Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020408.263ON59159131110.0
NCAS0B050208.263ON56855120690.0
Skud_12.1578.263ON59249020260.0
YLR089C (ALT1)8.263ON59249420220.0
TDEL0F039008.263ON55949720170.0
Smik_12.1488.263ON59249419960.0
Suva_10.1738.263ON59249119940.0
NDAI0B019908.263ON58849019880.0
CAGL0L12254g8.263ON57449719780.0
KAFR0B027308.263ON53949319400.0
SAKL0H17006g8.263ON53153019360.0
KLLA0F19162g8.263ON52848819260.0
ZYRO0C01628g8.263ON53448819190.0
Kpol_392.58.263ON51252018510.0
TPHA0J007508.263ON52249617880.0
NCAS0B038408.263ON49749017750.0
KLTH0G13662g8.263ON51952817750.0
KAFR0B055308.263ON51451117540.0
Skud_4.3728.263ON50749017380.0
YDR111C (ALT2)8.263ON50749017360.0
Kwal_56.237918.263ON51848217320.0
Smik_4.3578.263ON50749017220.0
Suva_2.2718.263ON50749017190.0
KNAG0M012108.263ON52149517120.0
KAFR0B05520singletonON51049317030.0
Ecym_43078.263ON53451316680.0
NDAI0J013608.263ON50149116580.0
TBLA0E044408.263ON56249616630.0
AGR085W8.263ON52149616540.0
TBLA0F030608.263ON50049616280.0
Kpol_543.398.263ON49249116250.0
TPHA0A018008.263ON49849816190.0
TBLA0G01630singletonON50049715710.0
ADL249W2.252ON3871871125e-05
Kpol_1039.222.252ON3862661081e-04
Kwal_34.160181.472ON3791691027e-04
KLTH0G09614g2.252ON3891031000.001
SAKL0E08492g2.252ON384127970.003
KNAG0E018502.252ON384112950.005
KLLA0F03509g2.252ON387148950.006
Suva_6.1361.321ON444187950.006
Kwal_23.48882.252ON389116920.013
ZYRO0A01672g2.252ON386105910.017
NDAI0B045502.102ON565172910.022
TDEL0C040902.252ON383100890.028
TPHA0O014501.321ON443183890.029
Ecym_32902.252ON386127880.036
NDAI0B037302.252ON386106880.041
KNAG0B053201.321ON433171870.050
Kpol_1035.231.321ON444140870.051
CAGL0J05126g1.321ON433357860.066
TPHA0F012602.252ON392149840.11
Ecym_6319singletonON354299840.12
KAFR0J015802.252ON383100830.18
Smik_9.532.252ON388129820.25
NCAS0B064402.252ON38596810.26
Kpol_431.132.475ON443434810.28
YIL116W (HIS5)2.252ON385101810.30
YJL060W (BNA3)1.321ON444187800.43
KLTH0G19646g1.472ON379122790.43
Ecym_62921.321ON430329780.63
Skud_10.1561.321ON460140780.66
TDEL0D019001.321ON443170780.67
Skud_9.552.252ON385103770.76
Suva_9.782.252ON386106770.83
KAFR0A017101.321ON435182751.4
SAKL0H21824gna 1ON499122751.5
KLLA0F10021g3.511ON497325751.6
NCAS0A092001.321ON445141751.6
NDAI0G057601.321ON448187751.8
CAGL0C01243g2.252ON383100742.0
NCAS0B060802.324ON649119752.0
SAKL0F02156g3.511ON498124742.2
KAFR0D014203.511ON492327742.3
AEL170C1.321ON458238732.5
ZYRO0G20636g1.321ON453132732.7
TDEL0E003802.3ON50559732.8
Smik_10.1801.321ON444145733.1
Kwal_14.25741.321ON44368723.2
NCAS0F025905.302ON61097723.9
KNAG0B006603.511ON496135724.2
KLTH0H10648g1.321ON443185715.0
SAKL0D06886g1.321ON447192706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02040
         (591 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...  1202   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   801   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   785   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   783   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   781   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   773   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   772   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   770   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   766   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   751   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   750   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   746   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   743   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   717   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   693   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   688   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   688   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            680   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   674   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   673   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   671   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   667   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   666   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   664   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   660   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   647   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   643   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   645   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   641   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   631   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   630   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   628   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              609   0.0  
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    48   5e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    46   1e-04
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    44   7e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    43   0.001
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.003
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    41   0.005
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    41   0.006
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    41   0.006
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    40   0.013
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.017
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    40   0.022
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    39   0.028
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    39   0.029
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    39   0.036
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    39   0.041
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    38   0.050
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    38   0.051
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    38   0.066
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    37   0.11 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    37   0.12 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.18 
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    36   0.25 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    36   0.26 
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    36   0.28 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    36   0.30 
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    35   0.43 
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    35   0.43 
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    35   0.63 
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    35   0.66 
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    35   0.67 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    34   0.76 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    34   0.83 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    33   1.4  
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    33   1.5  
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    33   1.6  
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    33   1.6  
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    33   1.8  
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    33   2.0  
NCAS0B06080 Chr2 complement(1149292..1151241) [1950 bp, 649 aa] ...    33   2.0  
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    33   2.2  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    33   2.3  
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    33   2.5  
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    33   2.7  
TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}...    33   2.8  
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    33   3.1  
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    32   3.2  
NCAS0F02590 Chr6 (522244..524076) [1833 bp, 610 aa] {ON} Anc_5.3...    32   3.9  
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    32   4.2  
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    32   5.0  
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    32   6.4  

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/591 (97%), Positives = 578/591 (97%)

Query: 1   MLAARPYSTKMSVVYRGGGSLNSTTKRFFLTTSQKMAPSVILRQQPNDLIIQPYQHFDIG 60
           MLAARPYSTKMSVVYRGGGSLNSTTKRFFLTTSQKMAPSVILRQQPNDLIIQPYQHFDIG
Sbjct: 1   MLAARPYSTKMSVVYRGGGSLNSTTKRFFLTTSQKMAPSVILRQQPNDLIIQPYQHFDIG 60

Query: 61  PKPSLIISRKFSASENIKMPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKA 120
           PKPSLIISRKFSASENIKMPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKA
Sbjct: 61  PKPSLIISRKFSASENIKMPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKA 120

Query: 121 KYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFP 180
           KYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFP
Sbjct: 121 KYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFP 180

Query: 181 ELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRD 240
           ELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRD
Sbjct: 181 ELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRD 240

Query: 241 NNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYY 300
           NNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYY
Sbjct: 241 NNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYY 300

Query: 301 LDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYG 360
           LDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLS             YG
Sbjct: 301 LDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSEKAIAEIFEIAAKYG 360

Query: 361 IVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQR 420
           IVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQR
Sbjct: 361 IVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQR 420

Query: 421 GGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIH 480
           GGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIH
Sbjct: 421 GGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIH 480

Query: 481 SELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKEL 540
           SELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKEL
Sbjct: 481 SELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKEL 540

Query: 541 LENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591
           LENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD
Sbjct: 541 LENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/551 (70%), Positives = 446/551 (80%), Gaps = 27/551 (4%)

Query: 66  IISRKFSASE-----NIKMPHAVKRQRKPAKDQLHSK--------------------SHY 100
           I++R +S +      N KMPH ++    P      +K                    +H 
Sbjct: 20  ILTRTYSVNLTNNKFNNKMPHFMEPSTSPQYPYFETKRTISSAATKLKTKPKPTTKKNHN 79

Query: 101 KFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQ 160
            F PA Q+ +A+LN+NVLKAKYAVRG+IPMRAE+L+ QLQEDP SLPFD I+NANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 161 QLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYS 220
           QLNQKPLSFYRQVLSLLQ+PE+L    E+   A+ L+K DA+ RA+ LL +IGG+VGAYS
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQ-DESKLVASGLFKKDALERAKTLLHEIGGTVGAYS 198

Query: 221 TSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIP 280
            SQGV GIRKTVA+FIT+RDN EPAYPEDIFLTAGASAAV YLLSI CKG +TGVLIPIP
Sbjct: 199 ASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIP 258

Query: 281 QYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPT 340
           QYPLYTA+LALNNSH LPYYLDEKSGWSTN KEI+ VVL A D+ I+PSVLVVINPGNPT
Sbjct: 259 QYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPT 318

Query: 341 GAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDE 400
           GAVLS             YGIVVIADEVYQEN+F+E VKFHSMKKVLR LQ++HPG +D 
Sbjct: 319 GAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNE-VKFHSMKKVLRNLQKKHPGVYDM 377

Query: 401 VQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVH 460
           VQLASLHSTSKGVSGECGQRGG+MELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437

Query: 461 PPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFK 520
           PP++G+ES+E DQAER HI SELH RA +L++ FN LEGI+CQKPQGAMYLFPRL+LPFK
Sbjct: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497

Query: 521 AVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEK 580
           AVQKAQH+EM+ DEFYCK LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI+ W+ 
Sbjct: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557

Query: 581 FHKEFYNKYRD 591
           FH++FYN YRD
Sbjct: 558 FHQDFYNTYRD 568

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/490 (75%), Positives = 426/490 (86%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPFDKIINANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+EDIGGSVGAYS+
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIRK+VA+FIT+RD+ E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTATLALNNS  LPYYLDE+SGWSTN +EI++VV +AI   IKP+VLVVINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVLS             YG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGKFD V
Sbjct: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRTLQREHPGKFDNV 402

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDLMV P
Sbjct: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           P EGEES+ELDQAER+ IH +L  RA  L++TFN LEGI+CQKPQGAMYLFP+++LPFKA
Sbjct: 463 PVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKA 522

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           VQ+A+H+E+T DEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  WE F
Sbjct: 523 VQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETF 582

Query: 582 HKEFYNKYRD 591
           HKEF+++YRD
Sbjct: 583 HKEFFDQYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/494 (75%), Positives = 427/494 (86%), Gaps = 2/494 (0%)

Query: 98  SHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIG 157
           S+ +F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPFD+IINANIG
Sbjct: 101 SNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIG 160

Query: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217
           NPQQL QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+EDIGGSVG
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277
           AYS+SQGV GIRK+VA+FIT+RD  E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337
           PIPQYPLYTATLALNNS  LPYYLDE SGWSTN +EI++VV +AI   IKP+VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 338 NPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGK 397
           NPTGAVLS             YG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGK
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQREHPGK 398

Query: 398 FDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDL 457
           FD VQLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDL
Sbjct: 399 FDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDL 458

Query: 458 MVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNL 517
           MV PP EGEES+E DQAER+ IH +L  RA  L+ETFN LEGI+CQKPQGAMYLFP+++L
Sbjct: 459 MVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDL 518

Query: 518 PFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDL 577
           PFKAVQ+A+H+E+T DEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  
Sbjct: 519 PFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKK 578

Query: 578 WEKFHKEFYNKYRD 591
           WE FHKEF+++YRD
Sbjct: 579 WESFHKEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/497 (74%), Positives = 421/497 (84%), Gaps = 2/497 (0%)

Query: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154
           H K H  F PA  + + DLNENVLKAKYAVRGSIPMRAE+LQ QL+ DP SLPFDKI+NA
Sbjct: 65  HKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNA 124

Query: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214
           NIGNPQQLNQKPLSFYRQVLS+LQ+PE+L   +E    +  ++K DA+ RA+++L D+GG
Sbjct: 125 NIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEE-LISKGVFKRDAIERAKRILRDVGG 183

Query: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274
           SVGAYS+SQGV GIRKTVADFIT RD+ EPAYPEDIFLTAGASAAVSYLLSI C+G++TG
Sbjct: 184 SVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETG 243

Query: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334
           VLIPIPQYPLYTATLALNNSH LPYYLDE+SGWSTNT EI+ VV ++I+  I+PSVLVVI
Sbjct: 244 VLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVI 303

Query: 335 NPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394
           NPGNPTG+VLS             YGIVVIADEVYQENIF    +FHSMKKVLR+LQ+EH
Sbjct: 304 NPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIF-AGSEFHSMKKVLRQLQKEH 362

Query: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454
           PG +D VQL SLHSTSKGVSGECGQRGG+MELTGF+HEIRQV+LKLASISLCPVVTGQAL
Sbjct: 363 PGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQAL 422

Query: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514
           VDLMV PP+ G+ESYE D+ ER  IH EL  RA  L +TFN LEGI+CQKP+GAMYLFP+
Sbjct: 423 VDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQ 482

Query: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574
           + LP+KA+Q AQH+E T DEFYC++LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEW
Sbjct: 483 IKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEW 542

Query: 575 IDLWEKFHKEFYNKYRD 591
           I  WE FHK+FY++YRD
Sbjct: 543 IKKWEDFHKKFYDQYRD 559

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/494 (74%), Positives = 426/494 (86%), Gaps = 2/494 (0%)

Query: 98  SHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIG 157
           S+ +F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPF+KIINANIG
Sbjct: 101 SNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIG 160

Query: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217
           NPQQL QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+E+IGGSVG
Sbjct: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEEIGGSVG 219

Query: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277
           AYS+SQGV GIR++VA+FIT+RD  E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLI
Sbjct: 220 AYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337
           PIPQYPLYTATLALNNS  LPYYLDE SGWSTN +EI++VV +AI+  IK +VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPG 339

Query: 338 NPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGK 397
           NPTGAVLS             YG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGK
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQREHPGK 398

Query: 398 FDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDL 457
           FD VQLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDL
Sbjct: 399 FDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDL 458

Query: 458 MVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNL 517
           MV PP EGEES+E DQAER+ IH +L  RA  L++TFN LEGI+CQKPQGAMYLFP+++L
Sbjct: 459 MVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDL 518

Query: 518 PFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDL 577
           PF+AVQ+A+H+E+T DEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  
Sbjct: 519 PFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKK 578

Query: 578 WEKFHKEFYNKYRD 591
           WE FHKEF++ YRD
Sbjct: 579 WETFHKEFFDHYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/491 (74%), Positives = 425/491 (86%), Gaps = 2/491 (0%)

Query: 101 KFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQ 160
           +F PA Q+ + D+NENVLKA+YAVRG+IPMRAE+L+ QL++DP+SLPF+KIINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 161 QLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYS 220
           QL QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L++DIGGSVGAYS
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222

Query: 221 TSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIP 280
           +SQGV GIRK+VADFIT+RD  E AYPEDIFLTAGASAAV+YLLSIFC+G +TGVLIPIP
Sbjct: 223 SSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIP 282

Query: 281 QYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPT 340
           QYPLYTATLALNNS  LPYYLDE SGWSTN +EI++VV +AI   IKP+VLVVINPGNPT
Sbjct: 283 QYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342

Query: 341 GAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDE 400
           GAVLS             YG VVIADEVYQENIF    +F+SMKKVLR LQ++HPGKFD 
Sbjct: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTEFNSMKKVLRHLQRDHPGKFDN 401

Query: 401 VQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVH 460
           VQLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 461 PPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFK 520
           PP EGEES+E DQ+ER+ IH +L+ RA  L+ETFN LEGI+CQKPQGAMYLFP++++PFK
Sbjct: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521

Query: 521 AVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEK 580
           A+Q+A H+E+T DEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EW+  WE 
Sbjct: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581

Query: 581 FHKEFYNKYRD 591
           FHKEF+++YRD
Sbjct: 582 FHKEFFDQYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/490 (75%), Positives = 413/490 (84%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA Q+ +ADLNENVLKAKYAVRGSIPMRAE+L+ QL+ +P +LPF +I+NANIGNPQQ
Sbjct: 101 FAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ 160

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L QKPLSFYRQVLS+LQ+P++L   ++N   A  +YK DA+ RA+ LL +IGGSVGAYS 
Sbjct: 161 LKQKPLSFYRQVLSILQYPDILKENEQNLIDA-KVYKRDAIDRAKLLLSEIGGSVGAYSA 219

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIRKTVA+FIT RD  EPAYPEDIFLT        YLLSI C+G KTGVLIPIPQ
Sbjct: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTATLALNNSH LPYYLDEKSGWSTN KEI+ VV DA++R I PSVLVVINPGNPTG
Sbjct: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVL+             YGIVVIADEVYQENI D  VKF+SMKKVLRKLQ+ HPGKFD V
Sbjct: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD-GVKFYSMKKVLRKLQKSHPGKFDNV 398

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHSTSKGVSGECGQRGG+MEL GF+HE+R+VILKLASISLCPVVTGQALVDLMV P
Sbjct: 399 QLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSP 458

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           P++G+ SYE DQAER HI SEL  RA++L+ETF  LEGI+CQKPQGAMYLFP+L+LPFKA
Sbjct: 459 PKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKA 518

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           VQ+AQH+EMT DEFYCK LL+ TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI  WE F
Sbjct: 519 VQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAF 578

Query: 582 HKEFYNKYRD 591
           HKEFY+ YRD
Sbjct: 579 HKEFYDNYRD 588

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/497 (72%), Positives = 424/497 (85%), Gaps = 4/497 (0%)

Query: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154
           HS ++  F PA Q  + D+NE VL AKYAVRG+IPMRAE+L+ QL E+P SLPF+ IINA
Sbjct: 82  HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINA 141

Query: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214
           NIGNPQQL QKPLSFYRQVLSLLQ+PEL+ +L+ NP    ++ K DA+ RA++LL+DIGG
Sbjct: 142 NIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQ---TMIKQDAIDRAKRLLDDIGG 198

Query: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274
           SVGAYS+SQGV+GIRKTVADFIT RD+   AYPEDIFLTAGAS+AV YLLSIFC+GE+TG
Sbjct: 199 SVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETG 258

Query: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334
           VLIPIPQYPLYTATLAL NSH LPYYL+E++GWST+ +E++S++LD+I+ NIKPSVLVVI
Sbjct: 259 VLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVI 318

Query: 335 NPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394
           NPGNPTGAVLS             YGI+VIADEVYQEN+F EDVKFHSMKKVLR+LQ + 
Sbjct: 319 NPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF-EDVKFHSMKKVLRQLQMKQ 377

Query: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454
           PG +D VQLASLHSTSKGVSGECGQRGG+MEL GF+H+IRQV+LKLASISLCPVVTGQAL
Sbjct: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437

Query: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514
           VDLMV PPQ+GEESYE DQ ER +IH ELHKRA  L + F +L+GI CQKPQGAMYLFP+
Sbjct: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497

Query: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574
           L LP+KA+Q+A H +M+ DEFYCK LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGT+W
Sbjct: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557

Query: 575 IDLWEKFHKEFYNKYRD 591
           I+ W  FH+EFYNK+++
Sbjct: 558 IEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/493 (74%), Positives = 419/493 (84%), Gaps = 2/493 (0%)

Query: 97  KSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANI 156
           K +  F PA Q+ I DLNENVLKAKYAVRG IP RAE+L+ QL E P SLPFDKIINANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 157 GNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSV 216
           GNPQQL Q+PLSFYRQVLSLLQ+P LL++++  P + +++YK DA+ RA+K+L+DIGGSV
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGS-SAVYKKDAILRAKKILKDIGGSV 165

Query: 217 GAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVL 276
           GAYS SQGV GIR+TVA+FIT RD  EPAYPEDIFLTAGASAAV+YLLSI CKGEKTGVL
Sbjct: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225

Query: 277 IPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINP 336
           IPIPQYPLYTATLALNNSH LPY+LDE +GWS N  EI++V+  A+  NIKP VLVVINP
Sbjct: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285

Query: 337 GNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPG 396
           GNPTGAVLS             YGIVVIADEVYQENIFD  +KFHS+K VLR+LQ+E PG
Sbjct: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD-GMKFHSVKGVLRRLQREIPG 344

Query: 397 KFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVD 456
           KFD VQLASLHSTSKGVSGECGQRGG+ME+ GF+HE+RQVILKLASISLCPVVTGQALVD
Sbjct: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404

Query: 457 LMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLN 516
           LMV PP+ GEES+ LDQA+R  IHS+L +RA  LW+TFN L+GI+CQKP GAMYLFP+LN
Sbjct: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464

Query: 517 LPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWID 576
           LP++A+Q+AQ +E++ DEFYCKELLE+TGICTVPGSGFGQV GTYHLRTTFLAPG EWID
Sbjct: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524

Query: 577 LWEKFHKEFYNKY 589
            W++FH EF  KY
Sbjct: 525 SWKQFHIEFMEKY 537

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/530 (68%), Positives = 429/530 (80%), Gaps = 8/530 (1%)

Query: 63  PSLIISRKFSASENIK-MPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAK 121
           PSL + R  +A    K MPH+    R  + + +     YKF PA ++ + DLNENVL+AK
Sbjct: 9   PSLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVP----YKFQPADKLSLEDLNENVLRAK 64

Query: 122 YAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPE 181
           YAVRG IP +AE+L++QL  DP+SLPFD+IINANIGNPQQL+QKPL+FYRQVLSLLQ P+
Sbjct: 65  YAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPD 124

Query: 182 LLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDN 241
           +L  +       + +YK DA+ RA +LL +IGGSVGAYS SQGV G RKTVADFIT+RD 
Sbjct: 125 MLEEIPRE--QLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDG 182

Query: 242 NEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYL 301
            E AY EDIFLTAGASAAVSY+LSI C+G +TGVLIPIPQYPLYTA+LALNNSH LPYYL
Sbjct: 183 GEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYL 242

Query: 302 DEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGI 361
           DE+S WSTN +EI+ VV ++I + ++P  LVVINPGNPTGA+LS             YGI
Sbjct: 243 DEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGI 302

Query: 362 VVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRG 421
           VVIADEVYQEN+F+   +FHSM+KVL+ LQ++H GKFD +QLASLHSTSKGVSGECGQRG
Sbjct: 303 VVIADEVYQENVFN-GAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRG 361

Query: 422 GFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHS 481
           G+MEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP+ G+ SYE DQ ERS IH 
Sbjct: 362 GYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHD 421

Query: 482 ELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELL 541
            L  RA+ L+ETFNRLEGI+CQKPQGAMYLFPRL+L +KAVQKA+H+ ++ DEFYC+ELL
Sbjct: 422 ALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELL 481

Query: 542 ENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591
           E TGICTVPGSGFGQVPGTYHLRTTFLAPGT+WI  WE+FHK+FYN+YRD
Sbjct: 482 EATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/488 (71%), Positives = 414/488 (84%), Gaps = 4/488 (0%)

Query: 104 PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163
           PA ++ + D+NENVLKAKYAVRG IPMRAE+L+ QL++DP SLPF KII+ANIGNPQQL+
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 164 QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223
           QKPL+FYR+VLSLLQ PELL    E   A  +LYK D+++RA++LL ++GGSVGAYS SQ
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADE---ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQ 161

Query: 224 GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283
           GV GIR+TVADFIT+RD+ E +YPEDI+LTAGASAAVSY+LSI CKG  TGVLIPIPQYP
Sbjct: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221

Query: 284 LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343
           LYTA+LALNNS  LPYYL E+  WST+ +EI+ VVLDAI + IKP+ LVVINPGNPTGA+
Sbjct: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281

Query: 344 LSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403
           LS             YGIVVIADEVYQEN+F +  KF+SMKKVLR LQ+ + G++D +QL
Sbjct: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVF-KGSKFYSMKKVLRNLQKTYHGQYDNIQL 340

Query: 404 ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463
           ASLHSTSKGVSGECGQRGG+MEL GF+H+IRQV LKLASISLCPVVTGQALVDLMV PPQ
Sbjct: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400

Query: 464 EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523
            G+ESYE DQ ER  IH  L +RA+KL+ETF+RLEGI+C+KPQGAMYL+P+L+LP+K +Q
Sbjct: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460

Query: 524 KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583
           +AQH+EM  DEFYCK LLENTGICTVPGSGFGQVPGTYHLRTTFL PGTEW++ WEKFHK
Sbjct: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520

Query: 584 EFYNKYRD 591
            F++KYRD
Sbjct: 521 AFFDKYRD 528

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/488 (73%), Positives = 406/488 (83%), Gaps = 2/488 (0%)

Query: 104 PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163
           PA ++ ++++NENVLKAKYAVRG+IPM A +L  +L++DP SLPFD I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 164 QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223
           QKPL+FYRQVLSLLQ+P LL    E     + LY+ DA+ RA +LL DIG SVGAYSTSQ
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEE-NEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167

Query: 224 GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283
           G+ GIR+TVA FIT RD  E AY EDIFLTAGAS+AVSYLLSI CKG++TGVLIPIPQYP
Sbjct: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227

Query: 284 LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343
           LYTA+LALNNSH LPYYLDEKSGWSTN  EI+ VV +AI++NIKPSVLVVINPGNPTGAV
Sbjct: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287

Query: 344 LSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403
           LS             YGIVVIADEVYQEN+FD   +FHSMKK+LRKLQ+ +PG FD VQL
Sbjct: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFD-GAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 404 ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463
           ASLHSTSKGVSGECGQRGG+ME+TGF+++IRQVILKLASISLCPVVTGQALVDLMV PP+
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 464 EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523
            G+ESYELDQ ER  IH  L +RA KL  TFN LEGI+CQKP+GAMYLFPRL LPFKA+Q
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 524 KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583
            A+H  MT D FYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI+ WE FHK
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 584 EFYNKYRD 591
            FY +YRD
Sbjct: 527 AFYEEYRD 534

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/520 (66%), Positives = 417/520 (80%), Gaps = 11/520 (2%)

Query: 72  SASENIKMPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMR 131
           S + +I +   V  +R      L+   H  + PA ++++ DLN+NVLKAKYAVRGSIP+R
Sbjct: 4   SGNCSISLVRRVGVRRLTLSTTLYEHKHNVY-PAQKLRMDDLNKNVLKAKYAVRGSIPLR 62

Query: 132 AEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPA 191
           AE+L+  L E  + LPFD +INANIGNPQQL QKPL+FYRQVLS+LQ+PELL S      
Sbjct: 63  AEELKLYL-EAGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLES------ 115

Query: 192 AATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIF 251
             ++++K DA+ RA KLL++IG SVG+YS+SQG+  IRKTVA+FIT+RD+ E + P DIF
Sbjct: 116 -GSNIFKKDAIERARKLLKEIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIF 173

Query: 252 LTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNT 311
           LTAGAS+AV YLLSI CK EK+GVLIPIPQYPLYTATLALNN+H LPYYLDE  GWST+ 
Sbjct: 174 LTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDI 233

Query: 312 KEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQE 371
            EI+ V+ D++D+ IKP+ LV+INPGNPTG++LS             +GIV+IADEVYQE
Sbjct: 234 NEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQE 293

Query: 372 NIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSH 431
           N+F+ + KFHSMKKVLR LQ+  PG++D VQLASLHSTSKGVSGECGQRGG+MELTGF+ 
Sbjct: 294 NVFN-NAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNP 352

Query: 432 EIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLW 491
           EI+QVILKL SISLCPVVTGQALVDLMV PPQ+G+ESYE DQ ERS I ++L  RA  LW
Sbjct: 353 EIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLW 412

Query: 492 ETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPG 551
           E FN +EG+ CQKP+GAMYLFP+++LPFK +QK+Q +++T DEFYCK LLE TGICTVPG
Sbjct: 413 EAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPG 472

Query: 552 SGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591
           SGFGQ PGTYHLRTTFLAPGTEWID W KFH EFY+KYRD
Sbjct: 473 SGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/496 (68%), Positives = 405/496 (81%), Gaps = 3/496 (0%)

Query: 96  SKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINAN 155
           S  H  F PA ++ I DLNENVLKAKYAVRG IP RAE L+ QL ++P SLPF K+INAN
Sbjct: 30  SLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINAN 89

Query: 156 IGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGS 215
           IGNPQQLNQKPL+FYRQVLSLLQ+P +L+  +       +LYK DA+ RA+++L DIG S
Sbjct: 90  IGNPQQLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKTLYKQDAIERAKRILNDIGSS 147

Query: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGV 275
           VG+YS+SQGV G+RKTVA++I+RRD  E AY EDIFLTAGAS+AVSYLL+I CKG+++GV
Sbjct: 148 VGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGV 207

Query: 276 LIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVIN 335
           LIPIPQYPLYTATLALNN++ LPYYL+E SGWSTN +EI++VV +AI   I P VLVVIN
Sbjct: 208 LIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVIN 267

Query: 336 PGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP 395
           PGNPTGA+LS             +GIVVIADEVYQENIF  + +FHSMKKVLR LQ+  P
Sbjct: 268 PGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGN-EFHSMKKVLRDLQRRVP 326

Query: 396 GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALV 455
           GK++ VQLASLHSTSKGVSGECGQRGG+MELTGFS EI+  ILKL SISLCPVVTGQALV
Sbjct: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386

Query: 456 DLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRL 515
           DLM  PP++GE SYE DQ ERS IHSEL++RA  LW+ FN +EG+ CQKPQG+MYLFP++
Sbjct: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446

Query: 516 NLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWI 575
           ++P KA++KAQ +++T DE YC ELLE TGICTVPGSGFGQ PGT+HLRTTFLAPGT WI
Sbjct: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506

Query: 576 DLWEKFHKEFYNKYRD 591
           D W +FH+ F NKYRD
Sbjct: 507 DQWREFHQIFCNKYRD 522

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 396/490 (80%), Gaps = 3/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA ++ + D+NENV+ AK+A+RGSI ++AE LQ QL ++P  LPFD+I  ANIGNPQ+
Sbjct: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           LNQKPL+F RQV+S+LQ+PELLN+   +      ++ +D+  RAE+LL DIGGSVGAYS 
Sbjct: 71  LNQKPLTFARQVVSILQYPELLNN--RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIRKT A++IT+RD  EP+YPEDIFLT GA++A SYLLS+ C+G +TGVLIPIPQ
Sbjct: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTATLALN S  +PYYLDE+S WSTNT EI+ +VLD+I + IKPSV+VVINPGNPTG
Sbjct: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVLS             YGIVV+ADEVYQENIFD  V+FHS KKVLR LQ+++PGKFD +
Sbjct: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFD-GVQFHSTKKVLRGLQKQYPGKFDNI 307

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLAS+HSTSKGV GECGQRGG+MEL GF+ E+RQ++LKLA +++C VVTGQA+VDLM+ P
Sbjct: 308 QLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLP 367

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           P++G+ SYELD+ ER  I   +++RA KL+  F++L+GI+CQKPQGAMYL+P L L  KA
Sbjct: 368 PKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKA 427

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           + KA+ + +T DEFYC ELL+ TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ WEKF
Sbjct: 428 IAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKF 487

Query: 582 HKEFYNKYRD 591
           HK FY KY+D
Sbjct: 488 HKHFYEKYQD 497

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/528 (63%), Positives = 414/528 (78%), Gaps = 10/528 (1%)

Query: 65  LIISRKFSASENIKMPHA-VKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYA 123
           +++SR+ + +    MPH+ +  +R  AK  + S    K    ++  + D+N+ VL AKYA
Sbjct: 1   MMLSRQLTRT----MPHSRLILRRLSAKAAVKSDLSQKAL-GSKKTLRDVNQCVLNAKYA 55

Query: 124 VRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELL 183
           VRG IP+RAE+L+H+L E+P SLPF+KIINANIGNPQQL+QKPL+FYRQVLSLLQ P L+
Sbjct: 56  VRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALI 115

Query: 184 NSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNE 243
            SL         L+K DAV RA+K+L+ +GGSVGAYS SQGV G R++VA+FI  RD  E
Sbjct: 116 ESLPT--GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-E 172

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDE 303
           PA   DIFLTAGAS+AVS +LS+FC G + G LIPIPQYPLYTATLALN++H LPYYLDE
Sbjct: 173 PASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDE 232

Query: 304 KSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVV 363
            SGWS +T++++ VV DAI + ++P+ LVVINPGNPTGA+LS             Y +VV
Sbjct: 233 ASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVV 292

Query: 364 IADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGF 423
           IADEVYQEN FD D  F SMKKVLR LQ+  PGK+D VQLASLHSTSKGVSGECGQRGG+
Sbjct: 293 IADEVYQENGFD-DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGY 351

Query: 424 MELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSEL 483
           MEL GFS E++QV LKLASISLCPVVTGQALVDLMV PP++G+ SYELD+ ER+ IH+ L
Sbjct: 352 MELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSL 411

Query: 484 HKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLEN 543
           H+++  L+ETF  LEG+ CQKPQGAMYLFP+L+L  KA++KA+ + M  DE+YCKELLE 
Sbjct: 412 HQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEA 471

Query: 544 TGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591
           TGICTVPGSGF QVPGTYHLRTTFLAPGTEW+D W+KFH++F +++RD
Sbjct: 472 TGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/511 (63%), Positives = 402/511 (78%), Gaps = 6/511 (1%)

Query: 82  AVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQL-- 139
           A   Q  P +  L   + + F PA ++ + DLN+NVLK++YAVRGSIP RAE+L+ +L  
Sbjct: 8   AATTQYFPVRKALDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLN 67

Query: 140 QEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKA 199
            +   SL F+ I++ANIGNPQQL+QKPL+F RQV+S+LQ+PELLN  + N   +T ++K+
Sbjct: 68  NDSSDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLN--QRNILVSTGIFKS 125

Query: 200 DAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAA 259
           DA+ RAE LL  IGGSVGAYS+SQGV GIR+TVA++IT RDN E A P+DIFLT GAS A
Sbjct: 126 DAMERAETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKA 185

Query: 260 VSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVL 319
            SYLLS+ CK + TGVLIPIPQYPLYTAT+ L ++  LPYYL+E+SGWSTNT EI+ VVL
Sbjct: 186 ASYLLSLLCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVL 245

Query: 320 DAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVK 379
           DAI  N+KPSV+VVINPGNPTG+VLS             YGIV+IADEVYQENIFD +  
Sbjct: 246 DAIADNVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDGE-- 303

Query: 380 FHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILK 439
           FHSMKKVLR LQ+++PGK+D VQLASLHSTSKGVSGECGQRGG+MEL GF  EIRQ ILK
Sbjct: 304 FHSMKKVLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILK 363

Query: 440 LASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEG 499
           LASISLC V+TGQALVDLMV+PP++G+ESYELD  ER +IH  L +RA KL+  F +L+G
Sbjct: 364 LASISLCSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKG 423

Query: 500 IQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPG 559
           ++CQKPQGAMYLFP+L+ P   + +A +  M+ DEFYC  LLE TGICTVPGSGFGQ  G
Sbjct: 424 VECQKPQGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEG 483

Query: 560 TYHLRTTFLAPGTEWIDLWEKFHKEFYNKYR 590
           TYHLRTTFLAPG +W + W+ FH+EF++KY+
Sbjct: 484 TYHLRTTFLAPGNQWTEKWKLFHEEFFSKYQ 514

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 391/490 (79%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PAA++   DLN +V KA+YAVRGSIP RA++L+ +L+++P  LPFD IINANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L+QKPL+F RQVLS+L++PE+L    E   A+ +L+  DA++RAE LL+DIGGSVGAYS 
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILQVDHEK-LASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIR+TVADFIT RD  EPA PEDI+LT GAS+A + LLS+ CK  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTA+ +L N+  LPYYLDE+  WST + EI+ VV DA+++ I+PSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVL+             YGI VI+DEVYQEN+F+ D KFHSMKKVLRKLQ  +PGKFD V
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFN-DFKFHSMKKVLRKLQHCYPGKFDNV 317

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C VVTGQA+VDLMV+P
Sbjct: 318 QLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNP 377

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           PQ G+ESYE D+ ERS I +E+  RAN L+ETFN LEGI+CQ PQGAMYLFPRL LP KA
Sbjct: 378 PQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKA 437

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
            ++++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W+ F
Sbjct: 438 FRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNF 497

Query: 582 HKEFYNKYRD 591
           H+ F+N+YRD
Sbjct: 498 HQSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/490 (64%), Positives = 389/490 (79%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA ++   DLN  V KA+YAVRG+IP RA++L+ +L+++P  LPFD IINANIGNPQQ
Sbjct: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L+QKPL+F RQVL++L++PE+L  +  N  A+ +L+  DA+ RAE+LL DIGGS+GAYS 
Sbjct: 80  LDQKPLTFTRQVLAILEYPEILR-VGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIR+TVADFITRRD  EPA PEDI+LT GAS+A + LLS+ CK  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTA+ +L N+  LPYYLDE+S WSTN+ EI+ VV DA+ + I+PSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVLS             YGI +I+DEVYQENIF+ DVKFHSMKKVLRKLQ  +PGKFD V
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFN-DVKFHSMKKVLRKLQHLYPGKFDNV 317

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHS SKG   ECGQRGG+ME+ GFS EIR  + KL SIS+C VVTGQA+VDLMV P
Sbjct: 318 QLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKP 377

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           PQ G+ESYE D  ER  I  E+  RAN L+ETF  LEGI+CQKPQGAMYLFPRL LP KA
Sbjct: 378 PQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKA 437

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           + +++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W++F
Sbjct: 438 LCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEF 497

Query: 582 HKEFYNKYRD 591
           H++F++KYR+
Sbjct: 498 HQDFFSKYRN 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/482 (65%), Positives = 386/482 (80%), Gaps = 4/482 (0%)

Query: 110 IADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSF 169
           + D+NE VL AKYAVRG IP+RAE+L+ +L E+P SLPFDKIINANIGNPQQL+QKPL+F
Sbjct: 41  LQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTF 100

Query: 170 YRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIR 229
           YRQVL+LLQ P+L++ L  +       +K DAV RA+K+L+ +GGSVGAYS SQGV G R
Sbjct: 101 YRQVLALLQNPDLISDL--SSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFR 158

Query: 230 KTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATL 289
           ++VA+FI  RD  EPA  +DIFLT GAS AVSY+LS+FC G + G LIPIPQYPLYTA+L
Sbjct: 159 ESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASL 217

Query: 290 ALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXX 349
           ALNNSH LPYYLDE+SGWS +T++I+ VV D+I + I+P+ LVVINPGNPTGA+L+    
Sbjct: 218 ALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTI 277

Query: 350 XXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHST 409
                    Y +V+IADEVYQEN F+ D +F SMKKVLR LQ+  PGK+D VQLASLHST
Sbjct: 278 ENVIKVAAKYSMVIIADEVYQENGFN-DAEFVSMKKVLRVLQKTEPGKYDNVQLASLHST 336

Query: 410 SKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESY 469
           SKGVSGECGQRGG+MEL GFS E++QV LKLASISLCPVVTGQAL+DLMV PP++G+ SY
Sbjct: 337 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASY 396

Query: 470 ELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHME 529
           E D+ ER  IH  LHKR+  L++ F  +EG+ CQ+PQGAMYLFP+L L  KA+ KA+   
Sbjct: 397 EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAG 456

Query: 530 MTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKY 589
           +  DE+YCKELLE TGICTVPGSGFGQVPGT+HLRTTFLAPGTEWID W+KFH++F   +
Sbjct: 457 LAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDH 516

Query: 590 RD 591
           RD
Sbjct: 517 RD 518

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/490 (64%), Positives = 391/490 (79%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PAA++   DLN  V KA+YAVRG+IP RA++L+ +L+  P  LPFD IINANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L+QKPL+F RQVLS+L++PE+L  +  +  A+ +L++ DA+ RAE LLEDIGGS+GAYS 
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILR-VGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIR++VA+FIT+RD+ EPA PE+I+LT GAS+A + LLS+ CK  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQ 198

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTA+ +L N+  LPYYLDE S WST + EI+ VV DA+++ IKPSVL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVLS             YGI +I+DEVYQEN+F+  VKFHSMKKVLRKLQ+ +PGKFD V
Sbjct: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFN-GVKFHSMKKVLRKLQRLYPGKFDNV 317

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C VVTGQA+VDLMV P
Sbjct: 318 QLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKP 377

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           PQ G+ESY+ D +ER  I  E++ RA  L ETFN LEGI+CQKPQGAMYLFPRL LP KA
Sbjct: 378 PQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKA 437

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           +++++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W+ F
Sbjct: 438 LRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHF 497

Query: 582 HKEFYNKYRD 591
           H++F+NKYRD
Sbjct: 498 HQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 389/490 (79%), Gaps = 2/490 (0%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PAA++   DLN +V KA+YAVRG+IP RAE+L+ +L+    SLPF+ IINANIGNPQQ
Sbjct: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L+QKPL+F RQVLS+L++PE+L  +  +  A+ +L+  DA++RA++LL+DIGGSVGAYS 
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILR-VDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138

Query: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281
           SQGV GIR+TVADFIT RD  EPA PEDI+LT GAS+A + LLS+ CK  +TG+L+PIPQ
Sbjct: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQ 198

Query: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           YPLYTA+ +L N+  LPYYLDE++ WST + EI+ VVLDA+ + I+PSVLVVINPGNPTG
Sbjct: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401
           AVL+             YGI +I+DEVYQENIF  DVKFHSMKK+LRKLQ  HPGKFD V
Sbjct: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFG-DVKFHSMKKILRKLQNLHPGKFDNV 317

Query: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C V TGQA++DLMV P
Sbjct: 318 QLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKP 377

Query: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521
           PQ G+ESY+ D+ ER  I++E+  RAN L+ETFN LEGI+CQKPQGAMYLFP+L LP KA
Sbjct: 378 PQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKA 437

Query: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581
           +++++ + +  D  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI  W +F
Sbjct: 438 LRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQF 497

Query: 582 HKEFYNKYRD 591
           H++F+NKYRD
Sbjct: 498 HQDFFNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/495 (63%), Positives = 388/495 (78%), Gaps = 4/495 (0%)

Query: 98  SHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIG 157
           S   F PA ++   DLN+N++ A+YAVRG+IPM+AE+L+ QL + P  LPF+ I  ANIG
Sbjct: 30  SGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIG 89

Query: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217
           NPQQL+QKPL+F RQV+S+LQ+P LL+   E     +  YK DA +RA  LLE IGGSVG
Sbjct: 90  NPQQLDQKPLTFSRQVVSILQYPPLLD--YEEQLVTSGAYKRDAFKRAAVLLEQIGGSVG 147

Query: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277
           AYS +QGV GIR++VADFITRRD  E A P+DIFLT GAS A +YLLSI C+   TG++I
Sbjct: 148 AYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMI 207

Query: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337
           PIPQYPLYTA++ + NS  LPYYLDE+SGWST  +EI+  V+D+I R + P V+VVINPG
Sbjct: 208 PIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG 267

Query: 338 NPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP-G 396
           NPTGAVLS             YGIVV+ADEVYQ NI+ + VKFHSMKKVLR LQ++HP G
Sbjct: 268 NPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIY-KGVKFHSMKKVLRSLQRDHPNG 326

Query: 397 KFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVD 456
           ++D VQLAS+HSTSKGVSGECGQRGG+MEL GFS+E+RQVILKLASIS+C VVTGQALVD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 457 LMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLN 516
           LM++PP+EG++SYELD  ER  IH+ +  R   L++TF +LEGI+CQ+PQGAMYLFP+L 
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 517 LPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWID 576
           L  KA+++A+ + +  DEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFLAPGT+WI 
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 577 LWEKFHKEFYNKYRD 591
            WE FHK FY+KYRD
Sbjct: 507 DWETFHKAFYDKYRD 521

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/493 (62%), Positives = 396/493 (80%), Gaps = 6/493 (1%)

Query: 100 YKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQL--QEDPRSLPFDKIINANIG 157
           + F PA ++ +ADLN+ ++ A+YAVRGSI MRAE+L+ +L  +  P S PF++II ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217
           NPQQL+QKPL+F RQV+S+L++P LL    ++   +  +YK DA+ RAE L   IG SVG
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKF--KDVLLSQGIYKKDALERAELLQSQIGASVG 139

Query: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277
           AYS +QGV GIR+T A FI++RDN E A  +DIFLT GAS AV+YL+   C+ E TG+LI
Sbjct: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199

Query: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337
           PIPQYPLYTA++ ++N+  LPYYLDE+SGWST  +EI++ V++AI+  IKPS +VVINPG
Sbjct: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259

Query: 338 NPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGK 397
           NPTGAVLS             YGIV+IADEVYQ+NIF+ +  FHSMKK+LR+LQ+++PGK
Sbjct: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGE--FHSMKKILRQLQKKYPGK 317

Query: 398 FDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDL 457
           +D VQLASLHSTSKGVSGECGQRGG+ME+ GFS E+R ++LKLASI++C VVTGQALVDL
Sbjct: 318 YDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDL 377

Query: 458 MVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNL 517
           MV PP  G+ESYE DQ ER+ IHS L KRA+KL++TF+ LEGI+CQKPQGAMYLFPRL L
Sbjct: 378 MVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLIL 437

Query: 518 PFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDL 577
           P +A+++A+ ++M ADEFYC +LLENTGICTVPGSGFGQ  GTYH+RTTFL+PGTEWID 
Sbjct: 438 PDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDD 497

Query: 578 WEKFHKEFYNKYR 590
           W+KFH++F  +Y+
Sbjct: 498 WKKFHEKFMKEYQ 510

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/513 (60%), Positives = 383/513 (74%), Gaps = 9/513 (1%)

Query: 79  MPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQ 138
           +PHA    R  +       S  +F P   +K+ DLN NVL+AKYAVRG IP RA +L+ Q
Sbjct: 31  LPHATMGLRSISS----GTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQ 86

Query: 139 LQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYK 198
           L  DP SLPF KII ANIGNPQQL QKPLSF R+VLSLL+ P LL    E       +YK
Sbjct: 87  LSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME---VLNLIYK 143

Query: 199 ADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASA 258
            DAVRRA++++ D+  S+GAYS SQGV+G RKTVA++++ RD  EPA  EDIFLT GAS 
Sbjct: 144 PDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASN 202

Query: 259 AVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVV 318
             S ++ + CKG+++GVLIPIPQYPLYTAT+ LNN+  LPYYLDE+SGWS N  +++ ++
Sbjct: 203 GASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERII 262

Query: 319 LDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDV 378
           +++I++ +KP+ LVVINPGNPTGA+L              Y IVVIADEVYQEN+F E +
Sbjct: 263 IESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVF-EGL 321

Query: 379 KFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVIL 438
           KF+SMKKVLR LQ+ +   F  VQL SLHSTSKG+SGECGQRGG+MEL GFS +IR+VIL
Sbjct: 322 KFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVIL 381

Query: 439 KLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLE 498
           K+ASI LC  V GQALVDLM+  P+ G+ESYE D +ERS I + L +R+  LWETFN LE
Sbjct: 382 KMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLE 441

Query: 499 GIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVP 558
           G++C+KPQG+MYLFPRL LP KA++ A+ ++M  DEFYC ELL +TGICTVPGSGFGQ P
Sbjct: 442 GVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAP 501

Query: 559 GTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591
            T HLRTTFL PGTEWI+ WE FHK FY+KYRD
Sbjct: 502 DTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 386/491 (78%), Gaps = 2/491 (0%)

Query: 100 YKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNP 159
           + F PA ++ I DLN NV+KA++AVRG+IPM+A++LQ QL ++P SLPF++I  ANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 160 QQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAY 219
           Q+L+QKPL+F RQV+S+LQ+PELLN   E  +    +Y  D+  RAEKLL +IGGSVGAY
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 220 STSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPI 279
           S SQGV GIRKT+A++IT+RD  E A P DIF+T GA+AA SYLLSI   G +TGVL+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 280 PQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVL-DAIDRNIKPSVLVVINPGN 338
           PQYPLYTA LAL+N+  LPYYL+E+SGWS +T EI+  +  +A+ + I+P V+V+INPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 339 PTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKF 398
           PTG++LS             YGIV+IADEVYQEN+F+ + KFHS KKVLR LQ++ P ++
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGN-KFHSCKKVLRSLQKQFPTQY 309

Query: 399 DEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLM 458
           + VQLASLHSTSKG+ GECGQRGG+ME+ GF++++R +ILKLA I +CPVVTGQA++DLM
Sbjct: 310 NNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLM 369

Query: 459 VHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLP 518
           + PP++G++SY+LD  ER  IH+++  RA KL++ F+ +EGIQCQKPQGAMYLFPRL L 
Sbjct: 370 ILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLS 429

Query: 519 FKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLW 578
            K + +A+  EM  DEFYC ELL  TGICTVPGSGFGQ P TYHLRTTFLAPG +WI+ W
Sbjct: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKW 489

Query: 579 EKFHKEFYNKY 589
           EKFHK F  +Y
Sbjct: 490 EKFHKAFLKRY 500

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/496 (62%), Positives = 383/496 (77%), Gaps = 4/496 (0%)

Query: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154
           +S S  K   A +++  DLN NV+KAKYAVRG+IP  A++L+ QL + P +LPF+ +IN+
Sbjct: 71  YSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINS 130

Query: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214
           NIGNPQQL QKPLSF RQVLS+L++P LL+   E     +  Y  D++ RA+ LL DIG 
Sbjct: 131 NIGNPQQLGQKPLSFGRQVLSILEYPALLD--HERTLVDSMGYAPDSIERAKTLLTDIG- 187

Query: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274
           S+GAYS SQGV GIR+TVADFIT RD+ E AYP+DIFLTAGAS+AVS +LSI CKG++TG
Sbjct: 188 SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247

Query: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334
           VLIPIPQYPLYTATL LN++  LPYYLDE +GWST+  EI  V  D+++  IKP+ LVVI
Sbjct: 248 VLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVI 307

Query: 335 NPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394
           NPGNPTG+VL+             YG+VVIADEVYQ+NIF    +FHSMKK+LR LQ+E 
Sbjct: 308 NPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGS-EFHSMKKILRILQKEV 366

Query: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454
           P K+D +QLASLHS SKG+ GECG RGG+ E  GF+ E++QVI KL+SISLC  V GQAL
Sbjct: 367 PNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQAL 426

Query: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514
           VDLM  PP++GE SYELDQ ER  I +   KR+NKL+E FN LEG+ CQKPQGAMY+FP 
Sbjct: 427 VDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPN 486

Query: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574
           + LPF A++ AQ++++T DEFYC+ELL+ TGICTVPGSGFGQ PGTYH+RTTFLAPG EW
Sbjct: 487 IQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEW 546

Query: 575 IDLWEKFHKEFYNKYR 590
           +  WEKFH EF+ KYR
Sbjct: 547 MKRWEKFHIEFFEKYR 562

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/496 (63%), Positives = 381/496 (76%), Gaps = 7/496 (1%)

Query: 97  KSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANI 156
           K   +F PA  + +AD+NENV+KAKYAVRG IP RAE+L+ +L+E P SLPF KII ANI
Sbjct: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANI 91

Query: 157 GNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAA-ATSLYKADAVRRAEKLLEDIGGS 215
           GNPQQL QKPL+FYRQV+SL+Q P+LL    E PA      +KAD V RA ++L+D GGS
Sbjct: 92  GNPQQLGQKPLTFYRQVISLMQNPQLL----EMPAEWLQQAFKADVVVRARRMLQDAGGS 147

Query: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGV 275
           VGAYS SQGV G R+TVA FI RRD   PA P++++LTAGAS+AVS LLS FCKG +TGV
Sbjct: 148 VGAYSASQGVKGYRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206

Query: 276 LIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVIN 335
           LIPIPQYPLYTAT+  NN+  LPYYL+E  GWSTN  E++ V+LD+  RNI P  LVVIN
Sbjct: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266

Query: 336 PGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP 395
           PGNPTG+VLS             YGIVVIADEVYQ+N+F  D KFHSM+KVL+ LQ   P
Sbjct: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFG-DAKFHSMRKVLKNLQLREP 325

Query: 396 GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALV 455
             +  VQLASLHS SKG+SGECGQRGG+MEL GF  E+R+V +KLASISLCPVVTGQALV
Sbjct: 326 TLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALV 385

Query: 456 DLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRL 515
           DLMV PP +G+ SYE    E   I+ EL +R+  LW+TF  LEGI+C  PQGA+YLFP+L
Sbjct: 386 DLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKL 445

Query: 516 NLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWI 575
           +LP KA++ AQ + + ADE YC ELL+ TGICTVPG+GFGQ+PGTYH+RTTFL PGT+WI
Sbjct: 446 HLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWI 505

Query: 576 DLWEKFHKEFYNKYRD 591
           + W+ FHK+FY+KYRD
Sbjct: 506 ESWKDFHKKFYDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/496 (60%), Positives = 382/496 (77%), Gaps = 10/496 (2%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA +  + D+NE++LKA+YA+RG+IP RAE+L  QL E+ +SLPF KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221
           L+Q+PL+F RQV+SL+QFP+LL S  ++   A  +Y  D++ RA KLL  IGGSVGAYS+
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKS--KDILLAQKIYSKDSIERATKLLNSIGGSVGAYSS 125

Query: 222 SQGVMGIRKTVADFITRRD-NNEPA------YPEDIFLTAGASAAVSYLLSIFCKGEKTG 274
           SQGV+ IRK VA FI +RD +++P          ++FLTAGAS AV ++L +F K E  G
Sbjct: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCG 185

Query: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334
           VL+PIPQYPLYTA + L  S  LPYYL+E + WST+ K+I+ +V+DAI +NIKP+ LVVI
Sbjct: 186 VLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVI 245

Query: 335 NPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394
           NPGNPTGA+L+             YGIV+IADEVYQEN++ E  +FHS KKVL +L++ +
Sbjct: 246 NPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVY-EAFEFHSFKKVLSELRKNY 304

Query: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454
           P K+D VQLASLHS SKGV+GECGQRGG+ME+TGFS+++++V+LK+ASIS+C VVTGQ L
Sbjct: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364

Query: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514
           VDLMV+PPQ G+ESYELDQ ERS IHS L  ++N L++ F RL GI CQKPQGAMYLFPR
Sbjct: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424

Query: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574
           L+L   A+  A  + +  DEFYC +LLENTGICTVPGSGFGQ PGTYHLRTTFL PG EW
Sbjct: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484

Query: 575 IDLWEKFHKEFYNKYR 590
           I+ WEKFH EF  KY+
Sbjct: 485 INSWEKFHLEFMEKYK 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/491 (61%), Positives = 372/491 (75%), Gaps = 5/491 (1%)

Query: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161
           F PA ++ + DLN++ + A YAVRGSIPMRAEQL  Q+  DP SLPFDKII ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 162 LNQKPLSFYRQVLSLLQFPELLNS--LKENPAAATSLYKADAVRRAEKLLEDIGGSVGAY 219
           + QKPL+F RQVLS+L++P +LN   L E       +Y+ D + RA K+L+ IGGSVGAY
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEK-LVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 220 STSQGVMGIRKTVADFITRRDN-NEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIP 278
           S SQGV+G R+TVADFI +RD   + A P DIFLT GAS+AV YLLSI C G + GVLIP
Sbjct: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181

Query: 279 IPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGN 338
           IPQYPLYTATL L+NS  +PYYL E + WSTNTKEI+  + +++   +KP  +V+INPGN
Sbjct: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241

Query: 339 PTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKF 398
           PTGA+LS             YGI +IADEVYQENIF    +FHSM+KVL  LQ E PG +
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIF-PGFEFHSMRKVLLNLQSEFPGTY 300

Query: 399 DEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLM 458
           D VQLASLHSTSKG  GECGQRGG+MEL GF  E+  ++LKLASIS+C VVTGQAL+DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 459 VHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLP 518
             PPQ G+ SY+LDQ ER+ I  +L  RA++L+  F  LEG++CQ+PQGAMYLFP+L LP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 519 FKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLW 578
            KA++KA  +E+  DE+YC+ELL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEWI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 579 EKFHKEFYNKY 589
            +FH++FY ++
Sbjct: 481 REFHQQFYERF 491

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/498 (58%), Positives = 381/498 (76%), Gaps = 2/498 (0%)

Query: 94  LHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIIN 153
           + S+    FTP A+V + DLN  ++K +YAVRG IP RAE+L+ QL++DP+SLPF+KIIN
Sbjct: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIIN 60

Query: 154 ANIGNPQQLNQKPLSFYRQVLSLLQFPELL-NSLKENPAAATSLYKADAVRRAEKLLEDI 212
           ANIGNPQQL QKPLSF R+VLS+LQ+P++L +  K        +Y+ D VRRA KLL +I
Sbjct: 61  ANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEI 120

Query: 213 GGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEK 272
           GGSVGAYS SQGV GI++TVAD+IT+RD+ E AYPEDIFLT GAS+AVS++L +FC G  
Sbjct: 121 GGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT 180

Query: 273 TGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLV 332
           TGVLIPIPQYPLYTAT+ L  +  + YYL+E+  WS NT E+++ + ++I   IKP+ +V
Sbjct: 181 TGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIV 240

Query: 333 VINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQ 392
           +INPGNPTG++L+             YG+++IADEVYQEN+F  + +FHS+KKVLRKLQ+
Sbjct: 241 IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGN-EFHSVKKVLRKLQR 299

Query: 393 EHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQ 452
           ++ G ++ VQLASLHSTSKG+ GECGQRGG+MEL G + ++R  ++KL SIS+C VVTGQ
Sbjct: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359

Query: 453 ALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLF 512
           AL+D++V PP+ G+ESYE+DQ ER++I ++L  R+ KL + F  LEG++C +PQGAMYLF
Sbjct: 360 ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF 419

Query: 513 PRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGT 572
           P+   P K +  AQ +   AD  YCKELLE+TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 420 PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD 479

Query: 573 EWIDLWEKFHKEFYNKYR 590
            WIDLW KFH EF  +YR
Sbjct: 480 SWIDLWRKFHTEFCERYR 497

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/497 (58%), Positives = 369/497 (74%), Gaps = 12/497 (2%)

Query: 103 TPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQL 162
           TPA +  + D+++++L  +YA+RG+IP RA++LQ QL   P  LPF KII ANIGNPQQL
Sbjct: 7   TPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQL 66

Query: 163 NQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTS 222
            Q+PL+F RQVLSL+++P L+NS  +N      +Y  DA++RAE +L  IGGSVGAYS+S
Sbjct: 67  EQEPLTFQRQVLSLVEYPNLVNS--KNILVENKIYAPDAIKRAETILNSIGGSVGAYSSS 124

Query: 223 QGVMGIRKTVADFITRRDNNEPAYPE---------DIFLTAGASAAVSYLLSIFCKGEKT 273
           QG++ IRK VA  I +RDN+E    +         +IFLT GA+ AVSY+L +F K E  
Sbjct: 125 QGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENC 184

Query: 274 GVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVV 333
           GVL+PIPQYPLYTA + L NS  LPYYL+E   WST+ +EI++++ DAI RNIKP+ LV+
Sbjct: 185 GVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVI 244

Query: 334 INPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQE 393
           INPGNPTGA+LS             YGIV+IADEVYQ NI+ +D KFHS KK+L  L+ +
Sbjct: 245 INPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIY-QDFKFHSFKKILNSLKLQ 303

Query: 394 HPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQA 453
           +P K+D VQLASLHS SKGV+GECGQRGG+ EL GFS EI+++ILKLASI +C VVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 454 LVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFP 513
           LVDLM  PP++G+ SY+LDQ ER++I S L  ++N L++ F+RL GI CQKPQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 514 RLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTE 573
           RL+L    + +A+   +  DEFYC +LLENTGICTVPGSGFGQ  GTYH+RTTFL  G E
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 574 WIDLWEKFHKEFYNKYR 590
           WI LWEKFH EF N+Y+
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 22/187 (11%)

Query: 238 RRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL 297
           R +   P   ++I L  G+  ++  ++   C   +  V++  P Y +Y     +N+    
Sbjct: 78  REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG-- 135

Query: 298 PYYLDEKSGWSTNTKEID-SVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXX 356
             Y++     S N+ +ID   +L+ ++ +    V+ + +PGNPTGA +            
Sbjct: 136 --YVEVPLISSDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLRNW 193

Query: 357 XXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGE 416
              GIVV+ DE Y        + F + K  L  L  +HP       L  L + SK  SG 
Sbjct: 194 TA-GIVVV-DEAY--------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGL 236

Query: 417 CGQRGGF 423
            G R GF
Sbjct: 237 AGIRLGF 243

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 110/266 (41%), Gaps = 31/266 (11%)

Query: 229 RKTVADFITRRDNN---EPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLY 285
           +  +A F  R D     EP   +++ L  G+   +  L+   C+ E   +L   P Y +Y
Sbjct: 63  KTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMY 122

Query: 286 TATLALNNSHTLPY-YLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVL 344
           +    +N+   +    + E + +  N  E    VL  +  + K  +L + +PGNPTG ++
Sbjct: 123 SVCANINDVEIVECPLITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLV 178

Query: 345 SXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLA 404
           +              G+VV+ DE Y +   D +   +SM K++ K    +P       L 
Sbjct: 179 NKKDIEFILENWTN-GLVVV-DEAYID-FADAEGTTYSMAKLVTK----YP------NLT 225

Query: 405 SLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQE 464
            L + SK   G  G R G   +T  S E   V+  + +    P           +   QE
Sbjct: 226 VLQTLSKSF-GLAGIRLG---VTFASEEFSSVLNAMKA----PYNISSLTSKYAIEAVQE 277

Query: 465 GEESYELDQAERSHIHSELHKRANKL 490
              +Y ++ A   +++ E H+  N+L
Sbjct: 278 ENLNYMIENAR--NVNQEKHRLLNEL 301

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 71/169 (42%), Gaps = 20/169 (11%)

Query: 219 YSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIP 278
           Y   QG   +RK +A+  +  D       E++ LT GA AA ++L      G+    +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDVT--LSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 279 IPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSV-LVVIN-P 336
            P Y   ++   +  +     +L +++ +  N  E++        R IKP+   +V+N P
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELE--------RMIKPNTKCIVLNTP 163

Query: 337 GNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMKK 385
            NP  +V+              +GIVV  DEVY          FHS +K
Sbjct: 164 NNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP-------LFHSCEK 205

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL--PYYL 301
           P   +++ L  G+  ++  L+   C   K  +LI  P Y +Y+    +N+   +  P  +
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 302 DEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVL 344
           ++ S      K I+++  D+   NIK  +  V +PGNPTGA++
Sbjct: 144 EDNSFQMNTDKVIETLQGDS---NIK--IAFVTSPGNPTGALI 181

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYL-D 302
           P   E+I L  G+  ++  L+ + C   K  ++I  P Y +Y+    +N+   +   L  
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 303 EKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIV 362
           E + +  +T    S VL+ + ++    ++ + +PGNPT A++               G +
Sbjct: 144 EDNSFQMDT----SKVLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGL 197

Query: 363 VIADEVY 369
           V+ DE Y
Sbjct: 198 VVVDEAY 204

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 233 ADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALN 292
           AD  TR     P    +I L  G+  ++  ++   C   +  +L+  P Y +Y+    +N
Sbjct: 78  ADECTR-----PLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKIN 132

Query: 293 NSH--TLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
           +    T P   ++ S    + K     VLD ++ + +  +L + +PGNPTGA
Sbjct: 133 DVEVVTCPLITEDNSFQMDSDK-----VLDILNNDQEIKLLFITSPGNPTGA 179

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 13/148 (8%)

Query: 229 RKTVADF-----ITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283
           +K ++D+     I +  N +P   +++ L  G+  ++  L+   C   K  +LI    Y 
Sbjct: 64  KKLLSDYRNKTSIFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYG 123

Query: 284 LYTATLALNNSH--TLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341
           +YT    +N+    T+P  L E+  +  + ++I    L+ +  +    ++ + +PGNPTG
Sbjct: 124 MYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKI----LETLQNDPSIKLVFITSPGNPTG 179

Query: 342 AVLSXXXXXXXXXXXXXYGIVVIADEVY 369
             +               G+VV+ DE Y
Sbjct: 180 TFIDVNRIEKILSQWQT-GLVVV-DEAY 205

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 82/187 (43%), Gaps = 22/187 (11%)

Query: 201 AVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAV 260
           A++ A+K LE     V  YS ++G   +  ++ D  T   N E    E++ +T GA+  +
Sbjct: 72  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKE-LKAENVVVTTGANEGI 128

Query: 261 -SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYYLDEKSG----WST 309
            S L+ +   G++  V++  P +  Y   + L     +      P  LD+++     W+ 
Sbjct: 129 LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 310 NTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVY 369
           + ++ +  +        K   +++  P NP G V +             + +V+I+DEVY
Sbjct: 187 DFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVY 240

Query: 370 QENIFDE 376
           +   F +
Sbjct: 241 EHLYFTD 247

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 233 ADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALN 292
            D + +  N  P   E++ L  G+   +  L+   C   K  +LI  P Y +Y+    +N
Sbjct: 73  TDSVFKDQNLPPLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDIN 132

Query: 293 NSH--TLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSV--LVVINPGNPTGAVL 344
           +     +P  +++ S      K I+++  D       PS+  + + +PGNPTGA++
Sbjct: 133 DVEYVKVPLVVEDNSFQMDTEKVIETLQND-------PSIKLVFITSPGNPTGALI 181

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 239 RDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLP 298
           +D  +P   E++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   + 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 299 Y-YLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
              +   + +  NT E+     +  D +IK  ++ + +PGNPTGA
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQN--DPSIK--LIFITSPGNPTGA 178

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 69/172 (40%), Gaps = 34/172 (19%)

Query: 219 YSTSQGVMGIRKTVADFITRRDNNEPAYPE---DIFLTAGASAAVSYLLSIFCKGEKTGV 275
           YS +QG+  +   +  FIT+  NN P Y E   DI L  G+S ++  +    C  E T V
Sbjct: 137 YSETQGMKPLLDFIKTFITKL-NNTPPYNETLYDIMLANGSSDSMFKVFETLC-DESTTV 194

Query: 276 L------IPIPQYPLYTATLALNNSHTLPY--------YLD---EKSGWSTNTKEIDSVV 318
           L      +P+    + T    +     L Y        YL+   +  G  +NTK +    
Sbjct: 195 LMEEFTFVPVISNVMATGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLS--- 251

Query: 319 LDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVIADEVY 369
                   KP +L  I+ G NP G  LS             + ++++ D+ Y
Sbjct: 252 --------KPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDE 303
           P   E++ L  G+  ++  ++   C   K  ++   P Y +Y+   ++N+   +   L  
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL-- 138

Query: 304 KSGWSTNTKEIDS-VVLDAIDRNIKPSVLVVINPGNPTGA 342
               S N+ ++D+  VLD + ++    ++ + +PGNPTGA
Sbjct: 139 --VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGNPTGA 176

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 79/183 (43%), Gaps = 27/183 (14%)

Query: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAY-----PEDIFLTAGASAAV-SYLLSIFCK 269
           V  YS ++G   + K++ D  +      P Y     PE++ +T GA+  + + L+ I  +
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYS------PLYKLTLKPENVLVTTGANEGILACLMGILNQ 137

Query: 270 GEKTGVLIP-----IPQYPLYTATLA---LNNSHTLPYYLDEKSGWSTNTKEIDSVVLDA 321
            ++  V  P     IP   L    +    +N    L   + + + W+ + ++ ++V+ + 
Sbjct: 138 NDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN- 196

Query: 322 IDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIF-DEDVKF 380
                K   +++  P NP G V +             + +++I+DEVY    F DE  + 
Sbjct: 197 -----KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYFVDEFTRI 251

Query: 381 HSM 383
            ++
Sbjct: 252 ATL 254

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDE 303
           P   ++I L  G+   V  L+   C  +   VL+  P Y +Y+    +N++  +   L  
Sbjct: 84  PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 304 KSGWSTNTKEID-SVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIV 362
           +     N+ ++D   VL+ +  +    +L +  PGNPTGA +S              GIV
Sbjct: 144 ED----NSFDMDLDNVLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWSA-GIV 198

Query: 363 VIADEVY 369
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 238 RRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL 297
           + +N  P   E++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +
Sbjct: 79  KAENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIV 138

Query: 298 PYYLDEKSGWSTNTKEIDS-VVLDAIDRNIKPSVLVVINPGNPTGA 342
              L     +  N+ ++D+  VL  +  +    +L + +PGNPTGA
Sbjct: 139 ECPL----LYKNNSFQMDTESVLTVLQNDPLIKLLFITSPGNPTGA 180

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 22/171 (12%)

Query: 219 YSTSQGVMGIRKTVADFITRRDNNEPAY-----PEDIFLTAGASAAV-SYLLSIFCKGEK 272
           YS ++G   + K +AD  T      P Y      ++I +  GA+ A+ S L+ +  KG++
Sbjct: 77  YSPTRGRPNLIKALADLYT------PLYGQQLSADNITVHTGANEAIFSCLMGLLNKGDE 130

Query: 273 TGVLIPIPQYPLYTATLALNNSHTL------PYYLDEKSGWSTNTKEIDSVVLDAIDRNI 326
             V++  P +  Y + + L            P  LD++    T   EID  +L+    N 
Sbjct: 131 --VIVFEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEW-EIDWDILEKT-INS 186

Query: 327 KPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDED 377
           +   +++  P NP G V +               IV+I+DEVY+   F ++
Sbjct: 187 RTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSDE 237

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 15/140 (10%)

Query: 247 PEDIFLTAGASAAV-SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PY 299
           PE++ +T GA+  + S L+ I   G++  V++  P +  Y   + L     +      P 
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPK 172

Query: 300 YLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI--NPGNPTGAVLSXXXXXXXXXXXX 357
            LD +    T      +V  D   R I P    VI   P NP G V +            
Sbjct: 173 ELDNRVTKGTEW----TVDFDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 358 XYGIVVIADEVYQENIFDED 377
              +++IADEVY+   F ++
Sbjct: 229 ENNVIIIADEVYEHLYFVDE 248

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 70/357 (19%), Positives = 134/357 (37%), Gaps = 53/357 (14%)

Query: 216 VGAYSTSQGVMGIRKTV--------ADFITRRDNNEPAYPEDIFLTAGASAAV-SYLLSI 266
           V  YS ++G   + K++         DFI   DN      +++ +T GA+  + S L+ I
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFI---DN------QNVLVTTGANEGILSCLMGI 124

Query: 267 FCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDR-- 324
              G++  V  P     +    L       +P +  ++      T +   +  DA+++  
Sbjct: 125 LNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTF 184

Query: 325 NIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMK 384
           N K   +++  P NP G V +             +  VVI+DEVY+   F E        
Sbjct: 185 NNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTESFP----- 239

Query: 385 KVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASIS 444
                            ++A+++     ++   G  G     TG+   I  +I K   + 
Sbjct: 240 -----------------RIANINEDIANLTLTVGSAGKSFAATGW--RIGWIISKNDQL- 279

Query: 445 LCPVVTGQALVDLMVHPPQEGEESYELDQAER----SHIHSELHKRANKLWETFNRLEGI 500
           L  V      +      P +   +  ++ A +      +  E  K+   L   F++L G+
Sbjct: 280 LNYVSKAHTRICFASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GL 338

Query: 501 QCQKPQGAMYL---FPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGF 554
              +P+G  ++   F ++ +P   V   + +E   D      L+   GI  +P + F
Sbjct: 339 NYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 70/149 (46%), Gaps = 14/149 (9%)

Query: 248 EDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL--PYYLDEKS 305
           +++ L  G+   +  L+   CK     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 306 GWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIA 365
                 + ++++  D + R     +L + +PGNPTG +++              G+VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLEHWKN-GLVVV- 197

Query: 366 DEVYQE--NIFDEDVK---FHSMKKVLRK 389
           DE Y +    F+E+ K   + S+ K++ K
Sbjct: 198 DEAYVDFSTYFNEETKKTEYFSVAKLVTK 226

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 116/299 (38%), Gaps = 70/299 (23%)

Query: 247 PEDIFLTAGASAAV-SYLLSIFCKGEKTGVLIPI-PQYPLYTATLALNNSH---TLPYYL 301
           PE+I +T GA+  + + L+S+   G++  VL P   QY      L     H   T P  L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 302 DEK----SGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXX 357
             +    S W+ +  +  S + +      K   +++ +P NPTG V +            
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 358 XYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGEC 417
              + +I+DEVY+   F  +                       V+LASL      ++   
Sbjct: 213 EKNVYIISDEVYENLYFTPEC----------------------VKLASLSPEISNITLTI 250

Query: 418 GQRGGFMELTGFSHEIRQVI------LKLAS---ISLC------PVVTGQALVDLMVHPP 462
           G  G    +TG+   I  +I      LKLAS   I +C      P +     +D+ ++  
Sbjct: 251 GSAGKIFAVTGW--RIGWIISENVELLKLASSAHIKICFSSPSPPQLACAHAIDIALN-- 306

Query: 463 QEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYL---FPRLNLP 518
                S   D+  + +I     ++   L   F  L G+    P+G+ ++   F +L +P
Sbjct: 307 -----SDYFDRMRKDYI-----EKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPY-YLD 302
           P   E+  L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 303 EKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
           E + +  +  EI +++  A D  IK  ++ + +PGNPTGA
Sbjct: 143 EDNSFQIDATEILNIL--ANDPLIK--LVFITSPGNPTGA 178

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 243 EPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL--PYY 300
           +P   +++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +  P  
Sbjct: 83  KPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 301 LDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYG 360
           + + S +  NT+     VL  ++ +    ++   +PGNPTGA +               G
Sbjct: 143 VSDNS-FQMNTE----AVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQKWDN-G 196

Query: 361 IVVIADEVY 369
           IVV+ DE Y
Sbjct: 197 IVVV-DEAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 46/96 (47%), Gaps = 5/96 (5%)

Query: 248 EDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPY-YLDEKSG 306
           E++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +    + E + 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 307 WSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
           +  N+ +    VLD +  +    ++ + +PGNPTG 
Sbjct: 148 FQLNSDK----VLDILKNDPLIKLVFITSPGNPTGV 179

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 95/434 (21%), Positives = 165/434 (38%), Gaps = 58/434 (13%)

Query: 156 IGNPQQLNQKPLSFYRQVLSLL-QFPELLNSLKENPAAATSLYKAD--------AVRRAE 206
           I N   L Q PL+   +VL L  QF +  N+ K N      +YK          A+ +A+
Sbjct: 22  IRNVSTLTQIPLAPPDRVLGLTEQFVKDKNTNKVN--LTVGIYKDGHGKVSTLPAITKAQ 79

Query: 207 KL--LEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLT----------- 253
           ++  L+D      +Y    G    R  V +F+ R  ++ P Y + +              
Sbjct: 80  EIIDLDDALNKNLSYLPISGCPNYRDNVLNFLFR--DSVPKYGDKLIADNRVSFIQSLSG 137

Query: 254 AGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKE 313
            GA A  S LLS F       V IP P +P +     +N    L YY     G  T  + 
Sbjct: 138 TGAIAVASKLLSSFISDT---VWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRW 194

Query: 314 IDSVVLDAIDRNIK--PSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQE 371
           ++S   +    N K   S+++     NPTG   +               ++ I D  YQ 
Sbjct: 195 LESTETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQG 254

Query: 372 NIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELT---- 427
               E    +    +LR    E   K  +  L    S +K + G  G+R G + +     
Sbjct: 255 L---ESGSLYDDAYLLRHCLDESRYKGWKHGLFLCQSFAKNM-GLYGERVGSLSIVVPPN 310

Query: 428 ------GFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHS 481
                     ++++++  + S    P   G  + +L++  P       EL       +HS
Sbjct: 311 LEKAKLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQP-------ELRNQWHQDVHS 360

Query: 482 ELHKRANKLWETFNRL--EGIQCQKPQGAMYLFPRLNLPFKAVQKAQH-MEMTADEFYCK 538
            + +  N   + +++L   G+     Q  M+ F RL++    + K ++ + +T+D     
Sbjct: 361 IVGRLTNVRKQMYDKLGWSGLVDSSQQHGMFYFTRLDIDQVQLLKDKYSIYLTSDGRLSL 420

Query: 539 ELLENTGICTVPGS 552
             + ++ I  V GS
Sbjct: 421 SGINDSNIDYVCGS 434

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 51/101 (50%), Gaps = 5/101 (4%)

Query: 243 EPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLD 302
           +P   +++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLT 142

Query: 303 EKSG-WSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
              G +  +T+ + +++ +  D  IK  ++ V +PGNPTGA
Sbjct: 143 VSDGSFQMDTEAVLTILKN--DSLIK--LMFVTSPGNPTGA 179

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 82/187 (43%), Gaps = 22/187 (11%)

Query: 201 AVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAV 260
           A++ A+K L DI   V  YS ++G   +  ++    +   N E    E++ +T GA+  +
Sbjct: 72  AIKEAQKAL-DIP-MVNQYSPTRGRPSLINSLIKLYSPIYNTE-LKAENVTVTTGANEGI 128

Query: 261 -SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYYLDEKSG----WST 309
            S L+ +   G++  V++  P +  Y   + L     +      P  LD+++     W+ 
Sbjct: 129 LSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 310 NTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVY 369
           + ++ +  +        K   +++  P NP G V +             + +V+I+DEVY
Sbjct: 187 DFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 240

Query: 370 QENIFDE 376
           +   F +
Sbjct: 241 EHLYFTD 247

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 248 EDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGW 307
           +++ +T GA  A ++L+     G    ++   P Y   ++  ++  +     +L+ + G+
Sbjct: 82  DNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGY 140

Query: 308 STNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADE 367
           + N +++ S V            +V+ NP NP G+V+S               I ++ DE
Sbjct: 141 TPNIQKLKSKV------RANTKYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDE 194

Query: 368 VY 369
           VY
Sbjct: 195 VY 196

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 64/329 (19%), Positives = 128/329 (38%), Gaps = 59/329 (17%)

Query: 248 EDIFLTAGA-SAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLA--------LNNSHTLP 298
           E+I +T GA  A +  L+++   G++  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 299 YYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXX 358
             + E + W  + + + +   D      K  ++++ NP NP G V +             
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 359 YGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECG 418
            G  +IADEVY+                     Q  P     +   S     K ++   G
Sbjct: 213 NGAYIIADEVYE-------------------FLQFTPNPLSRISNLSEAIAQKTIT--IG 251

Query: 419 QRGGFMELTGFS-----HEIRQVILKLASI----SLCPVVTGQALVDLMVHPPQEGEESY 469
             G    +TG+       + R+++ K+ ++      C     Q    L +   +  E  Y
Sbjct: 252 SAGKIFRVTGWRVGWMISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQ--RALECGY 309

Query: 470 ELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYL---FPRLNLPFKAVQKAQ 526
            L       + +E  ++ + +++  + L G+   KPQGA ++   F ++ +P +  Q  +
Sbjct: 310 FLS------MPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIP-EDYQFPE 361

Query: 527 HMEMTADEFYCKELL-ENTGICTVPGSGF 554
           +++  A +F+    L +   I  +P S F
Sbjct: 362 YLKNRARDFFISYWLTQEFCILLLPCSEF 390

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 62/140 (44%), Gaps = 19/140 (13%)

Query: 248 EDIFLTAGASAAV-SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYY 300
           E++ +T GA+  + S L+ +   G++  V++  P +  Y   + L     +      P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 301 LDEKSG----WSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXX 356
           LD+++     W+ + ++ ++ +        K   +++  P NP G V +           
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 357 XXYGIVVIADEVYQENIFDE 376
             + +V+I+DEVY+   F +
Sbjct: 244 VKHNVVIISDEVYEHLFFTD 263

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 72/170 (42%), Gaps = 16/170 (9%)

Query: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAV-SYLLSIFCKGEKTG 274
           V  YS ++G + + +++    +   N E    E++ +T GA+  + S L+ I   G++  
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAE-LKAENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 275 VLIP-----IPQYPLYTATLA---LNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNI 326
           V  P     IP   L    +    +N    +   + + + W+ + ++  + + D      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 327 KPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDE 376
           K   +++  P NP G V +               +V+I+DEVY+   F +
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTD 246

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 50/103 (48%), Gaps = 9/103 (8%)

Query: 243 EPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLD 302
           +P   +++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 303 EKSGWSTNTKEIDSVVLDAIDRN---IKPSVLVVINPGNPTGA 342
                S N+ ++D+     I +N   IK  ++ V +PGNPTGA
Sbjct: 143 ----VSDNSFQMDTEAALTILKNDPLIK--LIFVTSPGNPTGA 179

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 242 NEPAY----PEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL 297
           N+PA      +++ L  G+  ++  ++   C   K  +L+  P Y +Y+    +N+   +
Sbjct: 78  NDPAVKSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVV 137

Query: 298 PYYLDEKSGWSTNTKEID-SVVLDAIDRNIKPSVLVVINPGNPTGA 342
              L      S N+ ++D   VL  ++ +    ++ V +PGNPTGA
Sbjct: 138 QCPL----VVSDNSFQMDVEAVLTILENDPLIKLVFVTSPGNPTGA 179

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 73/182 (40%), Gaps = 12/182 (6%)

Query: 201 AVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAV 260
           A++ A++ LE     V  YS ++G + +  ++  F T   N +         T    A  
Sbjct: 63  AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 261 SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYYLDEKSGWSTNTKEI 314
           S L+ +   G++  V++  P +  Y   + L+    +      P  LD +        +I
Sbjct: 121 SILIGLLNPGDE--VIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVT-KGEEWQI 177

Query: 315 DSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIF 374
           D   L A   N K   +++  P NP G V +               +V+I+DEVY+   F
Sbjct: 178 DWDSLQAA-MNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYF 236

Query: 375 DE 376
            +
Sbjct: 237 KD 238

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 46/122 (37%), Gaps = 2/122 (1%)

Query: 249 DIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWS 308
           DI  T G++ A    L IFC    T VL+    Y            + +P  +D +    
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDT-VLLEEFTYSSSVEAADAQGLNCIPVPMDNQGIIP 191

Query: 309 TNTKEIDSVVLDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVIADE 367
              +E+ S   D       P +L  I  G NPTG  LS             Y I+++ D+
Sbjct: 192 EKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIVEDD 251

Query: 368 VY 369
            Y
Sbjct: 252 PY 253

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 71/325 (21%), Positives = 136/325 (41%), Gaps = 36/325 (11%)

Query: 249 DIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLAL--NNSHTLPYYLDEKSG 306
           D+  T G + A   +L IFC     G  I   Q+   ++  A      +  P  LDE   
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQFAFSSSISAAEAQGVNVFPIPLDEHG- 189

Query: 307 WSTNTKEIDSVVLDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVIA 365
                 ++++++ +  +   KP +L  +  G NPTG+ LS             +  ++I 
Sbjct: 190 --IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIE 247

Query: 366 DEVY---QENIFDED-----VK-FHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGE 416
           DE Y   Q   +++D     VK +   K+ ++ L++       E ++  L S SK ++  
Sbjct: 248 DEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA-- 305

Query: 417 CGQRGGFMELTGFSHEIRQVILKLASISL-CPVVTGQALVDLMVHPPQEGEESYELDQAE 475
            G R G+  + G + +I   IL L  +++  P    Q+++   ++  + G+E Y LD   
Sbjct: 306 PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGY-LDWLI 359

Query: 476 RSHIHSELHKR---ANKLWETFNRLEGIQCQKPQGAMYLFPRLNL---PFKAVQKAQHME 529
               H    KR    + L++   +++ I+   P   M+    ++    P  A +     E
Sbjct: 360 GLR-HEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDPE 418

Query: 530 MTADEFYCKELLENTGICTVPGSGF 554
                 + + +   +G+  VPG+ F
Sbjct: 419 KVEKAIFDRSIA--SGVLVVPGNWF 441

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/141 (19%), Positives = 62/141 (43%), Gaps = 19/141 (13%)

Query: 248 EDIFLTAGASAAV-SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYY 300
           E++ +T GA+  + S L+ +   G++  V++  P +  Y + + L     +      P  
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 301 LDEK----SGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXX 356
           LD++    + W+ + ++  + +        K   +++  P NP G V +           
Sbjct: 175 LDQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNIC 228

Query: 357 XXYGIVVIADEVYQENIFDED 377
               +++I+DEVY+   F ++
Sbjct: 229 VEKNVIIISDEVYEHLYFTDE 249

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 80/187 (42%), Gaps = 22/187 (11%)

Query: 201 AVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAV 260
           A++ A+K LE     V  YS ++G   +  ++    +     E    E+I +T GA+  +
Sbjct: 76  AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKE-LKQENITITTGANEGI 132

Query: 261 -SYLLSIFCKGEKTGVLIPIPQYPLYTATLAL----------NNSHTLPYYLDEKSGWST 309
            S L+ +   G++  V++  P +  Y + + L          N    L   + E + W+ 
Sbjct: 133 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTI 190

Query: 310 NTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVY 369
           + ++  + +        K   ++V +P NP G V +               +++I+DEVY
Sbjct: 191 DFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVY 244

Query: 370 QENIFDE 376
           +   F++
Sbjct: 245 EFLYFND 251

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 5/100 (5%)

Query: 244 PAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLD- 302
           P   +++ L  G+  ++  ++   C   K  +L   P Y +Y+    +N+   L   L  
Sbjct: 83  PLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIY 142

Query: 303 EKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGA 342
           E + +  +++++ S++  + D  IK  ++ + +PGNPTGA
Sbjct: 143 EDNSFQPDSQKVISIL--SSDPLIK--LVFLTSPGNPTGA 178

>NCAS0B06080 Chr2 complement(1149292..1151241) [1950 bp, 649 aa]
           {ON} Anc_2.324
          Length = 649

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 15/119 (12%)

Query: 119 KAKY----AVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN-----QKPLSF 169
           K KY    ++  S+  +  QL+   QE+      D++INA + N +++N     Q+P ++
Sbjct: 485 KMKYLQLESIDASLTTKTRQLEKIKQEEAEFSNVDRVINAKVQNSKRVNLERPEQEPRTY 544

Query: 170 YRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGI 228
             ++LS  +F +L N +K+    + +    D+    E L  DI     A    +G M +
Sbjct: 545 SGKLLS--KFTQLANMVKD----SVNYSDIDSDVSKESLERDITNLNEALEVCKGDMEV 597

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 9/124 (7%)

Query: 249 DIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALN--NSHTLPYYLDEKSG 306
           D+  TAG + A    L +FC     G  I    Y   ++  A      +  P  LDE   
Sbjct: 135 DVLATAGNTNAWESTLRVFCN---RGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDE--- 188

Query: 307 WSTNTKEIDSVVLDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVIA 365
           +    ++++S++ +      KP +L  I  G NPTG+ LS             +  ++I 
Sbjct: 189 FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 366 DEVY 369
           DE Y
Sbjct: 249 DEPY 252

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 70/327 (21%), Positives = 126/327 (38%), Gaps = 41/327 (12%)

Query: 249 DIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWS 308
           ++ +TAG ++A    L IFC    T +L     +    +        T P  +D+K    
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT-ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG--- 187

Query: 309 TNTKEIDSVVLDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVIADE 367
              +++ +++ +      KP +L  I  G NPTG+ L              +  +++ DE
Sbjct: 188 IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDE 247

Query: 368 VYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLA--------SLHSTSKGVSGECGQ 419
            Y     ++ VK  S++K ++    E     D+  L+         + S SK ++   G 
Sbjct: 248 PYYFLQMEDYVKDPSLRKEVKLSHDEFLASLDQTFLSIDTDGRVIRMDSFSKVLA--PGS 305

Query: 420 RGGFMELTGFSHEIRQVILKLASISLCPVVT-GQALVDLMVHPPQEGEESYELDQAERSH 478
           R G++     S++I +  L L  +S+       Q++V   +   + G+  Y LD      
Sbjct: 306 RLGWITC---SNQIMKAYLALYEMSMQAAAGFTQSIVSATLS--KWGQHGY-LDWLLGLR 359

Query: 479 IHSELHKRANKL---WETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTAD-- 533
            H    KR N +   ++   + +      P   M+      + F     A+H E T    
Sbjct: 360 -HEYTLKRDNAIDACYKYIPQTDAFHINPPVAGMF----FTITFDG---AKHPEFTTKFK 411

Query: 534 ------EFYCKELLENTGICTVPGSGF 554
                 E Y  E    +G+   PGS F
Sbjct: 412 SDPLLLESYLYEKAVESGVIIAPGSWF 438

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 48/238 (20%), Positives = 93/238 (39%), Gaps = 35/238 (14%)

Query: 325 NIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVYQENIFDEDVKFHSMK 384
           N K   +++ +P NP G V +              GI +I+DEVY+   F ++  F  + 
Sbjct: 210 NEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTDE--FTRIA 267

Query: 385 KVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASIS 444
            +  ++ Q              H+ + G +G+     G+    G+     + +L LAS  
Sbjct: 268 TLSEEISQ--------------HTLTVGSAGKSFAATGWR--IGWVISRNKELLALAS-- 309

Query: 445 LCPVVTGQALVDLMVHPPQEGEE--SYELDQAERSHIHSELHKRANKLWETFNR---LEG 499
                  +A V +    P   +E  +  ++ A ++  +++      K +E F +     G
Sbjct: 310 -------KAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKKYERFQKPFDDLG 362

Query: 500 IQCQKPQGAMYL---FPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGF 554
           +   + +G+ +L   F RL LP       +  +   D      L+   G+  +P S F
Sbjct: 363 LPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVAYWLINELGLVAIPCSSF 420

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 53/132 (40%), Gaps = 15/132 (11%)

Query: 248 EDIFLTAGASAAV-SYLLSIFCKGEKTGVLIP-----IPQYPLYTATLA---LNNSHTLP 298
           E++ +T GA+  + S L+ I   G++  V  P     IP   L    +    +N    + 
Sbjct: 123 ENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMD 182

Query: 299 YYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXX 358
             + E   W+ + +E+            K   L++  P NP G V +             
Sbjct: 183 QRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCVE 236

Query: 359 YGIVVIADEVYQ 370
             +V+I+DEVY+
Sbjct: 237 NNVVIISDEVYE 248

>TDEL0E00380 Chr5 complement(89449..90966) [1518 bp, 505 aa] {ON}
           Anc_2.3 YNL241C
          Length = 505

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 204 RAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEP------AYPEDIFLTAGA 256
           + E+  + I    GAY T+ G + +RK++ +F + R  +EP      A P  +FLT   
Sbjct: 78  KVEEFFKMITYIHGAYDTADGYVKLRKSIEEFESERKVSEPHRLFYFALPPSVFLTVAT 136

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 17/145 (11%)

Query: 242 NEPAYPEDIFLTAGASAAV-SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL--- 297
           N+    E++ +T GA+  + S L+ +   G++  V++  P +  Y + + L     +   
Sbjct: 110 NKDLTTENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVP 167

Query: 298 ---PYYLDEKSGWSTNTK-EIDSVVLDAIDRNIKPSVLVVI--NPGNPTGAVLSXXXXXX 351
              P  LD +     NT+ E  ++  +  ++ I P    VI   P NP G V +      
Sbjct: 168 INPPKELDLR-----NTRGEEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTT 222

Query: 352 XXXXXXXYGIVVIADEVYQENIFDE 376
                  + +++I+DEVY+   F +
Sbjct: 223 LGNICVKHNVIIISDEVYEHLYFTD 247

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 6/68 (8%)

Query: 307 WSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIAD 366
           W+ N  E+++ +        K   L++  P NP G V +             + +V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 367 EVYQENIF 374
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>NCAS0F02590 Chr6 (522244..524076) [1833 bp, 610 aa] {ON} Anc_5.302
           YDR292C
          Length = 610

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 374 FDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQ--RGGFMELTGFSH 431
           ++E +KF  +      + +E   + D ++  SLH+ +KG +G   +  R G ME T  S 
Sbjct: 147 YEESIKFDVVNATNDNVSREASPRVDSLKKNSLHAKNKGNNGGGRKWGRNGMMEETTSSE 206

Query: 432 EIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEES 468
           ++ Q+    +S +   + + ++  D+       GE +
Sbjct: 207 DVSQLDFSRSSKNKSGIASPESNFDMEFDKNAFGERT 243

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 249 DIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSH---TLPYYLDEKS 305
           D+  T G + A    L +FC  +K  V++   +   +++ LA   +    T P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC--DKGDVILA--EAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 306 GWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG-NPTGAVLSXXXXXXXXXXXXXYGIVVI 364
                 ++++ ++ +  +   KP +L  I  G NPTG+ LS             +  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 365 ADEVYQENIFDEDVK 379
            DE Y     DE VK
Sbjct: 245 EDEPYYFLQIDEYVK 259

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 75/185 (40%), Gaps = 18/185 (9%)

Query: 199 ADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASA 258
           A  V  A+K L+D    V  YS ++G M +  ++    +   N +     +I +T GA+ 
Sbjct: 69  AFVVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQ-LQANNIQVTTGANE 125

Query: 259 AV-SYLLSIFCKGEKTGVLIPI-------PQYPLYTAT-LALNNSHTLPYYLDEKSGWST 309
            + + L+ +   G++  V  P         Q P    T + L+    +     E + W+ 
Sbjct: 126 GILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTV 185

Query: 310 NTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIADEVY 369
           +  E+ + +        K   L++  P NP G V +               +V+I+DEVY
Sbjct: 186 DYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVY 239

Query: 370 QENIF 374
           +   F
Sbjct: 240 EHLYF 244

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 81/192 (42%), Gaps = 30/192 (15%)

Query: 201 AVRRAEKLLEDIGGSVGAYSTSQG----VMGIRKTVADFITRRDNNEPAYPEDIFLTAGA 256
           AVR A+K LE    +   YS ++G    +  + K  + F   R       P ++ +T GA
Sbjct: 75  AVREAQKALEVALNN--QYSPTKGRPSLINELIKLYSPFYKTRLG-----PSNVQVTTGA 127

Query: 257 SAAV-SYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTL------PYYLDEK----S 305
           + A+ S L+ +  +G++  V++  P +  Y + + +            P  L+ +    +
Sbjct: 128 NEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPKELENRVTHGT 185

Query: 306 GWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSXXXXXXXXXXXXXYGIVVIA 365
            W+ +  E+ + +        K   L++  P NP G V +               +V+I+
Sbjct: 186 EWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIIS 239

Query: 366 DEVYQENIFDED 377
           DEVY+   F  +
Sbjct: 240 DEVYEHLYFTSE 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,014,099
Number of extensions: 2672562
Number of successful extensions: 7198
Number of sequences better than 10.0: 95
Number of HSP's gapped: 7311
Number of HSP's successfully gapped: 95
Length of query: 591
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 476
Effective length of database: 40,294,809
Effective search space: 19180329084
Effective search space used: 19180329084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)