

Query: 271 GG-----DPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLR 325
                  D  +++     DL  ++    +   S   G         ++LK+ +  G++L+
Sbjct: 287 KAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSG---------KLLKIDVLPGEILK 337

Query: 326 PGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
           PG    ++G G PK+  G  FG++++  +V FP
Sbjct: 338 PGAIKCVEGMGMPKS--GGRFGNLYIRFDVAFP 368

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 120/262 (45%), Gaps = 40/262 (15%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TLK+LY GK  K  L R  IC +CDG+   ++           +C  CKG G   + 
Sbjct: 187 LKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK----------YACKTCKGQGVQTQT 236

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +       K+ C+ C G G +K+++ L V +  GS +
Sbjct: 237 NRMGPLVQSWSQ-TCADCGGAGIF----VESKDICQQCQGLGFVKQRKILQVAVQPGSCH 291

Query: 238 SNTIIFKEKGDEDLRTRRA-------GDIV---FRLKLHDEPNGGDPDILVTKEGTDLHM 287
           +  I+   +GDE + ++         GD+V    RLK        DP   +  +   ++ 
Sbjct: 292 NQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLK--------DPRFQIVDDYNLIYK 343

Query: 288 NIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE-- 345
             ++ L+ ++ G    ++      +++KL +  G+VL+PG    ++  G PK  NG    
Sbjct: 344 KCKVDLMTSLCGGV-VYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSG 402

Query: 346 FGDMFVHVNVEFP----PDNWI 363
           FG M+V   V +P    P+N I
Sbjct: 403 FGHMYVKFEVTYPRRLEPENAI 424

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD L V   ++  EI+KAYR  ALK+HPDK    EE   ++ KF+EI  AYE L
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEE---SKRKFQEICQAYETL 58

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 112/250 (44%), Gaps = 35/250 (14%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TL+++YNGK  K  L R  +C  C G            S    SC  C+G G   + 
Sbjct: 146 LKCTLEEMYNGKRAKLALKRTRLCQTCQGEG----------SKKATSCYACRGKGMQTQT 195

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q     +C  C G G    KP+   + C  CHG+G ++E++   + + +G EN
Sbjct: 196 KRQGPIMQ-TWSSTCGTCGGSGT-IVKPS---DICNGCHGQGWVRERKIFEIEVQKGMEN 250

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIVF---RLKLHDEPNGGDPDILVTKEGTDLHMN 288
             T++   + DE + ++        GD++    +L       G D  +L+++   DL  +
Sbjct: 251 GQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLPHRSLKRGHDSSLLLSECQVDLKTS 310

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGD 348
           +    +   S   G         +VLK+ +  G++L+PG    ++  G PK+  G  +GD
Sbjct: 311 LCGGTVWVDSHPSG---------KVLKIDVIPGELLKPGAIKCVQSMGMPKSKGG--YGD 359

Query: 349 MFVHVNVEFP 358
           +F+   V FP
Sbjct: 360 LFIKFKVIFP 369

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD LGV  +++  EI+KAYR  ALK HPDK    E+   +++KF++I  AYEIL +
Sbjct: 10 YDTLGVAANASRQEIKKAYRLKALKHHPDKNGHSEQ---SKLKFQQICKAYEILGD 62

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 117/252 (46%), Gaps = 35/252 (13%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TL++LY GK  K  L R  IC +C+G+   ++           +C  CKG G   + 
Sbjct: 194 LKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQK----------YTCKTCKGQGVQTQT 243

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +       K+ C+ C G G IK+++ L VT+  G+ +
Sbjct: 244 KCMGPLVQSWSQ-TCADCGGAGIFV----ESKDICQQCQGLGFIKQRKILQVTVQPGTSH 298

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIV---FRLKLHDEPNGGDPDILVTKEGTDLHMN 288
           +  I+   +GDE +           GD+V    RLK        DP   VT   + ++  
Sbjct: 299 NQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLK--------DPKFQVTDNCSLIYKK 350

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE--F 346
            ++ L+ ++ G    ++      +++KL +  G+VL+P     I+G G PK  NG    F
Sbjct: 351 CKVDLMTSLCGGI-VYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGF 409

Query: 347 GDMFVHVNVEFP 358
           G ++V  +V +P
Sbjct: 410 GHLYVKFDVSYP 421

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD L V   ++  EI+KAYR  AL++HPDK    EE   ++ KF+EI  AYE+L
Sbjct: 8  YDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEE---SKRKFQEICQAYEVL 58

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/374 (23%), Positives = 155/374 (41%), Gaps = 41/374 (10%)

Query: 2   AKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS 61
           A  + Y ILGV +D+++ +I+ AYR+++ K+HPDK    +E      KF EI  AYE+LS
Sbjct: 16  AAQDYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEA---HHKFIEIGEAYEVLS 72

Query: 62  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRNA-------HPMGG--HPQREDESTNE 112
           +                              G          + M G  HP  ++     
Sbjct: 73  DSEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGS 132

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
              ++  VTL   Y+G      L  N  C  C G+     +          +C  C+G G
Sbjct: 133 NLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQ--------FATCETCQGRG 184

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
            + +++      Q +Q++ C  C GKG+      + K+ CK+C G  ++K  +   +++P
Sbjct: 185 VIIQVIQMGFMTQQIQQV-CGACQGKGK------TIKHVCKICRGARVVKTPKTFEISVP 237

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
            G++ +  ++ K    E +   ++GD+VF  + +   N G       + G  L+    + 
Sbjct: 238 AGAQRNYNVV-KSGQAEKVPDMQSGDLVFVFEENSHENLG-----YRRRGDHLYRTEVLH 291

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKT----PNGTEFGD 348
             EA+ G   R +    D + + +   +  V  PG+   +   G PK      +   +GD
Sbjct: 292 WKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGD 351

Query: 349 MFVHVNV----EFP 358
           +F+   +    EFP
Sbjct: 352 LFIEYVIVSPKEFP 365

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 123/273 (45%), Gaps = 39/273 (14%)

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVER 176
           +++ TL  LY GKN K  L R  +C  C G            S  V +C  C+G G   R
Sbjct: 141 DLKCTLSSLYEGKNTKLGLNRRRVCKACKGR----------GSMKVRTCKACRGRGQQSR 190

Query: 177 LVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSE 236
                P  Q   + +C  C G G +T     D + C+ C GEG I+E++   V +  G  
Sbjct: 191 SRQMGPMMQTWTQ-TCSDCNGMGTFT----KDSDVCRDCEGEGCIRERKIFDVEVKPGMC 245

Query: 237 NSNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPNGGDPDILVTKEGTDLHM-NI 289
               II   + DE ++TR        GD++  +    +P        V + G DL + N 
Sbjct: 246 QGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQ----RVNRNGCDLMVRNC 301

Query: 290 EIPLIEAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGWP-----KTPNG 343
           +IPL+ ++ G  G+       + +++ +T+  G++++P     I+  G P     + P G
Sbjct: 302 KIPLVTSLCG--GKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKRAPEG 359

Query: 344 TEFGDMFVHVNVEFPPDNWISERNDITTLTNVL 376
             +G++++   VEF P+   SE   +T L  VL
Sbjct: 360 --YGNLYIQFQVEF-PETLASE--TVTKLKQVL 387

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD+L V  +++  EIRKAYR LALK HPDK    EE  S   KF E+  AYEIL
Sbjct: 8  YDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEESKS---KFLEVNEAYEIL 58

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 101/405 (24%), Positives = 157/405 (38%), Gaps = 67/405 (16%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YDIL V+  +T+ EI+KAYRK ALK HPDK       A +   F++I+ AYE LSN    
Sbjct: 8   YDILEVNTTATEQEIKKAYRKKALKHHPDK---NNHSAESIKLFQDISHAYETLSNSNKR 64

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGR--NAHPMGGH------PQREDESTNEATQIEI 118
                                     G   N+HP   H       Q      +  T    
Sbjct: 65  ELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGASG 124

Query: 119 EVTLKDLYNGKNVKFQ------------------------LTRNVICTLCDGNCWRRRKN 154
              ++ + NG    F                         +  N+ C L D    +R K 
Sbjct: 125 FGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAK- 183

Query: 155 GDLYSPPVLSCTKCKGAGYVE----RLVGDSPFFQYVQRI---------SCRKCFGKGEY 201
             L       C +C+G G  +    R    +  F   +R+         +C++C G G+Y
Sbjct: 184 --LALNRTRLCQRCQGYGGKKATQCRGCQGTGLFTTTKRMGPMVQTWQTTCKECSGTGKY 241

Query: 202 TAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRA----- 256
                  K+ C  C G G IKE++   V +  G  N N II   + DE + T        
Sbjct: 242 ----IRSKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKERVI 297

Query: 257 -GDIVFRLKL-HDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTF-DDRV 313
            GD++  ++L  +E +      LV      L  N E+ L  ++ G  G  + +       
Sbjct: 298 PGDVIITIQLTRNEESNMRYKYLVHDHDLILD-NFEVDLKTSLCG--GTIIIEDHPSGNP 354

Query: 314 LKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
            K+ +  G++L+PG    ++ +G P   NG  FG++++   V+FP
Sbjct: 355 FKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYIRFRVKFP 398

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 106/242 (43%), Gaps = 27/242 (11%)

Query: 119 EVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLV 178
           E+TLK+ Y G ++ F L  N  C  C G   +  K           C+ C+G G V +++
Sbjct: 147 EITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGK--------TTRCSDCQGQGVVIQII 198

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
              P  Q +Q++ C  C GKG+        KNKCK CHG  + ++ +   V +P G+   
Sbjct: 199 RMGPITQQIQQM-CGACQGKGQII------KNKCKQCHGAKVERKTKHFHVDVPAGAPRD 251

Query: 239 NTIIFKEKGDE--DLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEA 296
              +   + D+  D     AGD+  +       N G       + G  LH    + L EA
Sbjct: 252 FVDVKNGEADKGPDF---DAGDVYIKFSESSRDNMG-----YRRRGVHLHRTEVLTLKEA 303

Query: 297 ISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVE 356
           + G   R +      + +KL    G  +R G+T  + G G PK  +G  FGD+FV   V 
Sbjct: 304 LQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPK--DGRHFGDLFVDYVVL 361

Query: 357 FP 358
            P
Sbjct: 362 TP 363

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILGV +D+++ EI+ AYR+L+ K+HPDK  +P ++ ++  KF E+  AYE+LS+
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDK--NPGDETAHH-KFIEVGEAYEVLSD 78

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 116/266 (43%), Gaps = 38/266 (14%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           +  +L++LY+GK  K +L R  +C  C GN       G   S    +C  C G G+  + 
Sbjct: 144 LRCSLEELYHGKKSKLRLDRTRLCKTCKGN-------GGTSSS---ACRACNGQGFYTQT 193

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q     +C+ C G G +  +    K+ C  C G+G IKE++   + +  G  +
Sbjct: 194 RRHGPMVQ-TWSTTCQDCGGSGTFVRR----KDVCSECKGQGCIKERKIFEIEVQPGMHH 248

Query: 238 SNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTK---------EGTDLHMN 288
              I+  E+ DE         IV+     ++ N GD  I+V +           TDL MN
Sbjct: 249 GQEIVLPEEADE---------IVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHNDTDLVMN 299

Query: 289 -IEIPLIEAISGTQGRFLTKTFD-DRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEF 346
              + L  ++ G  G  L +       LK+ +  G++L+PG    ++  G P  P    F
Sbjct: 300 DCHVDLKTSLCG--GEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMPH-PQSQGF 356

Query: 347 GDMFVHVNVEFPPDNWISERNDITTL 372
           G++++   V+FP    +   N ++ L
Sbjct: 357 GNLYIRFQVDFPDKLQLETINKVSEL 382

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD L +  D+T  EI+KAYR  ALK HPDK    E+   ++ KF+EI  AYEIL +
Sbjct: 10 YDTLNISVDATPQEIKKAYRLAALKSHPDKNNHSED---SKRKFQEICKAYEILGD 62

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 118/276 (42%), Gaps = 46/276 (16%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++  L DLY GK  K  L R  +C+ CDG    R          V SC  CKG G V + 
Sbjct: 155 LKCNLSDLYQGKKTKLGLNRMRVCSSCDGKGGMR----------VASCRTCKGQGEVVKT 204

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q +   +C  C G G +      D + C +C G G+ KE++   V +  G  +
Sbjct: 205 RRVGPMVQTMSS-TCNSCHGTGTF----IKDSDLCFVCKGSGVSKERKIFDVEVKAGMTH 259

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
           +  I+   + DE + T         GD+V  + L       +    V  +   +  N E+
Sbjct: 260 NQVIVLPGEADEVIETSHGLIKVQPGDVVIVIDLVK-----NTQFQVVNDHDLVLKNCEV 314

Query: 292 PLIEAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE----- 345
           PL   + G  G  + +     +++KL++   ++L+P     ++G G PK    ++     
Sbjct: 315 PLKTCLCG--GEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIA 372

Query: 346 ------FGDMFVHVNVEFPPDNWISERNDITTLTNV 375
                 +G+++V   V+FP      ER + TT+T +
Sbjct: 373 GTDIDGYGNLYVQFQVKFP------ERLEDTTITKL 402

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V+ D++   I+KA+   AL+ HPDK    EE   ++ +F+EI+ AYE+LS+
Sbjct: 8  YDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEE---SKKQFQEISKAYEVLSD 60

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 134/308 (43%), Gaps = 59/308 (19%)

Query: 99  MGGHPQ---------REDESTNEATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCW 149
           +GGH +         R+ +S     +  ++  LK+LY+GK  K  LTR  +C  C G+  
Sbjct: 131 LGGHCRFNSAAKDKARDGKSRGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGH-- 188

Query: 150 RRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDK 209
                G + S     C +C+G G   +     P  Q     SCR C G G +        
Sbjct: 189 -----GSMTSS---VCGECRGQGVYSQTRRHGPLVQ-TWSSSCRNCSGAGTFV----KSN 235

Query: 210 NKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRA------GDIVFRL 263
           + C+ C G G I+E++   V I  G  N + II   + D+ + T         GD++  +
Sbjct: 236 DVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVI--I 293

Query: 264 KLHDEPNGG------DPDILVTKEGTDLHMNI---EIPLIEAISGTQGRFLTKTFDDRVL 314
            + ++ + G      + D+++T+   DL  ++    I + +  SG            R +
Sbjct: 294 IVQEQCSTGRYRRFRESDLVLTRCVVDLRTSLCGGSIYIDDHPSG------------RPI 341

Query: 315 KLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTN 374
           KL +  G++L PG    ++  G PK  N +++GD+++   V FP      ER +  T+  
Sbjct: 342 KLEVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNFP------ERLEPETMNV 395

Query: 375 VLPAGKSD 382
           +  A  SD
Sbjct: 396 ISSALASD 403

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V    +  E++K+Y+  AL++HPDK    E   S +  F++IT AY ILS+
Sbjct: 8  YDLLNVSPTVSPQELKKSYKLAALRYHPDKNGHSE---SAKQAFQQITEAYGILSD 60

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 111/252 (44%), Gaps = 34/252 (13%)

Query: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVER 176
           ++  TL++LY GK V+  LTR  +CTLC G    R            +CT C G G   +
Sbjct: 136 KLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAS----------TCTACSGQGICSQ 185

Query: 177 LVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSE 236
                   Q     +CR C G G        D + C  C G G ++E++   V I  G  
Sbjct: 186 TKRQGSLVQ-TWSSTCRVCSGSGTI----VKDCDTCTSCGGAGYLRERKVFEVEIRPGMR 240

Query: 237 NSNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPN----GGDPDILVTKEGTDLH 286
             + ++F  + DE + T         GD+   ++           GD ++L+    T+LH
Sbjct: 241 AGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRGDANLLL----TELH 296

Query: 287 MNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEF 346
           +++   L     GT   ++      ++++L +  G++L PG    I+  G P   + +++
Sbjct: 297 VDLRTSL---CGGTV--YIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDPSQY 351

Query: 347 GDMFVHVNVEFP 358
           G +F+  +V+FP
Sbjct: 352 GHLFIKFHVDFP 363

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV    +  E++K+Y+  AL++HPDK    E   +++ +F++I  AY +L +
Sbjct: 8  YDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHSE---ASKQRFQQIADAYRVLGD 60

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 117/244 (47%), Gaps = 23/244 (9%)

Query: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYV 174
           +++ +++LK  Y+G +++F L+ N  C +C G+     K        +  C  C+G G +
Sbjct: 144 KVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGK--------LAQCPDCQGRGVI 195

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            +++      Q +Q++ C +C G G+        KN+CK CHG+ +IK+ +   V +P G
Sbjct: 196 IQVLRMGIMTQQIQQM-CGRCGGTGQII------KNQCKTCHGKKVIKKNKFFHVDVPPG 248

Query: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294
           +   N +  +    E      AGD+V   K  D  N G       + G +L+    +   
Sbjct: 249 APR-NYLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMG-----YRRRGDNLYRTEVLSAE 302

Query: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354
           EA+ G   R +    +++ +KL+ P   V+  G+  V+KG G PK+  G   GD+++   
Sbjct: 303 EALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKG--HGDLYIDYV 360

Query: 355 VEFP 358
           V  P
Sbjct: 361 VIMP 364

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y IL VD+D+++ EI+ AYR+L+ K+HPDK    EE      KF E+  AY++LS+
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEA---HHKFIEVGEAYDVLSD 77

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 117/246 (47%), Gaps = 27/246 (10%)

Query: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYV 174
           +++ +++LK  Y+G +++F L  N  C  C G+     K        +  C  C+G G +
Sbjct: 143 KVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGK--------LAQCPDCQGRGVI 194

Query: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234
            +++      Q +Q++ C +C G G+        KN+CK CHG+ + K+ +   V +P G
Sbjct: 195 IQVLRMGIMTQQIQQM-CGRCGGTGQII------KNECKTCHGKKVTKKNKFFHVDVPPG 247

Query: 235 SENS--NTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
           +  +  +T + + +   D     AGD+V   K  D  N G       + G +L+    + 
Sbjct: 248 APRNYMDTRVGEAEKGPDFD---AGDLVIEFKEKDTENMG-----YRRRGDNLYRTEVLS 299

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
             EA+ G   R +    +++ +KL+ P   V+  G+  V+KG G PK   G  +GD+++ 
Sbjct: 300 AAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYID 357

Query: 353 VNVEFP 358
             V  P
Sbjct: 358 YVVVMP 363

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y IL +D+D+T+ EI+ AYR+L+ K+HPDK    EE      KF E+  AY++LS+
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEA---HQKFIEVGEAYDVLSD 77

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 111/245 (45%), Gaps = 27/245 (11%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ T+KDLY GK  K +L R+ +C++C G+   +R            C +C G G +   
Sbjct: 164 LKCTIKDLYRGKRSKLRLERSKLCSICKGDGGVKRS----------MCNQCHGDGNITET 213

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q     +C  C G G       +    C+ C+G G   E +   V I  G ++
Sbjct: 214 TRLGPMLQTFTH-TCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPGMKD 268

Query: 238 SNTIIFKEKGDEDLRTRRA--GDIVFRLKLHDEPNGGDPDILVTKEGTDLHM-NIEIPLI 294
              I+F  +GDE +  RR   G+++  +   +     D       +G DL+  N EI L 
Sbjct: 269 GTQIVFNNEGDEIVNKRRVIPGNVIIHINEIE-----DNKFKRVNDGQDLYYWNYEIDLF 323

Query: 295 EAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHV 353
            ++ G  G    K   +++++K+ +  G+++  G    ++  G PK   G E+G +++  
Sbjct: 324 TSLCG--GVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMPKN-KGNEYGILYIQF 380

Query: 354 NVEFP 358
            V++P
Sbjct: 381 QVKYP 385

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 116/253 (45%), Gaps = 32/253 (12%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TL++LYNGK  K  L R  +C  C+G    +R           +C  C+G G+  + 
Sbjct: 158 LKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQRT----------TCESCQGDGFQTQT 207

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +  KP    + C  CHGEG I+E++   V +  G ++
Sbjct: 208 RRMGPMVQTWTQ-TCASCDGAGCFI-KPN---DVCPHCHGEGFIRERKIFHVEVKPGFQD 262

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPNGGDPDILVTKEGTDLHMN-IE 290
              +I + + DE +           GD+V  +K   + N    +        DL MN   
Sbjct: 263 GKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDEN----NCFQMINNKDLLMNGCP 318

Query: 291 IPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE----- 345
           + L+ ++ G +  ++      +++KL +  G++L+P    +I+G G P   +G +     
Sbjct: 319 VDLVTSLCGGE-VYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLR 377

Query: 346 FGDMFVHVNVEFP 358
            GD+++   +++P
Sbjct: 378 RGDLYIQFKIQYP 390

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 110/239 (46%), Gaps = 23/239 (9%)

Query: 120 VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVG 179
           ++LK  Y+G +++F L+ N  C  C G+     K        +  C  C+G G + ++V 
Sbjct: 146 LSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGK--------LAQCPDCQGRGIIVQVVR 197

Query: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239
                Q +Q+I C +C G G+        KN+CK CHG+ + K+ +   V +P G+   N
Sbjct: 198 MGIMTQQIQQI-CGRCAGTGQVI------KNQCKTCHGKKVTKKNKFFHVDVPPGAPR-N 249

Query: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299
            +  +    E      AGD+V   +  D  N G       + G +L+    +   EA+ G
Sbjct: 250 YMDTRAGEAEKGPDFDAGDLVIEFREMDTENMG-----YRRRGHNLYRTEVLSAAEALYG 304

Query: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              R +    +++ +KL+ P   V+  G+  V+KG G PK     + GD+++   V  P
Sbjct: 305 GWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPK--GSRDHGDLYIDYVVVMP 361

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y IL + +D+++ EI+ AYR+L+ K+HPDK    +E      KF EI  AYE+LS+
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEA---HHKFIEIGEAYEVLSD 77

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 143/366 (39%), Gaps = 43/366 (11%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNXXXX 66
           YD+LGV  D++  EI+KAYRKLAL++HPDK  + +EK      F++I+ AY +L +    
Sbjct: 5   YDVLGVASDASQSEIKKAYRKLALRYHPDKN-NGDEKCHE--AFQKISHAYGVLGDVAQR 61

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXEGRNAHPMGGHPQREDESTNEATQI------EIEV 120
                                       N   +           +           E++ 
Sbjct: 62  QRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNIIHELKC 121

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           TL+DLY GK +K  L R   C  C            L +  V  C+ C G+G + R+   
Sbjct: 122 TLQDLYRGKVIKLALRRTAPCERC-----------SLGAANV--CSSCNGSGNITRIERV 168

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
            P  Q     +C  C G+G  +         C  C G   + E+    V +  G  +  T
Sbjct: 169 GPLTQ-TWSSTCNACQGQGRMSV-------DCSQCGGAQYLNERVVFKVHVKPGMHDGQT 220

Query: 241 IIFKEKGDEDLRTR-------RAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPL 293
           I+   + D+ +R R        +GD+V  ++  +  +       + K        +++ L
Sbjct: 221 IVLDGEADQCVRDRLGHLTVAESGDVVIVIR--ELADAKFKRSALNKRENLFVDQVKVDL 278

Query: 294 IEAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
             A++G  G  L +      ++K+ +  G+ L       ++G G P    G + GD+++ 
Sbjct: 279 TTALTG--GNVLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPIDDTG-QRGDLYIR 335

Query: 353 VNVEFP 358
                P
Sbjct: 336 FCTHSP 341

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 23/239 (9%)

Query: 121 TLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGD 180
           +LK+ YNG  +KF +  N IC  C G+     K+          C  C+G G   +++  
Sbjct: 146 SLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKS--------TKCPDCQGRGVTVQVIRM 197

Query: 181 SPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNT 240
               Q +Q++ C KC GKG+        KN CK CHG  ++++ +   + +P G+     
Sbjct: 198 GMMTQQIQQV-CGKCGGKGQII------KNPCKTCHGSKVVQKPKDFEIELPAGA--PRK 248

Query: 241 IIFKEKGDEDLR-TRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISG 299
            +  E G  D      +GD+      +D+ N G       + G  L+    +   EA+ G
Sbjct: 249 FVHAEHGAADKHPDYDSGDVYIEFTENDKDNMG-----YRRRGPHLYRTEVLNATEALYG 303

Query: 300 TQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              R L      +++ +     K+++ G+T  I G G P       FGD+F+   V  P
Sbjct: 304 GWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMP 362

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y IL +D+D+TD +IR AYR+L+ K+HPDK  +P ++ ++  KF E+  AYEILS+
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDK--NPNDEDAHH-KFIEVGQAYEILSD 76

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 110/243 (45%), Gaps = 26/243 (10%)

Query: 119 EVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLV 178
           E++LKD Y G  + F L  N +C  C G       +G L       C  C+G G + +L+
Sbjct: 142 EISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGKL-----TPCPDCQGRGVIIQLI 193

Query: 179 GDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENS 238
                 Q +Q++ C +C GKG+        K +C+ CHG  ++ +K++  V +P+G++  
Sbjct: 194 RMGMMTQQIQQM-CGRCGGKGQLF------KKQCRKCHGNKVMPQKKEFQVKLPKGAKRH 246

Query: 239 NTIIFKEKGDE--DLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEA 296
              +   + D+  DL    AGD++     +D+ N G       + G +L+    + + EA
Sbjct: 247 YMDVKHGEADKNPDL---EAGDLLIEFNENDKSNMG-----YRRRGQNLYRTEVLNVTEA 298

Query: 297 ISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTE-FGDMFVHVNV 355
           + G   R +      + L++      V+  G+   I G G P      E FGD+F+   V
Sbjct: 299 LYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDYVV 358

Query: 356 EFP 358
             P
Sbjct: 359 IMP 361

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILG+ +D+TD EI+ AYR+L+ KFHPDK  +P  + +++ KF E+  AYE+LS+
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDK--NPGNEDAHQ-KFIEVGEAYEVLSD 75

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 119/290 (41%), Gaps = 46/290 (15%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           +  +LKDLY GK  K +L R  +C LC G    ++            C  C G G + + 
Sbjct: 171 LRCSLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKS----------KCFTCNGLGSLTQT 220

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + SC  C G G +  +  +    C+ C G G ++E++   V I  G  N
Sbjct: 221 RRMGPMIQTFSQ-SCPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFDVEIQPGMVN 275

Query: 238 SNTIIFKEKGDEDLRTRR------AGDIVF---RLKLHDEPNGGDPDILVTKEGTDLHMN 288
              II   + DE + T        AGDIV    +LK ++     D D+L+         N
Sbjct: 276 GQVIILPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLD--------N 327

Query: 289 IEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPN------ 342
             + L +A+ G    F++      ++K+ +  G++L PG    +   G PK         
Sbjct: 328 FSVNLSKALCGGT-IFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVS 386

Query: 343 --GTEFGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGD 390
                 G+++V  +++FP      E + I  L  VL   +    HA+  D
Sbjct: 387 IINISKGNLYVKFDIKFPTR---LEEDTIAKLKAVLSEDRY--AHAEMAD 431

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YDIL +  ++   +I+KAYR LALK+HPDK    EE   +++ F++I+ AYE+L
Sbjct: 8  YDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEE---SKVMFQKISEAYEVL 58

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 110/254 (43%), Gaps = 39/254 (15%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TL +LY+GK  K  L R  +C  C G    RR+          +C  C+G G     
Sbjct: 169 LKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRR----------TCKTCRGQGQQTET 218

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G YT +     + C  C GE  IKE++   V + +G  +
Sbjct: 219 RRTGPMVQTWTQ-TCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFDVEVSKGMCH 273

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIVFRL------KLHDEPNGGDPDILVTKEGTDL 285
             TI+   + DE ++T         GD+V  +      K H           V + G DL
Sbjct: 274 GQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFH----------RVNRYGCDL 323

Query: 286 HM-NIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGT 344
            M +  I L  ++ G    ++      ++LK+++  G+++ P     I+G G PK  +  
Sbjct: 324 VMGSCSIDLSTSLCGGD-IYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDG 382

Query: 345 EFGDMFVHVNVEFP 358
             G++++   +E+P
Sbjct: 383 GKGNLYIQFQLEYP 396

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD L V  D+T  EI++AY+ +ALK+HPDK    E+ A N  KF+E+  AYEIL++
Sbjct: 8  YDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSED-AKN--KFQEVCKAYEILAD 60

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 109/247 (44%), Gaps = 22/247 (8%)

Query: 112 EATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGA 171
           ++ Q+   ++L++ + G NV FQ+     C  C G+     K        V  C +C G 
Sbjct: 155 QSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGK--------VDKCKECGGN 206

Query: 172 GYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
           G+V +++   P  Q +    C KC G G      ++ KN CK CHG+ L+ + +++ V +
Sbjct: 207 GFVVQVIRMGPVTQQMH-TQCPKCHGAG------STIKNHCKKCHGQKLVTKSKEINVKV 259

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
           P G+      I +  GD++L    AGD++ + +   + N G       + G DL     +
Sbjct: 260 PAGAPRDFLKIVENGGDKELNA-EAGDLLVQFQEIAQNNLG-----YRRRGNDLFRTEAL 313

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFV 351
              +A+ G   R +      R +K++   G  +   +   + G G P       FGD+++
Sbjct: 314 VFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMP-IQGSDRFGDLYI 372

Query: 352 HVNVEFP 358
              +  P
Sbjct: 373 DYVIIVP 379

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 42/62 (67%), Gaps = 3/62 (4%)

Query: 1  MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          +A  + Y ILG+ +++++  I+ AYR+L+ K+HPDK  + EE  ++   F EI  AYE+L
Sbjct: 25 LAGKDYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNH---FIEIGEAYEVL 81

Query: 61 SN 62
          S+
Sbjct: 82 SD 83

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 120/295 (40%), Gaps = 44/295 (14%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           ++ TL +LY+GK  K +L R   C  C G            S  + SC+KC G G + + 
Sbjct: 237 LKCTLSNLYSGKRSKLRLERTRCCLKCKG----------FGSLNIKSCSKCNGRGSLTQT 286

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q   + +C  C G G +       ++ C  C GEG + EK+   V I  G  +
Sbjct: 287 KKFGPMTQTFTQ-TCDGCGGNGTFADA----QDICNECQGEGFLNEKKIFEVEITPGMTD 341

Query: 238 SNTIIFKEKGDEDLRTRRA------GDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
              II   + DE + T         GDI+  + L       DP   V +    L+ N +I
Sbjct: 342 GQLIILTGEADEVISTNLGKERVIPGDIILTINLLP-----DPTFKVVQGADLLYANYKI 396

Query: 292 PLIEAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGWPK----------- 339
            L+ ++ G  G    K    + ++K+ +  G++++ G    ++  G PK           
Sbjct: 397 NLLTSLCG--GSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDI 454

Query: 340 -TPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANN 393
                T  G++ +H  + +P    + E + +  L N+L   K         +A+N
Sbjct: 455 QANKPTLKGNLVIHFEIVYPD---MLETDTVIELQNILNNDKYIQNQITEEEADN 506

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 1  MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          +A    YDIL V  DS +  I+KAYR LALK+HPDK    EE  S +M F++I+ AY +L
Sbjct: 2  VASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEE--SKQM-FQKISEAYVVL 58

Query: 61 SN 62
          SN
Sbjct: 59 SN 60

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 106/247 (42%), Gaps = 21/247 (8%)

Query: 112 EATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGA 171
           ++ ++   +TLKD YNG ++ F L  N  C  C G+     K        V  C  C G 
Sbjct: 150 QSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGK--------VKKCPDCGGR 201

Query: 172 GYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTI 231
           G V +++      Q VQ+  C +C G GE        +NKCK+C G  + K+++ + V+ 
Sbjct: 202 GVVIQVIRMGIVTQQVQQ-RCNRCAGSGEII------QNKCKVCSGAKVQKKEKDISVSF 254

Query: 232 PRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEI 291
             G E  N I  ++   E       GD++       E N G       + G DL     +
Sbjct: 255 DSGIER-NHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMG-----YRRRGKDLFRTEVL 308

Query: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFV 351
            L EAI+G   R +      + L+L      ++  G+   I G G P   +  +FGD+++
Sbjct: 309 TLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDLYI 368

Query: 352 HVNVEFP 358
              V  P
Sbjct: 369 DYVVIKP 375

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDP-EEKASNEMKFKEITTAYEILSN 62
          Y ILG+ ++  + EI+ AYR+L+ KFHPDK  +P +E A N  KF EI  AYE+LS+
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDK--NPNDEDAHN--KFIEIGEAYEVLSD 77

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 110/269 (40%), Gaps = 45/269 (16%)

Query: 118 IEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERL 177
           +  TLK+LY GK  K  L R   C  C+G          +     + C +C+G G     
Sbjct: 177 LNCTLKELYQGKKCKLGLNRTRSCHSCNG----------MGGMNTIICNECQGKGINTET 226

Query: 178 VGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSEN 237
               P  Q     +C  C G G +    +     CK C GEG ++E+    VT+  G  N
Sbjct: 227 KMLGPMVQSWSS-TCFNCSGMGYFIDSQSG----CKECQGEGYLRERTIFTVTVKPGMRN 281

Query: 238 SNTIIFKEKGDEDLRTRRA-------GDIVFRL-KLHDEPNGGDPDILVTKEGTDLHM-- 287
           +  I+ K + D+ +   +        GD++  + ++  +    D +I   +     H   
Sbjct: 282 NQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEI 341

Query: 288 ---------NIEIPLIEAISGTQGRFLTKTF-DDRVLKLTMPQGKVLRPGDTIVIKGEGW 337
                    N +I LI ++ G  G    K     +++KL +   ++L+P     ++  G 
Sbjct: 342 INEKDLLLRNCQIDLITSLCG--GEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGM 399

Query: 338 PK-----TPNGTEF---GDMFVHVNVEFP 358
           P+     T NG E+   GD+++   V++P
Sbjct: 400 PRYIEDETNNGEEYLPNGDLYIQFKVKYP 428

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          Y IL V   +T  EI+ AY+KLALK+HPDK    EE   +++KF+EI  AYE+L
Sbjct: 15 YSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEE---SKLKFQEICKAYEVL 65

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAY 57
           M   +PY+ILGV   ST+ EI+KAYR L+LKFHPDK+   +  +E+ S E  F +I+ AY
Sbjct: 117 MGTFDPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAY 176

Query: 58  EILSN 62
           E L+N
Sbjct: 177 EALTN 181

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAY 57
           +   +PYD+LGV   ++D EI+ AYRKL+LKFHPDKV   I  EEK S E  + +I+ AY
Sbjct: 116 IGSFDPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAY 175

Query: 58  EILSN 62
           E L++
Sbjct: 176 EALTD 180

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 100/246 (40%), Gaps = 21/246 (8%)

Query: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           + ++E +++LK  Y G + +F L  +  C  C G      K           C  CKG+G
Sbjct: 150 SLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTK--------VCPDCKGSG 201

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIP 232
            + +++      Q +Q+  C +C G+G         KN CK+C+G  + ++ +   V +P
Sbjct: 202 IIIQIIRMGMMTQQIQQ-PCGRCRGQGHLI------KNFCKVCNGAKVQQKLKDFKVYVP 254

Query: 233 RGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
            GS   N +  K    E       GD++         N G       + G +L     I 
Sbjct: 255 PGSP-RNHVEVKAGQAEKNPNYEPGDVIIEFNELPLDNLG-----YRRRGNNLFRTEYIS 308

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVH 352
           L EA+ G   R L      + + L       +  G+  ++KG G P      +FGD+++ 
Sbjct: 309 LNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLYID 368

Query: 353 VNVEFP 358
             V  P
Sbjct: 369 YKVIIP 374

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 37/57 (64%), Gaps = 4/57 (7%)

Query: 7  YDILGVDRD-STDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILG++++   + EI+ AYRKL+ K+HPDK  + ++   N   F ++  AY++L +
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQN---FIKVGEAYDVLGD 79

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y IL VD+ +TD EI+KAYRKLA+K HPDK  +P  KAS    FK I  A+E+LSN
Sbjct: 23 YQILKVDKKATDGEIKKAYRKLAIKLHPDK--NPHPKASE--AFKIINRAFEVLSN 74

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL VDR +TD EI+KAYRKLA+K HPDK   P+   +    FK I  A+E+LSN
Sbjct: 23 YEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSN 74

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 45/62 (72%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY++LG+   ++D +I+ AYRKL++KFHPDK+   +  EE+ S E K+ +IT AYE L
Sbjct: 120 FDPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEAL 179

Query: 61  SN 62
           ++
Sbjct: 180 TD 181

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 45/62 (72%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY+ILG+   ++D +I+ AYRKL++KFHPDK+   + P+EK+  E  + +IT AYE L
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESL 183

Query: 61  SN 62
           ++
Sbjct: 184 TD 185

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL VDR +TD +I+KAYRKLA+K HPDK   P+   +    FK I  A+E+LSN
Sbjct: 23 YEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSN 74

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 42/62 (67%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY+ILGV   + D EI+ AYRKL++KFHPDK+   + PE +   E  + +IT AYE L
Sbjct: 121 FDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESL 180

Query: 61  SN 62
           ++
Sbjct: 181 TD 182

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL VD+ +TD EI+KAYRKLA+K HPDK   P    +    FK I  A+E+LSN
Sbjct: 23 YEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEA----FKVINRAFEVLSN 74

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL V+R ST++EI+KAYRKLA++ HPDK  +P  KAS    FK I  A+E+LS+
Sbjct: 23 YEILKVERTSTENEIKKAYRKLAIRLHPDK--NPHPKASE--AFKIINRAFEVLSD 74

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 4/54 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YDIL VD+ + D+EI+K+YRKLA+K HPDK  +P  KAS    FK I  A+E+L
Sbjct: 26 YDILKVDKTAQDNEIKKSYRKLAIKLHPDK--NPHPKASE--AFKRINRAFEVL 75

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 44/62 (70%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY+ILGV   ++D +I+ AYRKL++KFHPDK+   + P+EK   E  + +IT AYE L
Sbjct: 124 FDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESL 183

Query: 61  SN 62
           ++
Sbjct: 184 TD 185

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 44/62 (70%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PYDILG+   +++ EI+ AYRKL++KFHPDK+   +  +E+ + E  + +IT AYE L
Sbjct: 118 FDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEAL 177

Query: 61  SN 62
           ++
Sbjct: 178 TD 179

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 127/300 (42%), Gaps = 45/300 (15%)

Query: 116 IEI--EVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           IEI  +V+ KD ++  KNV+ + +    C+ C G   +   +        +SC+ C G G
Sbjct: 202 IEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHK-------VSCSTCHGTG 254

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQQLLVTI 231
               + G    FQ +   +C  C G+G  T K   D   C  CHGEG+ +   + + V +
Sbjct: 255 TTVHIRGG---FQMMS--TCPTCNGEG--TMKRPQDN--CTKCHGEGVQVNRAKTITVDL 305

Query: 232 PRGSENSNTIIFKEKG-------DEDLRTR---RAGDIVFRLKLHDEPNGGDPDILVTKE 281
           P G ++ + +    +G       + DL+       GDI+ R+++  +PN         K 
Sbjct: 306 PHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPN------FSIKN 359

Query: 282 GTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTP 341
             D+  + EIP+  A  G  G     T + + +++ +  G   +    I I   G PKT 
Sbjct: 360 KYDIWYDKEIPITTAALG--GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKT- 414

Query: 342 NGTEFGDMFVHVNVEFPPDNWISER---NDITTLTNVLPAGKSDDGHAQTGDANNAEFVK 398
             T  GDM V   +       ++E+     +  +TN   A K+       G A N E +K
Sbjct: 415 -STIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTNDDMAKKTMQPGTAAGTAINEEILK 473

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PYD LG+ + +T  EI+KAY KLA K+HPD   +P+     E KF ++  AYEILS+
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSD 114

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + D EI+K YRK ALK+HPDK         N  KFKEI+ A+EILS+
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDK------PTGNTEKFKEISEAFEILSD 57

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G+  ++EK Q+ + +  G +    I FK  GD +  T  R+    V + K+H  PN    
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKEKVH--PN---- 263

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                +E   L   + +   E++ G Q     +T D R L ++  Q   ++P D+    G
Sbjct: 264 ---FKREDDTLVYYLPLTFKESLLGFQKTI--QTIDGRTLPISRVQP--VQPNDSSTYPG 316

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P T    + GDM V   +E+P
Sbjct: 317 QGMPMTKKPGQRGDMIVKYKIEYP 340

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + D EI+K YRK AL++HPDK         N  KFK+I+ AYEILS+
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALQYHPDK------PTGNTEKFKQISEAYEILSD 57

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G G  +EK+Q+ + + RG +    I +K +GD + RT  R+    V + K H        
Sbjct: 195 GPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQEKAHP------- 247

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
             L  ++G +L   + +   E++ G       +T D R L L+  Q   ++P +T    G
Sbjct: 248 --LFKRDGENLLYTVPLSFQESLLGFSK--TVQTIDGRSLSLSRTQ--PIQPTETTTYPG 301

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P   N  + GD+ +   +++P
Sbjct: 302 QGMPNPKNPNQRGDLIITYKIDYP 325

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 112/273 (41%), Gaps = 46/273 (16%)

Query: 98  PMGGHPQREDESTNEATQIEIEVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGD 156
           P GG      E   +  ++   ++ KD ++  +NV   ++    C  C G+     K G 
Sbjct: 184 PFGGF---YSEVRGDNVEVIHTLSFKDAVFGSRNVTLNVSSIEQCKTCTGSGM---KPGS 237

Query: 157 LYSPPVLSCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCH 216
             S     C+ C G G    +      FQ     +C  C G GE  A+    ++ C+ C 
Sbjct: 238 HRS----ECSSCHGTGTTVHVRAG---FQMAS--TCMSCGGTGENIAR----EDVCRNCD 284

Query: 217 GEGLIKEKQQ--LLVTIPRGSENSNTI------------IFKEKGDEDLRTRRAGDIVFR 262
           GEG      Q  + V +P G  + + I            I  E+ D+   TR  GD++ R
Sbjct: 285 GEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTR--GDLLVR 342

Query: 263 LKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGK 322
           +++  +       +   + G +L    EIP+  A+ G  G  +  T D   L+L +  G 
Sbjct: 343 IRVKQD------KVFSIRNGNELWQTREIPVTTAVLG--GNVVIPTLDGNQLRLRVRSGT 394

Query: 323 VLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNV 355
             R G+T+ + G+G P+   G   GDM V   V
Sbjct: 395 --RDGETVSVPGQGVPRGRGGLSRGDMKVQWRV 425

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PY +LG+++D+   EI+KAY KLA K+HPD   D   K S++ KF +IT AYEILS+
Sbjct: 47  DPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKD---KGSDK-KFHDITNAYEILSD 100

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (70%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY+ILG+   ++D +I+ AYRKL++KFHPDKV   +  +EK+  E  + +IT AYE L
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESL 183

Query: 61  SN 62
           ++
Sbjct: 184 TD 185

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   ++D EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 14/170 (8%)

Query: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260
           +T K  S K   K   GE    EK Q+ + +  G +    + +K  GD +  T     + 
Sbjct: 195 FTGKKKSFKIGRKGMRGE---PEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQ 251

Query: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320
           F +K    P       L  ++G ++   + +   E++ G       +T D R L L+  Q
Sbjct: 252 FIIKEKKHP-------LYKRDGDNIIYTLPLTFKESLLGFSKTL--QTLDGRTLPLSRSQ 302

Query: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISERNDIT 370
              ++P +     G+G P + N  + G++ +   + +P     S+R  I 
Sbjct: 303 --PVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIA 350

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 104/261 (39%), Gaps = 41/261 (15%)

Query: 108 ESTNEATQIEIEVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCT 166
           E      +I   ++ KD ++  KNV  + +    C  CDG+  +          P  S +
Sbjct: 176 EYQGSPIEISHRISFKDSVFGTKNVNLKYSAYDPCNTCDGSGLK----------PGASRS 225

Query: 167 KCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQ 225
            C G       V     FQ     +C +C G+G        D + C+ CHGEG  + +  
Sbjct: 226 TCPGCSGTGTRVHVRAGFQMAS--TCNQCGGEGSVL----RDADTCQTCHGEGAKLDKNH 279

Query: 226 QLLVTIPRGSENSNTIIFKEKGD-----------EDLRTRRAGDIVFRLKLHDEPNGGDP 274
           +L V +P G ++ + I    KG            + +R  R GD++ R+++  +P     
Sbjct: 280 ELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSR-GDLLLRIRVDKDPR---- 334

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                K   D+    +IP+  A  G  G     T D   ++L +  G   +  D + I  
Sbjct: 335 --FQIKNKYDIWFTQDIPITTAALG--GVVTIPTVDGEQVRLKVSPG--TQHHDVVSIPQ 388

Query: 335 EGWPKTPNGTEFGDMFVHVNV 355
           +G P+   GT  GDM V   V
Sbjct: 389 KGVPRGSFGTR-GDMKVQYRV 408

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY  LGV   +T  EI+KAY KLA K+HPD      + A  + KF ++  AYEILS+
Sbjct: 39 DPYSTLGVSNSATSSEIKKAYYKLAKKYHPDI----NKAADAQKKFHDLQNAYEILSD 92

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L ++R+++D+EI+KAYRKLA+K HPDK   P    +    FK I  A+E+LS+
Sbjct: 24 YEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSD 75

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL V+R + D EI+KAYRKLA+K HPDK  +P  KA+    FK I  A+E+L N
Sbjct: 24 YEILKVNRTANDSEIKKAYRKLAIKLHPDK--NPHPKAAE--AFKLINRAFEVLGN 75

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 2   AKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYE 58
           A  +PY++LGV   STD EI+ AYRKL++KFHPDK+   ++  E+ + E +F  I  AY+
Sbjct: 108 AAFDPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYK 167

Query: 59  ILSN 62
            L++
Sbjct: 168 ALTD 171

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + D EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 11/142 (7%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
           G+G I EK Q+ + +  G +    I +K +GD + +T     + F L+  + P       
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNHP------- 266

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
           +  +EG DL   + +   E++ G   +   +T D R L ++  Q   ++P +T V  G+G
Sbjct: 267 VFKREGDDLTCTLPLTFKESLLGFNKQI--QTIDGRTLPISRTQ--PIQPSETSVYPGQG 322

Query: 337 WPKTPNGTEFGDMFVHVNVEFP 358
            P     ++ G++ V   +++P
Sbjct: 323 MPIPKTPSQRGNLIVRYKIDYP 344

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 115/274 (41%), Gaps = 42/274 (15%)

Query: 116 IEI--EVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           IEI   V+ KD ++   NV+ + +    C  C G   +   +        ++C  C G G
Sbjct: 207 IEIVHNVSFKDAVFGSNNVQLKFSALDPCGTCSGTGMKPNTHK-------VNCGTCHGTG 259

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQQLLVTI 231
               + G    FQ +   +C  C G+G  T K   D   C  CHGEG+ +   + + V +
Sbjct: 260 TTVHIRGG---FQMMS--TCPTCNGEG--TMKRPQDS--CSKCHGEGVQVNRGKTITVDL 310

Query: 232 PRGSENSNTIIFKEKG-------DEDLRTR---RAGDIVFRLKLHDEPNGGDPDILVTKE 281
           P G ++ + +    +G       +EDL+       GDI+ R+++  +PN         K 
Sbjct: 311 PHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLSRGDILVRIRVDKDPN------FSIKN 364

Query: 282 GTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTP 341
             D+  N EIP+  A  G  G     T + + +++ +  G   +    I I   G PKTP
Sbjct: 365 KYDIWYNKEIPITTAALG--GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKTP 420

Query: 342 NGTEFGDMFVHVNVEFPPDNWISERNDITTLTNV 375
             T  GDM V   +       ++E+     L +V
Sbjct: 421 --TIRGDMKVQYKIVVKKPQSLAEKCLWEALADV 452

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PYD LG+ + +T  EI+KAY KLA K+HPD   +P+     E KF ++  AYEILS+
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSD 114

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 48/66 (72%), Gaps = 4/66 (6%)

Query: 1   MAKL-NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTA 56
           MA++ +PYD+LG+   ++D +I+ AYR+L+LKFHPDK+   +  EE+ + E  + +I+ A
Sbjct: 120 MAQMFDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKA 179

Query: 57  YEILSN 62
           +E L++
Sbjct: 180 HEALTD 185

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 111/279 (39%), Gaps = 43/279 (15%)

Query: 112 EATQIEI--EVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKC 168
           + + IE+   ++ KD ++  KNV  + +    C  CDG+  +          P  S T C
Sbjct: 174 QGSPIELTHRISFKDSVFGTKNVNLKFSAYDPCGTCDGSGLK----------PGASRTTC 223

Query: 169 KGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQQL 227
            G       V     FQ     +C +C G+G        D + C  CHGEG  + +   +
Sbjct: 224 PGCSGTGTRVHIRAGFQMAS--TCNQCGGEGSVV----RDSDTCATCHGEGASLNKDHAI 277

Query: 228 LVTIPRGSENSNTIIFKEKGD-----------EDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
            V +P G ++ + I    +G            + +R  R GD++ R+++  +P       
Sbjct: 278 KVDLPHGLQDGDVIRISGQGSYPNIAVDPAMKDTVRLSR-GDVLLRIRVDKDPR------ 330

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
              K   D+ +  +IP+  A  G  G     T D   ++L +  G   +  D + I  +G
Sbjct: 331 FQIKNKYDIWLTQDIPITTAALG--GIVTVPTVDGEQVRLKVAPGT--QHNDVVSISQKG 386

Query: 337 WPKTPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTNV 375
            P+   G+  GDM V   +        +ER     L +V
Sbjct: 387 VPRGAFGSR-GDMKVQYKISIKKPQSQAERCLWEALADV 424

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY  LGV + ++  EI+KAY KLA K+HPD  I+  E A  + KF ++  AYEILS+
Sbjct: 40 DPYATLGVSKSASGSEIKKAYYKLAKKYHPD--INKAEDA--QKKFHDLQNAYEILSD 93

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDIL V+R S+D +I+KAYRKLA+K HPDK  +P  KA     FK I  A+E+LS+
Sbjct: 23 YDILNVERSSSDVDIKKAYRKLAIKLHPDK--NPYPKAHE--AFKLINRAFEVLSD 74

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL V++ + D+EI+KAYRKLA+K HPDK  +P  KAS    FK I  A+E+LS+
Sbjct: 24 YEILKVEKTANDNEIKKAYRKLAVKLHPDK--NPHPKASE--AFKIINRAFEVLSD 75

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L ++R ++D+EI+K+YRKLA+K HPDK  +P  +AS    FK I  A+E+LS+
Sbjct: 26 YEVLQIERSASDNEIKKSYRKLAIKLHPDK--NPHPRASE--AFKVINRAFEVLSD 77

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V++ ++D EI+KAYRKLA+K HPDK   P    +    FK I  A+E+LS+
Sbjct: 24 YEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSD 75

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + EI+K YRK ALK+HPDK     E      KFK+I+ AYEILS+
Sbjct: 8  YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSD 57

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 11/159 (6%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
           G G ++EK Q+ + +  G +    + +K KGD + RT     + F +   DE     P  
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFII---DE----KPHP 268

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
              +E  +L   + +   E++ G       +T D R L ++  Q   ++P +     G+G
Sbjct: 269 TFQREDDNLVCTVPLTFKESLLGFSK--TVQTIDGRNLPISRSQ--PIQPTEITRYPGQG 324

Query: 337 WPKTPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTNV 375
            P +    + GD+ V   + +P     ++R+ I T  NV
Sbjct: 325 MPISKKPGQRGDLIVKYKIAYPITLTQAQRDAIKTNFNV 363

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDK-VIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  D+T ++I+KAYRK A++ HPDK   DPE +A    KF+E++ AY++LS+
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQA----KFQEVSKAYKVLSD 60

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K Y+K ALK+HPDK       A +  KFKEI+ AYEILS+
Sbjct: 8  YDMLGVSPSANEQELKKGYKKAALKYHPDK------PAGDTEKFKEISEAYEILSD 57

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 11/136 (8%)

Query: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG 282
           EK Q+ + +  G +    I +K +GD + +T     + F L+    P       L  ++G
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHP-------LYKRDG 270

Query: 283 TDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPN 342
            +L  ++ +   E++ G       +T D R L ++  Q   ++P +     G+G P +  
Sbjct: 271 DNLIYSLPLSFKESLLGFSKTI--QTIDGRTLPISKIQ--PVQPTEVSSYPGQGMPVSKR 326

Query: 343 GTEFGDMFVHVNVEFP 358
             + GD+ V   +++P
Sbjct: 327 PGQRGDLVVKYKIDYP 342

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   ++D E++K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 68/144 (47%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G+  I EK+Q+ + +  G +    I +K +GD +  T  R+    + + K H+       
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPHE------- 256

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                ++G DL   + +   E++ G       +T D R  ++++ + + ++P + +   G
Sbjct: 257 --FFKRDGNDLIYTLPLTFKESLLGFDK--TVRTIDGR--QISIHKTQPVQPSEEMRYPG 310

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P + N +E GD+ V    ++P
Sbjct: 311 QGMPLSKNPSERGDLIVKYKTDYP 334

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V++ ++D+EI+KAYRKLA++ HPDK   P    +    FK I  A+E+LS+
Sbjct: 26 YELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSD 77

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 115/274 (41%), Gaps = 42/274 (15%)

Query: 116 IEI--EVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           IEI  +V+ KD ++  KNV+ + +    C  C G   +   +        +SCT C G+G
Sbjct: 206 IEIVHKVSFKDAVFGAKNVQLKFSALDPCGTCSGTGMKPNTHK-------VSCTTCHGSG 258

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEK-QQLLVTI 231
               + G    FQ +   +C  C G+G  T K   D   C  CHGEG+   + + + V +
Sbjct: 259 STVHVRGG---FQMMS--TCPTCNGEG--TMKRPQDN--CTSCHGEGVQANRGKSITVDL 309

Query: 232 PRGSENSNTIIFKEKGD----------EDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKE 281
           P G ++ + +    +G           +D      GDI+ R+++  +P+         + 
Sbjct: 310 PHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRGDILVRIRVDKDPS------FSIRN 363

Query: 282 GTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTP 341
             D+  + EIP+  A  G  G     T D + +++ +  G   +    I I   G P+T 
Sbjct: 364 KYDIWYDKEIPITTAALG--GTITIPTVDGQKIRIKVAPG--TQYNQVISIPNMGVPRT- 418

Query: 342 NGTEFGDMFVHVNVEFPPDNWISERNDITTLTNV 375
             T  GDM V   +       ++E+     L +V
Sbjct: 419 -ATLRGDMKVQYKIVVKKPQSLAEKCLWEALADV 451

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PYD LG+ + +T  EI+KAY KLA K+HPD   +P+     E KF ++  AYEILS+
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSD 114

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY +LGV   +TD E+R AYRKL++KFHPDK+   +  E+++  E ++  IT AY+ L
Sbjct: 115 FDPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKAL 174

Query: 61  SN 62
           ++
Sbjct: 175 TD 176

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY +LGV   +TD +I+ AYRKL++KFHPDK+   +  EE+A  E  + +I+ AYE L
Sbjct: 122 FDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEAL 181

Query: 61  SN 62
           ++
Sbjct: 182 TD 183

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY+ILG+   ++D +I+ AYRKL++KFHPDK+   +  +EK   E  + +IT AYE L
Sbjct: 124 FDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESL 183

Query: 61  SN 62
           ++
Sbjct: 184 TD 185

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V+R S + EI+K+YRKLA+K HPDK  +P  KAS    FK I  A+E+LS+
Sbjct: 24 YNVLKVERSSDETEIKKSYRKLAIKLHPDK--NPHPKASE--AFKVINRAFEVLSD 75

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY++LG+   ++D +I+ AYRKL+LKFHPDK+   +   ++   E ++ +IT AYE L
Sbjct: 120 FDPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESL 179

Query: 61  SN 62
           ++
Sbjct: 180 TD 181

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY+ LGV +D++  +I+KAY KLA +FHPD  I+ +E A  E KF ++  AYEILS+
Sbjct: 41 DPYETLGVAKDASASQIKKAYYKLAKQFHPD--INKDEGA--EKKFHDLQNAYEILSD 94

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+   + + EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 62/138 (44%), Gaps = 15/138 (10%)

Query: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG 282
           EK Q+ + +  G +    I +K  GD +  T R   + F ++    P         T++G
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHP-------FFTRDG 262

Query: 283 TDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KT 340
            DL   + +   E++ G       +T D R L ++  Q   ++P +     G+G P  KT
Sbjct: 263 NDLIYTLPLTFKESLLGFNK--TIQTIDGRTLPVSRIQ--PIQPSEKSTYPGQGMPIPKT 318

Query: 341 PNGTEFGDMFVHVNVEFP 358
           P   + GDM V+  V++P
Sbjct: 319 PG--QRGDMIVNYKVDYP 334

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKV--IDPEEKASNEMKFKEITTAYEILSN 62
           Y ILGVD+ +T  ++R++Y +L  KFHPDK   ++ E++  NE K  EI  AYEILS+
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSD 587

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGVD  +TD E++KAYRK AL+FHPDK  D  E+A+    F  I +AYE+LS+
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATE--IFATIRSAYEVLSD 59

>SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {ON}
           some similarities with uniprot|P35191 Saccharomyces
           cerevisiae YFL016C MDJ1 Protein involved in folding of
           mitochondrially synthesized proteins in the
           mitochondrial matrix localizes to the mitochondrial
           inner membrane member of the DnaJ family of molecular
           chaperones
          Length = 510

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 112/281 (39%), Gaps = 41/281 (14%)

Query: 108 ESTNEATQIEIEVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCT 166
           E   ++ +I   ++ KD ++  KNV         C  C         +G        +C 
Sbjct: 191 EYKGDSIEITHRISFKDAVFGVKNVNLNYAALDPCNSC-------HSSGLKSGASRTTCP 243

Query: 167 KCKGAGY-VERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEK- 224
            C+G G  V    G    FQ     +C +C G+G          + C  CHGEG++  + 
Sbjct: 244 GCQGTGTRVHVRAG----FQMAS--TCTQCDGEGSVI----RGSDMCGTCHGEGVVMNRG 293

Query: 225 QQLLVTIPRGSENSNTIIFKEKG-------DEDLRTR---RAGDIVFRLKLHDEPNGGDP 274
           +Q+ V +P G ++ + I    +G       D  ++     R GD++ R+++  +P     
Sbjct: 294 KQIKVDLPHGLQDGDAIRISREGSYPHISIDPSMKNSVHLRRGDLLLRVRVDKDPR---- 349

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                K   D+    EIPL  A  G  G     T D + ++L + QG   +  D + I  
Sbjct: 350 --FSIKNNYDIWFTQEIPLTTAALG--GVVTVPTVDGQQIRLKVKQGT--QHDDVVSIPQ 403

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTNV 375
           +G P+   G+  GDM V   +        +ER     L +V
Sbjct: 404 QGVPRGTLGSR-GDMKVQYKLAVRKPQSQAERCLWEALADV 443

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PY  LGV + ++  EI+KAY KLA K+HPD  I+  E A  + KF ++  AYEILS+
Sbjct: 56  DPYKTLGVSQSASGSEIKKAYYKLAKKYHPD--INKAEDA--QKKFHDLQNAYEILSD 109

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY +L V   STD EIR AYRKL++KFHPDK+   +   E++  E ++  IT AY+ L
Sbjct: 116 FDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKAL 175

Query: 61  SN 62
           ++
Sbjct: 176 TD 177

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY +L +   STD EIR AYRKL++KFHPDK+   +  +E+   E ++  IT AY+ L
Sbjct: 114 FDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKAL 173

Query: 61  SN 62
           ++
Sbjct: 174 TD 175

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+   + + EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 11/153 (7%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
           G G + EK Q+ + +  G +    I FK +GD + RT   G    +  L ++P+      
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRT--GGRQTLQFVLQEKPHE----- 261

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
             T++  DL   + +   E++ G   +   +T D + + +T  Q   ++P  T    G+G
Sbjct: 262 FFTRQDNDLIYTLPLSFKESLLGFSKQ--VQTIDGKTIPITRTQ--PIQPTQTSTYPGQG 317

Query: 337 WPKTPNGTEFGDMFVHVNVEFPPDNWISERNDI 369
              + N ++ GD+ +   +++P      +R  I
Sbjct: 318 MTLSKNPSQRGDLIIKFKIDYPTSLTPQQRQAI 350

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  +  D E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 65/140 (46%), Gaps = 15/140 (10%)

Query: 221 IKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDPDILV 278
           I EK+Q+ + +  G +    I +K +GD +  T  R+    + + K+HD          +
Sbjct: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD---------FL 256

Query: 279 TKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP 338
            ++G DL   + +   E++ G        T D R + ++  Q   ++P +     G+G P
Sbjct: 257 KRDGNDLTYTLPLSFKESLLGFSK--TVHTIDGRQIFISKTQ--PVQPSEESRYPGQGMP 312

Query: 339 KTPNGTEFGDMFVHVNVEFP 358
            + N +E GD+ V   +++P
Sbjct: 313 LSKNPSERGDLIVKYKIDYP 332

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 100 GGHPQREDESTNEATQIEIEVTLKDLYNGKNVKFQLTR 137
           G H     +   +  Q+ + V+L+DLY GK   F++TR
Sbjct: 163 GMHSHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITR 200

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L +D++++D +++KAYRKLA+K HPDK   P    +    FK+I  A+E+LS+
Sbjct: 26 YELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSD 77

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 123/315 (39%), Gaps = 59/315 (18%)

Query: 108 ESTNEATQIEIEVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCT 166
           E   E   +  +V+ KD ++  KNVK        C+ CDG+  +   +  +       C 
Sbjct: 166 EYKGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHSRSV-------CP 218

Query: 167 KCKGAG-YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEK 224
            C G G  V    G    FQ     +C+ C G+G        D +KC  CH  G  +   
Sbjct: 219 TCHGTGTQVHVRAG----FQMAS--TCQTCDGEGS----TIKDSDKCGTCHSHGFKLNSN 268

Query: 225 QQLLVTIPRGSENSNTIIFKEKGD-----------EDLRTRRAGDIVFRLKLHDEPN--- 270
           + + V +P G ++ +TI    +G             +L   R GD++ R+++  +     
Sbjct: 269 KTITVDLPHGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLTR-GDLLIRVRVRKDTRFQV 327

Query: 271 GGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTI 330
             + DI+ T+E         IP+  A  G  G     T ++  ++L +  G   +    I
Sbjct: 328 SNNYDIIYTQE---------IPITTAALG--GVIEVPTVEEEKIRLKVSSG--TQHDQVI 374

Query: 331 VIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISER----------NDITTLTNVLPAGK 380
            I  +G P+   G + GDM V   +        +ER          ND T    + P+G 
Sbjct: 375 RIPNKGVPRGARG-DRGDMLVKFKIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGS 433

Query: 381 SDDGHAQTGDANNAE 395
           S   ++ + D +  E
Sbjct: 434 SAKDNSSSADKDTVE 448

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 43/58 (74%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY +LG++++S+  +I+KAY KLA K+HPD  I+ EE +  + KF ++  AYEILS+
Sbjct: 25 DPYKVLGINKNSSQSDIKKAYYKLAKKYHPD--INKEEDS--QKKFHDLQNAYEILSD 78

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 44/62 (70%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY++LG+   +++ +I+ AYRKL++KFHPDK+   +  +E+ + E  + +IT AYE L
Sbjct: 128 FDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEAL 187

Query: 61  SN 62
           ++
Sbjct: 188 TD 189

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 42/61 (68%), Gaps = 3/61 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY++LG+   +T+ E+R +YRKL++KFHPDK+   +  EE+   E ++  IT AY+ L
Sbjct: 114 FDPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKAL 173

Query: 61  S 61
           +
Sbjct: 174 T 174

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGVD  +TD E++KAYRK AL+FHPDK  D  ++A+    F  I +AYE+LS+
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATE--IFATIRSAYEVLSD 59

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK       + +  KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDK------PSGDAEKFKEISEAFEILND 57

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 11/142 (7%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
           G G   EKQQ+ + +  G +    I +K +GD + RT R   + F L+     N      
Sbjct: 208 GPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPHSN------ 261

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
             T++G DL  ++ +   E++ G       +T D R L ++  Q   ++P D+    G+G
Sbjct: 262 -YTRDGNDLIYSLPLTFKESLLGFSKTI--QTIDGRTLPISRVQ--PVQPSDSSTYPGQG 316

Query: 337 WPKTPNGTEFGDMFVHVNVEFP 358
            P     ++ G++ V   +++P
Sbjct: 317 MPIAKTPSQRGNLIVKYKIDYP 338

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK AL++HPDK  D  E+A+   KF  I  AYE+LS+
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEAT--QKFAVIRAAYEVLSD 59

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260
           +  K  S K   K  HG     EK Q+ + +  G +    I +K +GD + +T R   + 
Sbjct: 194 FVGKKKSFKIGRKGPHGAS---EKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQ 250

Query: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320
           F ++    PN         ++G DL   + +   E++ G       +T D R L L+  Q
Sbjct: 251 FVIQEKSHPN-------FKRDGDDLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLSRVQ 301

Query: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              ++P  T    G+G P   N ++ G++ V   V++P
Sbjct: 302 --PVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 337

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYE 58
           M+K N Y +LGV + +T  +IRK+Y  +  K+HPDK   +   +K  N+ K  EI  AYE
Sbjct: 501 MSKKNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYE 560

Query: 59  ILSN 62
           ILS+
Sbjct: 561 ILSD 564

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+IL V+R + D+EI+K+YRKLA++ HPDK  +P  +AS    FK I  A+E+L +
Sbjct: 24 YEILKVERTANDNEIKKSYRKLAIRLHPDK--NPHPRASE--AFKLINRAFEVLGD 75

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV+ +STD EI+KAYRK ++K HPDK  +P    + + KF+ I+ AY++LS+
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDK--NPNNPDATK-KFQAISEAYQVLSD 60

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILND 57

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 11/154 (7%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDI 276
           G G   EKQQ+ + +  G +    I +K +GD + RT R   + F ++     N      
Sbjct: 205 GPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPHEN------ 258

Query: 277 LVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEG 336
             T++G DL   + +   E++ G       +T D R L ++  Q   ++P D     G+G
Sbjct: 259 -YTRDGNDLIYTLPLTFKESLLGFNKTI--QTIDGRTLPISRVQ--PVQPSDVSTYPGQG 313

Query: 337 WPKTPNGTEFGDMFVHVNVEFPPDNWISERNDIT 370
            P   N ++ G++ V   +++P     S+R  I+
Sbjct: 314 MPVAKNPSQRGNLIVKYKIDYPATLNDSQRRAIS 347

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK AL++HPDK  D  E+A+   KF  I  AYE+LS+
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEAT--QKFAIIRAAYEVLSD 59

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 15/138 (10%)

Query: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDPDILVTK 280
           EK Q+ + + +G +    I +K +GD + RT  R+    V + K H          L  +
Sbjct: 230 EKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVLQEKAHP---------LFKR 280

Query: 281 EGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKT 340
           +G +L   + +   E++ G       +T D R L ++  Q   ++P ++    G+G P T
Sbjct: 281 DGDNLIYTLPLSFKESLLGFSKTI--QTIDGRTLPISRVQ--PIQPSESSRYPGQGMPIT 336

Query: 341 PNGTEFGDMFVHVNVEFP 358
               + GD+ V   +++P
Sbjct: 337 KKPGQRGDLIVKYKIDYP 354

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK AL++HPDK  D  E+A+   KF  I  AYE+LS+
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATE--KFAIIRAAYEVLSD 59

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V   + + EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 8  YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 11/136 (8%)

Query: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG 282
           EK Q+ + +  G +    I +K +GD +  T   G    +  L ++PN         ++ 
Sbjct: 218 EKAQIEIALKAGWKAGTKITYKNQGDYNPST--GGRKTLQFILKEKPNTN-----FKRDE 270

Query: 283 TDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPN 342
            +L   + +   E++ G Q     KT D + L ++  Q   ++P +     G+G P + +
Sbjct: 271 DNLIYTLPLTFKESLLGFQKTI--KTIDGKTLPISRVQ--PVQPSECTTYPGQGMPISKS 326

Query: 343 GTEFGDMFVHVNVEFP 358
             + GDM V   V +P
Sbjct: 327 VGQRGDMIVKFKVGYP 342

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V+R ++D+EI+KAYR+LA+K HPDK   P    +    FK I  A+E+L +
Sbjct: 25 YEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEA----FKVINRAFEVLGD 76

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G G + EK+Q+ + +  G +    I FK +GD + +T  R+    V + KLH        
Sbjct: 203 GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEKLHPH------ 256

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                ++G +L   + +   E++ G       +T D R L ++  Q   ++P +T    G
Sbjct: 257 ---FKRDGNNLIYTLPLSFKESLLGFSKTI--QTIDGRTLPISRVQ--PIQPSETSTYPG 309

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P      + GD+ +   V++P
Sbjct: 310 QGMPLPKTPAQRGDLIIKYKVDYP 333

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 4/35 (11%)

Query: 103 PQREDESTNEATQIEIEVTLKDLYNGKNVKFQLTR 137
           PQRE+E+     Q+ + V+L+DL+ G+   F++TR
Sbjct: 171 PQREEETV----QVNLPVSLEDLFAGRKKSFKITR 201

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260
           +  K  S K   K  HG     EK Q+ + +  G +    I +K +GD + +T R   + 
Sbjct: 208 FVGKKKSFKIGRKGPHGAS---EKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQ 264

Query: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320
           F ++    PN         ++G DL   + +   E++ G       +T D R L L+  Q
Sbjct: 265 FVIQEKSHPN-------FKRDGDDLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLSRVQ 315

Query: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              ++P  T    G+G P   N ++ G++ V   V++P
Sbjct: 316 --PVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 351

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 108/261 (41%), Gaps = 42/261 (16%)

Query: 108 ESTNEATQIEIEVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCT 166
           E   ++ ++   +  KD ++  KN   Q +    C +C G+  ++            +C 
Sbjct: 168 EYKGDSVEVIHRMKFKDAVFGAKNANLQFSVLDPCGVCHGSGLKKNAQSS-------TCP 220

Query: 167 KCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQ 225
            C G G    + G    FQ     +C +C G+G  T +P   ++ C  CHGEG+ +  ++
Sbjct: 221 SCHGTGTTVHVRGG---FQMAS--TCNQCGGEGT-TVRP---EDVCSKCHGEGVELNSQR 271

Query: 226 QLLVTIPRGSENSNTIIFKEKGD-----------EDLRTRRAGDIVFRLKLHDEPNGGDP 274
            + V +P+G ++ + +    +G              ++  R GD++ R+++  +      
Sbjct: 272 SISVDLPQGLQDGDVVRVPGQGSYPHLAVDPKMKNSVKLHR-GDVLVRIRVDKDSR---- 326

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                +  TD+    EIP+  A  G  G+    T DD  ++L +  G   +    I I  
Sbjct: 327 --FSIRNKTDIWFTKEIPITTAALG--GQVTIPTVDDTQIRLKVQPG--TQHDQVISIPN 380

Query: 335 EGWPKTPNGTEFGDMFVHVNV 355
            G P+   G E G M V   +
Sbjct: 381 MGVPRI--GGERGAMKVQYKI 399

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY+ LGV ++++  EI+KAY KLA KFHPD  I+ E  A  E KF ++  AYEILS+
Sbjct: 36 DPYETLGVGKNASSSEIKKAYYKLAKKFHPD--INKEPNA--EAKFHDLQNAYEILSD 89

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (6%)

Query: 5  NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +PY +LGV   ++  EI+KAY KLA ++HPD  I+ E  A  E KF ++  AYEILS+
Sbjct: 35 DPYGVLGVKSSASQGEIKKAYYKLAKQYHPD--INKE--AGAEKKFHDLQNAYEILSD 88

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G G  +EK Q+ + +  G +    + +K  GD + RT  R+    V + K H        
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQEKTHP------- 270

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
             L  + G DL   + +   E++ G       +T D R L L+  +   ++P +T    G
Sbjct: 271 --LYKRNGDDLEYTLPLTFKESLLGFSKTI--QTIDGRTLPLS--RSSPVQPTETSRYPG 324

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P     ++ GD+ V   +++P
Sbjct: 325 QGMPMPKMPSQRGDLVVRFKIDYP 348

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 217 GEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDP 274
           G G  +EK Q+ + +  G +    + +K +GD + R+  R+    V + K H       P
Sbjct: 182 GPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAH-------P 234

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
           D    ++G DL   + +   E++ G        T D R  KL + + + ++P +     G
Sbjct: 235 DF--KRDGDDLIYILRLSFKESLLGFSK--TINTIDGR--KLPLSRSQPIQPTEISTYPG 288

Query: 335 EGWPKTPNGTEFGDMFVHVNVEFP 358
           +G P + N ++ G++ +   +++P
Sbjct: 289 QGMPVSKNPSQRGNLIIKYKIDYP 312

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260
           +  K  S K   K  HG     EK Q+ + +  G +    I +K +GD + +T R   + 
Sbjct: 210 FVGKKKSFKIGRKGPHGAA---EKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKTLQ 266

Query: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320
           F ++    PN         ++G DL   + +   E++ G       +T D R L L+  Q
Sbjct: 267 FVIQEKGHPN-------FKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLSRVQ 317

Query: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              ++P  T    G+G P   N ++ G++ V   V++P
Sbjct: 318 P--VQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L VD  ++D +I+KAYRK+A+K HPDK   P    +    FK++  A+E+LS+
Sbjct: 26 YELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSD 77

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260
           +  K  S K   K  HG     EK Q+ + +  G +    I +K +GD + +T R   + 
Sbjct: 201 FVGKKKSFKIGRKGPHG---TSEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQ 257

Query: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320
           F ++    PN         ++G DL   + +   E++ G       +T D R L L+  Q
Sbjct: 258 FVIQEKSHPN-------FKRDGDDLIYTLPLSFKESLLGFSKTI--QTIDGRTLPLSRVQ 308

Query: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358
              ++P  T    G+G P   N ++ G++ V   V++P
Sbjct: 309 --PVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 344

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 42/62 (67%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PY++L V   +TD EIR AYRKL++KFHPDK+   +   E++  E ++  IT AY+ L
Sbjct: 114 FDPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKAL 173

Query: 61  SN 62
           ++
Sbjct: 174 TD 175

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDIL V + +   EI+K+YRKLA+K HPDK  +P  KA     FK I  A+E+LS+
Sbjct: 26 YDILNVQKSADSVEIKKSYRKLAIKLHPDK--NPHPKAGE--AFKVINRAFEVLSD 77

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 111/265 (41%), Gaps = 42/265 (15%)

Query: 116 IEI--EVTLKD-LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAG 172
           IEI  +V+ KD ++   NV+ + +    C+ C G   +   +        ++C+ C G G
Sbjct: 201 IEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGTGMKPNTHK-------VNCSTCHGTG 253

Query: 173 YVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQQLLVTI 231
               + G    FQ +   +C  C G+G  T K   D   C  CHGEG+ +   + + V +
Sbjct: 254 TTVHIRGG---FQMMS--TCPTCNGEG--TMKRPQDS--CTKCHGEGVQVNRAKTITVDL 304

Query: 232 PRGSENSNTIIFKEKGD----------EDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKE 281
           P G ++ + +    +G           +D      GDI+ R+++  +PN         K 
Sbjct: 305 PHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIRVDKDPN------FSIKN 358

Query: 282 GTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTP 341
             D+  + EIP+  A  G  G     T + + +++ +  G   +    I I   G PKT 
Sbjct: 359 KYDIWYDKEIPITTAALG--GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKTT 414

Query: 342 NGTEFGDMFVHVNVEFPPDNWISER 366
             T  GDM +   +       ++E+
Sbjct: 415 --TIRGDMKIQYKIVVKKPQSLAEK 437

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PYD LG+ + +T  EI+KAY KLA K+HPD  I+ E  A  E KF ++  AYEILS+
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD--INKEVDA--EKKFHDLQNAYEILSD 114

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 40/59 (67%), Gaps = 6/59 (10%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVID--PEEKASNEMKFKEITTAYEIL 60
          ++PY++LGV++  T+ E++K YRKL L+ HPDK  D  PE K     KF +I  A+E+L
Sbjct: 13 IDPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTPEAKE----KFHKIQFAFEVL 67

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+   +TD EI+KAYRK ++K HPDK  +P + ++ E +F+ I+ AY++LS+
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDK--NPNDPSATE-RFQAISEAYQVLSD 60

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGVD  ++D E++KAYRK AL++HPDK     E+A+    F  I TAYE+LS+
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATE--IFATIRTAYEVLSD 59

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK AL++HPDK  D  ++A+   KF  I  AYE+LS+
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATE--KFAIIRAAYEVLSD 59

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK AL+FHPDK  D  ++A+    F  I  AYE+LS+
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATE--NFATIRAAYEVLSD 59

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGVD  ++D +++KAYR+ AL++HPDK I   ++A+    F  I  AYE+LS+
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATE--IFASIRAAYEVLSD 59

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+ ++TD E++KAYR+ AL+FHPDK  +P+        F  +  AYE+L++
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK--NPDNVEETTAIFASVRAAYEVLAD 59

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V  D++D +++KAYR+ AL++HPDK  D  E+A+    F EI  AYE+LS+
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEAT--TIFAEIRAAYEVLSD 59

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 2  AKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV----IDPEEKASNEMKFKEITTAY 57
          ++++ Y++LGV  D++ DEI+  YRK+ L  HPDK     ID   K  + +   +I  AY
Sbjct: 7  SRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAY 66

Query: 58 EILSN 62
           +LSN
Sbjct: 67 RVLSN 71

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YDIL V  D++  EI+K+YRKLA+K HPDK  +P++  + + KF+E+  AY++L
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDK--NPDDPQA-QTKFQELAKAYQVL 58

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (71%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILGV+ D+T  EI+KAYR+ A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQA----KFQAVGEAYQVLSD 60

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 6/56 (10%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V   + + E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 8  YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 11/148 (7%)

Query: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG 282
           EK Q+ + +  G +    I +K KGD + +T     + F +     P+         +E 
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNPKTGGRKTLQFIISEKPHPH-------FKRED 280

Query: 283 TDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPN 342
            +L   + +   E++ G       +T D + L L+  +G+ ++P +T    G+G P T  
Sbjct: 281 DNLIYTLPLTFKESLLGFSKTI--QTIDGKNLPLS--RGQPVQPSETTTYPGQGMPITKK 336

Query: 343 GTEFGDMFVHVNVEFPPDNWISERNDIT 370
             + GD+ +   V++P +   ++R  I+
Sbjct: 337 PGQRGDLLIKYKVDYPINLTPAQREAIS 364

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   +T  EI+KAYR+ A++ HPDK   DPE +A    KF+E+  AY++LS+
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQA----KFQEVGEAYQVLSD 60

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV+  +TD EI+KAYRK ++  HPDK  + ++ A+ E +F+ I+ AY++LSN
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDK--NRDDPAATE-RFQSISEAYQVLSN 60

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V + +++ +I+KAYRKLA+K HPDK   P  +AS    FK+I  A+E+LS+
Sbjct: 24 YEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHP--RASE--AFKKINRAFEVLSD 75

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D E++KAYRK ALK+HPDK  +  E+A+    F  I  AYE+LS+
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEAT--QAFATIRLAYEVLSD 59

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+   +T  EI+KAYRK ++K HPDK  +P +  + E +F++I+ AY++LS+
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQQISEAYQVLSD 60

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PY  LGV RD++  +I++AY KLA K+HPD  I+ E  A  +  F  +  AYEILS+
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPD--INKEPGA--DKTFHNLQNAYEILSD 101

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYE 58
           MA  + Y ILGV ++S   EIRK+Y  L  K+HPDK   +  EE+  N  K ++I  AYE
Sbjct: 600 MANKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYE 659

Query: 59  ILSN 62
            LS+
Sbjct: 660 CLSD 663

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 44/62 (70%), Gaps = 3/62 (4%)

Query: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEMKFKEITTAYEIL 60
            +PYDILG+   S+D +I+ AYRKL++KFHPDK+   +  +E+   E K+ +IT AYE L
Sbjct: 121 FDPYDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEAL 180

Query: 61  SN 62
           ++
Sbjct: 181 TD 182

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+  D+T  EI+KAYR+ A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQA----KFQAVGEAYQVLSD 60

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYEILSN 62
           Y +L +   +TD EIRKAY  L  K+HPDK   + P+++A N  K   I  AYEILS+
Sbjct: 562 YKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSD 619

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          L  Y+IL +  D+T +EI+KAYR   L  HPDK+        N +   +I  AY+ILSN
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSN 65

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 6/63 (9%)

Query: 3  KLNPYDILGVDRDS---TDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEI 59
          K+N YDILG   ++   T +EI+K YR LALK+HPDK   P +    E KF +IT A  I
Sbjct: 12 KVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKT--PNDLTLVE-KFHKITIALNI 68

Query: 60 LSN 62
          L+N
Sbjct: 69 LTN 71

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+  D++  EI+KAYRK A+  HPDK   DPE +A    KF+ I  AY++LS+
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQA----KFQAIGQAYQVLSD 60

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDILGV  ++T  EI+KAYR+ A++ HPDK  D  E  S   KF+ +  AY++LS+
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQS---KFQAVGEAYQVLSD 60

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG++  +T  EI+KAYRK ++K HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSD 60

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L V  D+TD ++++AYRK AL +HPDK  +  E+A+    F +I  AYE+LS+
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATE--VFAQIRAAYEVLSD 59

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+  ++T  EI+KAYRK+A+  HPDK   DPE +A    KF+ +  AY++L++
Sbjct: 8  YDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQA----KFQAVGEAYQVLND 60

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 39/58 (67%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS 61
          ++PY  L +  D+ D +++K+YR+L L++HPDK+ +   K   + +F ++  +YE+L+
Sbjct: 11 IDPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT 68

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 41/56 (73%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D +++KAYR+ AL++HPDK  D  E+A+    F  I +AYE+L++
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATT--VFATIRSAYEVLAD 59

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 1   MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYE 58
           M+K N Y +L V   +T  +IRK+Y  +  K+HPDK   +   +K  N+ +  EI  AYE
Sbjct: 499 MSKKNYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYE 558

Query: 59  ILSN 62
           ILS+
Sbjct: 559 ILSD 562

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          +  YD+LG+  D+T  EI+KAYR+ A++ HPDK  D  +  S   KF+ +  AY++LS+
Sbjct: 5  MEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQS---KFQAVGEAYQVLSD 60

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+  ++T  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LSN
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDK--NPNDPGATE-RFQAISEAYQVLSN 60

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (41%), Gaps = 39/228 (17%)

Query: 125 LYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVGDSPFF 184
           ++  KNV  +      C  C+G+  +             +C  C G+G    +      F
Sbjct: 207 VFGKKNVSIKFRALDPCGTCNGSGLKS-------GASKTTCPSCHGSGTTVHVRAG---F 256

Query: 185 QYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGL-IKEKQQLLVTIPRGSENSNTIIF 243
           Q +   +C+ C G+G  T    SD   CK CHGEG+ +  ++ + V +P G ++ + +  
Sbjct: 257 QMMS--TCQTCGGEG--TTVNASDF--CKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRI 310

Query: 244 KEKGD-----------EDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIP 292
             +G            + ++  R GDI+ R++++ +P+         K   D+    EIP
Sbjct: 311 PGQGSYPDIAVDKEMAKSVKLSR-GDILVRIRVNKDPH------FSIKNKYDIWYTKEIP 363

Query: 293 LIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKT 340
           +  A  G  G     T +   +++ +P G    P   I I   G PK+
Sbjct: 364 ITTAALG--GTVSIPTIEGTKIRIKVPAGTA--PEQVISIPNMGVPKS 407

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PY+ LGV + S+  +I+KAY KLA K+HPD  I+ E  A  E KF ++  AYEILS+
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHPD--INKE--AGAEKKFHDLQNAYEILSD 100

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          L  Y+IL +  D+T DEI+KAYR   L  HPDK+        + +   +I  AY+ILSN
Sbjct: 7  LTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSN 65

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%)

Query: 2  AKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS 61
          + L  Y+IL +  D+T +EI+KAYR   L  HPDK+        N +    I  AY++LS
Sbjct: 5  SSLTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLS 64

Query: 62 N 62
          N
Sbjct: 65 N 65

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILGV  ++T  EI+KAYR+ A++ HPDK   DP  +A    KF+ +  AY++LS+
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQA----KFQAVGEAYQVLSD 60

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   +T  EI+KAYRK A++ HPDK  D  E    E KF+ +  AY++LS+
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEA---ETKFQAVGEAYQVLSD 60

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 42/56 (75%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V+  ++D +++KAYR+ AL++HPDK I+  ++A++   F  I TAYEILS+
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATD--IFANIRTAYEILSD 59

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  ++T  +I+KAYRK A++ HPDK  D  E  S   KF+ +  AY++LS+
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQS---KFQAVGEAYQVLSD 60

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+  ++T  EI+KAYR+ A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQA----KFQAVGEAYQVLSD 60

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKV--IDPEEKASNEMKFKEITTAYEILS 61
           Y ILG+ +++T  +IRKAY +L  ++HPDK   +   E+  N  K  EI  AYE LS
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLS 617

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  ++   EI+KAYRK +++ HPDK  +P + ++ E +F+ I+ AY++LSN
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDK--NPNDPSATE-RFQSISQAYQVLSN 60

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  D+   +I+KAYRK ++K HPDK  +P++  + E +F+ I+ AY++LS+
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDK--NPDDPTATE-RFQAISEAYQVLSS 60

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV+  ++D +++KAYRK AL +HPDK  D  E+A+    F  I  AYE+L++
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEAT--AIFATIRAAYEVLAD 59

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYEIL 60
           Y ILGV ++S    IRKAY  L  K+HPDK   +  +E+  N  K  EI  AYEIL
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEIL 611

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 4/62 (6%)

Query: 1  MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          + K   Y +LGV  D+T++EI K+YRKLA+K HPDK     +    E  FK +  A+ +L
Sbjct: 5  LDKTTHYSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVL 60

Query: 61 SN 62
          +N
Sbjct: 61 TN 62

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+   +T  EI+KAYRK A++ HPDK  D  +  S   KF+ +  AY++LS+
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQS---KFQSVGEAYQVLSD 60

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V   ++D E++KAYRK AL++HPDK  +  E+A+    F EI  AYE+LS+
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEAT--AIFSEIRAAYEVLSD 59

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 107/263 (40%), Gaps = 41/263 (15%)

Query: 108 ESTNEATQIEIEVTLKDLYNG-KNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCT 166
           E   ++  +   V+ KD   G K +K + +    C  C G+     K+G   S    SC+
Sbjct: 185 EYKGDSIHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGL---KSGAKRS----SCS 237

Query: 167 KCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQ 226
            C G G    +      FQ     +C +C G+G    +     ++C  C GEG++  +Q+
Sbjct: 238 ICHGTGTQMHVRAG---FQMAS--TCTQCNGEGSSIRR----SDQCSSCRGEGVVFNRQK 288

Query: 227 LL-VTIPRGSENSNTIIFKEKG-----------DEDLRTRRAGDIVFRLKLHDEPNGGDP 274
            + V +P G ++ + +    +G              +RTRR GD++ ++++  +P     
Sbjct: 289 EIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRR-GDLLIQIRVERDPR---- 343

Query: 275 DILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKG 334
                +   D+    +IP+  A  G  G     T D   L+L +  G   +    + +  
Sbjct: 344 --FQIRNNYDIWYTQDIPITTAALG--GVVNIPTVDGEQLRLKIAPG--TQHEQVVSVPN 397

Query: 335 EGWPKTPNGTEFGDMFVHVNVEF 357
           +G PK    +  GDM V   +  
Sbjct: 398 KGVPKGLTASR-GDMKVQYKISL 419

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 4/58 (6%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
           +PY+ LGV RD++  +I+KAY KLA K+HPD  I+ +E A  E KF ++  AYEILS+
Sbjct: 51  DPYETLGVSRDASTSQIKKAYYKLAKKYHPD--INKDEGA--EKKFHDLQNAYEILSD 104

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 5/60 (8%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          L  YD+LGV   ++  EI+KAYRK A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 5  LEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQA----KFQRVGEAYQVLSD 60

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 3   KLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV--IDPEEKASNEMKFKEITTAYEIL 60
           K N Y ILG+  D+   +IR+AY  L  K+HPDK   +   E+A  E K   I  AYE+L
Sbjct: 507 KKNYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVL 566

Query: 61  SN 62
           S+
Sbjct: 567 SD 568

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+  D++  +I+KAYRK A+  HPDK   DPE +A    KF+ I  AY++LS+
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQA----KFQAIGEAYQVLSD 60

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYEILSN 62
           Y IL V +++   +IRKAY +L  K+HPDK   +   E+ +NE K   I  AYEILS+
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSD 566

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+  ++T  EI+KAYR+ A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQA----KFQAVGEAYQVLSD 60

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YDILG+  ++T  EI+KAYR+ A++ HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQA----KFQAVGEAYQVLSD 60

>Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig
          244] FULL
          Length = 284

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 6/60 (10%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVID--PEEKASNEMKFKEITTAYEILS 61
          LNPY+ L V+   ++ ++RK+YRK  L +HPDK  D  PE K     KF +I  A+EIL+
Sbjct: 11 LNPYEELQVETSVSEAQLRKSYRKRMLLYHPDKTKDWTPEAKE----KFHKIQFAFEILT 66

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LGV   + D E++KA+R+ AL++HPDK  D  E+A+    F +I  AYE+L++
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATE--TFAQIRAAYEVLND 59

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+L +D  +T  EI+KAYRK ++K HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQAISEAYQVLSD 60

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          Y++LGV+ D+T  EI+KAYRK AL   P+K   P    +NE KF+ I  AY++L
Sbjct: 8  YELLGVEPDATSSEIKKAYRKKALSMLPEK--HPSNIGANE-KFQAIAEAYQVL 58

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 5/57 (8%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKV-IDPEEKASNEMKFKEITTAYEILSN 62
          YD LG+  D+T  EI+KAYRK A+  HPDK   DP+ +A    KF+ +  AY++LS+
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQA----KFQAVGQAYQVLSD 60

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV  D+   EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLSS 60

>NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON}
           Anc_1.297
          Length = 623

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYEILSN 62
           Y I+G+ +D+   +IRK Y  L  KFHPDK   +  +E+  N+ K   I  AYE+LS+
Sbjct: 558 YKIMGLSKDAAAKDIRKTYLSLTKKFHPDKQGQLSEKEQKKNQEKMSAINEAYEVLSD 615

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+   +T  EI+KAYR+ A++ HPDK   P++  ++E +F+++  AY++LS+
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDK--HPDDPTASE-RFQQVGEAYQVLSD 60

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LG+   +T  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSS 60

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 41/56 (73%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LG++  +T  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDK--NPNDPGATE-RFQAISEAYQVLSD 60

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 39/55 (70%), Gaps = 3/55 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS 61
          YD+LGV  D+   +I+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLS 59

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD+LGV   +T  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++L
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVL 58

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 2  AKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV---IDPEEKASNEM---KFKEITT 55
          +++  Y++L ++ D+T  EI+KAY++  L  HPDK    I P    +N++      +I  
Sbjct: 6  SRITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQ 65

Query: 56 AYEILSN 62
          AY+ILSN
Sbjct: 66 AYKILSN 72

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 39/55 (70%), Gaps = 3/55 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILS 61
          YD+LGVD  +   +I+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS
Sbjct: 9  YDLLGVDPSAKAIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLS 60

>TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON}
          Anc_1.113 YJR097W
          Length = 170

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 29/37 (78%)

Query: 1  MAKLNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKV 37
          M+ L+ Y+ILG+D D+T+ +I++AY++  L  HPDK+
Sbjct: 1  MSLLSHYEILGIDSDATESDIKRAYKEKLLAIHPDKI 37

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++LG+   +T  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++LS+
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSD 60

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y++L V   + D+E++KAYR+ AL++HPDK  +PE        F  I  AYE+LS+
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK--NPENVEEATEIFASIRAAYEVLSD 59

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   ++  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++L +
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLGD 60

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 5/59 (8%)

Query: 7   YDILGVDRDSTDD----EIRKAYRKLALKFHPDKVIDPEEKASN-EMKFKEITTAYEIL 60
           YD+LG+D    D+    E+++ Y+KL L++HPDK +   E AS    +F  + +A++IL
Sbjct: 84  YDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEM--KFKEITTAYEILSN 62
           Y IL V +D+   +IRK+Y  L  KFHPDK     EK   ++  K  EI  AYE+LS+
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSD 586

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEM--KFKEITTAYEILSN 62
           Y +LG+ + ++  EIRKAY  L  K+HPDK     EK   ++  K  ++  AYEILS+
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSD 581

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD LG+   +T  EI+KAYR+ A++ HPDK  D  E    E KF+ +  AY++LS+
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEA---ENKFQAVGEAYQVLSD 60

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 38/54 (70%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD+LGV   ++  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++L
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDLKATE-RFQAISEAYQVL 58

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 38/54 (70%), Gaps = 3/54 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          YD+LGV  D+   +I+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++L
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVL 58

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          YD+LGV   ++  EI+KAYRK +++ HPDK  +P +  + E +F+ I+ AY++L +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGD 60

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 6/58 (10%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNE-MKFKEITTAYEIL 60
          ++ Y +LG+D D+  D I+KAYR+  L+ HPDK     ++ SNE +   ++  AY +L
Sbjct: 3  VSHYSVLGIDSDADSDTIKKAYRRRLLETHPDK-----KQISNESLSVDQLQKAYRVL 55

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 4  LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          L  Y+IL +  D+T +EI++AYR   L  HPDK+        + +   +I  AY ILS+
Sbjct: 7  LTHYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSD 65

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 3/61 (4%)

Query: 5   NPYDILGVDRDSTDDEIRKAYRKLALKFHPD---KVIDPEEKASNEMKFKEITTAYEILS 61
           N Y ILG+  +++D EIRKAY  L  K+HPD   K +  EE+  N+ K  EI  AYE+L+
Sbjct: 541 NYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLN 600

Query: 62  N 62
           +
Sbjct: 601 D 601

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILGV  +++ +EIRK+Y KLA K HPDK    + + + E+ FK +  A+ IL+N
Sbjct: 14 YSILGVPTNASTNEIRKSYMKLAKKLHPDKT---KSEHTAEL-FKLVVDAHSILNN 65

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+ILGVD  ST  EI+KAY++  L  HPDK    E   +  +  +EI  AY++L N
Sbjct: 8  YEILGVDTKSTVAEIKKAYKEKLLCTHPDKNRTVE---AQNVSIEEIKEAYQVLVN 60

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 4/54 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEIL 60
          Y +LG+  D+++ +I+KAYR++A+  HPDK     + AS    FK ++ A  +L
Sbjct: 14 YSVLGLKSDASESQIKKAYRRIAMAIHPDK----NKSASAAEMFKLVSHAQSVL 63

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y+ILGV   +T  EI+KAYRK +++ HPDK  + ++  + E +F+ I+ AY++LS+
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDK--NRDDPMATE-RFQAISEAYQVLSD 60

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDK--VIDPEEKASNEMKFKEITTAYEILSN 62
           Y IL + +++   EIRKAY      +HPDK   +  E++  N+ K  EI  AYE LS+
Sbjct: 477 YKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSD 534

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 10/67 (14%)

Query: 3  KLNPYDILGVDRDSTDD-------EIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITT 55
          ++N Y +LG    S D        ++RK YRKLAL++HPDK  +P +  S   KF +++ 
Sbjct: 12 RVNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDK--NPHD-TSLIHKFHQVSV 68

Query: 56 AYEILSN 62
          A +ILS+
Sbjct: 69 ATKILSD 75

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y +LG+  D+TD +IRK+Y KLA + HPDK    + + + E+ FK +  A+ IL++
Sbjct: 14 YSVLGLPFDATDAQIRKSYMKLARELHPDKS---KSEVAAEL-FKVVAHAHSILTD 65

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62
          Y ILG+  ++TD EIRK+Y  LA K HPDK    + +A+ E+ FK +  A+ IL++
Sbjct: 15 YSILGLTPNATDIEIRKSYMNLARKLHPDK---SKSEATGEL-FKLVVHAHSILTD 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,312,635
Number of extensions: 2212708
Number of successful extensions: 4832
Number of sequences better than 10.0: 351
Number of HSP's gapped: 4590
Number of HSP's successfully gapped: 466
Length of query: 432
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 320
Effective length of database: 40,638,807
Effective search space: 13004418240
Effective search space used: 13004418240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)