Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020308.260ON29982998154010.0
KAFR0B027208.260ON2982302285300.0
NCAS0B050108.260ON2952302182390.0
Smik_12.1468.260ON2958301981460.0
Suva_10.1718.260ON2958301981220.0
NDAI0B019808.260ON2959301681150.0
Skud_12.1558.260ON2959301980630.0
YLR087C (CSF1)8.260ON2958301080490.0
CAGL0L12210g8.260ON2981304074200.0
TDEL0F038708.260ON2942304870250.0
ZYRO0C01694g8.260ON3006307465590.0
Kpol_392.78.260ON2995305463250.0
TPHA0J007308.260ON3046310257690.0
TBLA0E044208.260ON3148260055610.0
SAKL0H17072g8.260ON2997307154100.0
KLTH0G13728g8.260ON2966156829490.0
Kwal_YGOB_56.238088.260ON2941157327910.0
Kwal_56.23810singletonOFF2763136224470.0
Ecym_43108.260ON2943157822570.0
KLLA0F19096g8.260ON2923159720820.0
AGR088W8.260ON2887153820000.0
Kwal_56.23808singletonOFF62601611e-12
SAKL0H21868g4.107ON78260802.6
KLLA0B03894g4.373ON1558117776.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02030
         (2998 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  5937   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3290   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3178   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3142   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3133   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3130   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3110   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3105   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2862   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2710   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2531   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2440   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2226   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2146   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2088   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1140   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1079   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...   947   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   874   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   806   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   775   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    67   1e-12
SAKL0H21868g Chr8 (1908378..1910726) [2349 bp, 782 aa] {ON} high...    35   2.6  
KLLA0B03894g Chr2 complement(352195..356871) [4677 bp, 1558 aa] ...    34   6.5  

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 5937 bits (15401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2886/2998 (96%), Positives = 2886/2998 (96%)

Query: 1    MADTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKR 60
            MADTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKR
Sbjct: 1    MADTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKR 60

Query: 61   YRLKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNA 120
            YRLKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNA
Sbjct: 61   YRLKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNA 120

Query: 121  EDDDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF 180
            EDDDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF
Sbjct: 121  EDDDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF 180

Query: 181  TDRAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNY 240
            TDRA             KAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNY
Sbjct: 181  TDRASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNY 240

Query: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300
            LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS
Sbjct: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300

Query: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW 360
            LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW
Sbjct: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW 360

Query: 361  RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP 420
            RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP
Sbjct: 361  RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP 420

Query: 421  TLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKP 480
            TLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKP
Sbjct: 421  TLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKP 480

Query: 481  LQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSK 540
            LQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSK
Sbjct: 481  LQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSK 540

Query: 541  DSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEK 600
            DSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEK
Sbjct: 541  DSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEK 600

Query: 601  AKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYL 660
            AKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYL
Sbjct: 601  AKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYL 660

Query: 661  NVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNA 720
            NVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNA
Sbjct: 661  NVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNA 720

Query: 721  PPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIR 780
            PPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIR
Sbjct: 721  PPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIR 780

Query: 781  YLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEEDDK 840
            YLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEEDDK
Sbjct: 781  YLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEEDDK 840

Query: 841  VKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYY 900
            VKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYY
Sbjct: 841  VKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYY 900

Query: 901  MDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPT 960
            MDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPT
Sbjct: 901  MDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPT 960

Query: 961  YFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVK 1020
            YFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVK
Sbjct: 961  YFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVK 1020

Query: 1021 DFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKEL 1080
            DFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKEL
Sbjct: 1021 DFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKEL 1080

Query: 1081 SFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYG 1140
            SFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYG
Sbjct: 1081 SFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYG 1140

Query: 1141 SIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPD 1200
            SIV             EETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPD
Sbjct: 1141 SIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPD 1200

Query: 1201 TAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVID 1260
            TAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVID
Sbjct: 1201 TAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVID 1260

Query: 1261 SIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEK 1320
            SIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEK
Sbjct: 1261 SIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEK 1320

Query: 1321 NREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSII 1380
            NREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSII
Sbjct: 1321 NREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSII 1380

Query: 1381 LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ 1440
            LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ
Sbjct: 1381 LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ 1440

Query: 1441 ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA 1500
            ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA
Sbjct: 1441 ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA 1500

Query: 1501 SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITV 1560
            SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITV
Sbjct: 1501 SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITV 1560

Query: 1561 YTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNL 1620
            YTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNL
Sbjct: 1561 YTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNL 1620

Query: 1621 MNLVQQQEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIHSGKASFLWENP 1680
            MNLVQQQEDPALKSISSFSRSFKLNIA          VFGETSLTNTIHSGKASFLWENP
Sbjct: 1621 MNLVQQQEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIHSGKASFLWENP 1680

Query: 1681 KGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHPSIVANFQCDDI 1740
            KGPTKETASLVLYAKRCETSMKHRNSMLFENQITG            HPSIVANFQCDDI
Sbjct: 1681 KGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHPSIVANFQCDDI 1740

Query: 1741 NLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKINPFLLVDLD 1800
            NLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKINPFLLVDLD
Sbjct: 1741 NLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKINPFLLVDLD 1800

Query: 1801 FTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYF 1860
            FTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYF
Sbjct: 1801 FTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYF 1860

Query: 1861 RLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQV 1920
            RLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQV
Sbjct: 1861 RLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQV 1920

Query: 1921 LGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGE 1980
            LGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGE
Sbjct: 1921 LGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGE 1980

Query: 1981 IYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHL 2040
            IYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHL
Sbjct: 1981 IYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHL 2040

Query: 2041 RFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXXXXXXXXXXXXXXXX 2100
            RFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLP                     
Sbjct: 2041 RFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFG 2100

Query: 2101 XCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDT 2160
             CHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDT
Sbjct: 2101 SCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDT 2160

Query: 2161 FYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQ 2220
            FYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQ
Sbjct: 2161 FYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQ 2220

Query: 2221 SIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKEDAPRKDIAPFLSDI 2280
            SIQVFQELKKVLVNPLTQ                   TVPGKEKKEDAPRKDIAPFLSDI
Sbjct: 2221 SIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDAPRKDIAPFLSDI 2280

Query: 2281 RKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLIT 2340
            RKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLIT
Sbjct: 2281 RKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLIT 2340

Query: 2341 VNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSRPSQNIDYKRLLNSFDI 2400
            VNSTHNVLFARCAPLLMALSQDIQHMV            QRVSRPSQNIDYKRLLNSFDI
Sbjct: 2341 VNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDI 2400

Query: 2401 LFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRH 2460
            LFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRH
Sbjct: 2401 LFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRH 2460

Query: 2461 IFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLS 2520
            IFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLS
Sbjct: 2461 IFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLS 2520

Query: 2521 NLLRPKPMKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLIFANINGKVDXXXXXXXXXXXM 2580
            NLLRPKPMKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLIFANINGKVD           M
Sbjct: 2521 NLLRPKPMKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSM 2580

Query: 2581 RKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPYPLVA 2640
            RKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPYPLVA
Sbjct: 2581 RKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPYPLVA 2640

Query: 2641 LSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTA 2700
            LSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTA
Sbjct: 2641 LSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTA 2700

Query: 2701 LVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDI 2760
            LVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDI
Sbjct: 2701 LVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDI 2760

Query: 2761 NTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMD 2820
            NTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMD
Sbjct: 2761 NTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMD 2820

Query: 2821 EDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVR 2880
            EDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVR
Sbjct: 2821 EDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVR 2880

Query: 2881 WNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEP 2940
            WNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEP
Sbjct: 2881 WNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEP 2940

Query: 2941 QIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998
            QIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ
Sbjct: 2941 QIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3290 bits (8530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1607/3022 (53%), Positives = 2123/3022 (70%), Gaps = 75/3022 (2%)

Query: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65
            S+F S+ +  GK+FSWVFL+DWIL ++L ++V+FYVGRAIA+  S I EWLLWKR  +KV
Sbjct: 5    SEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRAHIKV 64

Query: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125
            NIESLR+SLLGGRIFFKN+TII KDYTIS L G ++WRYWL + R P +   L ++D +G
Sbjct: 65   NIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSY--HLESKDSNG 122

Query: 126  ASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTDRAX 185
             ++++NE+L CR +L CEG E+F+YNRT +YDN I +FSKEER KF++FL+E +F D + 
Sbjct: 123  VTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSS 182

Query: 186  XXXXXXXXXXXXKAQDEVEIK----SYTESSFDESNESQMANDRIFHDEETGKN-LFLNY 240
                          +   + K     + ES +   +     NDRIF   ++ K+ LFL  
Sbjct: 183  YSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQT 242

Query: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300
             P++I+V  AS   GNKFTPSL+I+S++   G++DYCQPKEKLD+YK KL ++  N +V+
Sbjct: 243  FPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVT 302

Query: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW 360
            +K NIGY EE+LLKFK+  GKLS+LW  F   T  + +PLGL+++KK R      F QKW
Sbjct: 303  VKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQKW 362

Query: 361  RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP 420
            +GLSLYK  +FE   +DLDDI+FD   HEYAKF+S++KCP+AI TYE+DIPG VPHGAHP
Sbjct: 363  QGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGAHP 422

Query: 421  TLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKP 480
            T S IDGPD+GNNGAPPT  L+IQ+FGGS+CYGPW QRQ+ FI S+LAP +SR + PVK 
Sbjct: 423  TNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPVKR 482

Query: 481  LQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSK 540
              PG  R+YT  KL I + +D TWRI TRE SKD  FL+HYK TN+DYRPFGW+DL+FSK
Sbjct: 483  RVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRFSK 542

Query: 541  DSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEK 600
            +SYA F FAL  T +G +N + IHL  +EIRSSVNHDI +K K  DFD+++ +PL WN++
Sbjct: 543  ESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWNDR 602

Query: 601  AKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYL 660
            A WTI++ S+QLETFLLREHITLIADT++DF++GEPTPYELFRP    INWK+D Y IYL
Sbjct: 603  ATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFIYL 662

Query: 661  NVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNA 720
            NVNDHNIVNNPLDFNENCYLS HGD L +++T+P + I A+  +I+YNI TPMFRL+LN 
Sbjct: 663  NVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLLNT 722

Query: 721  PPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIR 780
            PPWNTLNEFMK+KEVGR+YDF   G+YL+Y+ELDVDNVD I+IIC S+ T L CYGFVIR
Sbjct: 723  PPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFVIR 782

Query: 781  YLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSD--DASTFVSDFDKNNEED 838
            YL N+KMNYFGDFF+F+TSEEYT     +   E  +    SD  D     SD +   ++ 
Sbjct: 783  YLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESGMDDA 842

Query: 839  DKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDV 894
               ++P       +D+RR  NETDL+LTF++W+GA++LPETIYNCD C AL FGEL ID+
Sbjct: 843  ISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELIIDL 902

Query: 895  RSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGL 954
            RS+NYYMDLLASL+D ++ +Y+   P +IF++V   N    +   ++S+++IHGHRM+GL
Sbjct: 903  RSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMFGL 962

Query: 955  PPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTA 1014
            PP EPTYFCKWDFD+G + + SE DF+KG +TSF +IGFGF DLEN+LLY KEV++DMT+
Sbjct: 963  PPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDMTS 1022

Query: 1015 VTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNY 1074
            +TVN ++  + + N        L   ++ F +IDFE+  YS+R+D+ IP LK+S+YG + 
Sbjct: 1023 LTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGLDI 1082

Query: 1075 EASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVI 1134
            +  K+   FNF TK++ T+F   KN  +HR++QR+YIT+NDA FHR  F+LP S+Q   +
Sbjct: 1083 DG-KKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKEL 1141

Query: 1135 YQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEY-NTTSDCIILNLPYPDSTNLNSD 1193
            Y +LYGSIV              +T +FI++DFL EY +   D  I  +P+  +   N  
Sbjct: 1142 YNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQA 1201

Query: 1194 SFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGD 1253
            S +   D  P   S++ +  S     + DN VID  YIS+ I+P +  YIE L +  Y +
Sbjct: 1202 STHHEEDMDPLEFSNSTV--STEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEE 1259

Query: 1254 DDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEM 1313
            +  QVID IEI  +K LS FQEG SSI N K+R+L+ D++WG+RD  GIELYLD LDFEM
Sbjct: 1260 NIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEM 1319

Query: 1314 NEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAK 1373
            ++++IEK+REK L E+T L K  SIRAS++ + S    + +PPALSL+VEG + WS TA+
Sbjct: 1320 SQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAE 1379

Query: 1374 KVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLT 1433
            K +NSI   S D TIDE+Q+ WLF F  +Q + + +++ T   VQ   T SR++LIS+LT
Sbjct: 1380 KQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLT 1439

Query: 1434 VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQL 1493
             A+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHI+TY+P DW   V   L
Sbjct: 1440 AANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYL 1499

Query: 1494 KERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAF 1553
            KE+  N   +AK +FMSVFS+WRNWEFSDVARSYIY ++FL NQAEK ++++ +  K   
Sbjct: 1500 KEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNL 1559

Query: 1554 VSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDK 1613
             S ++T YTAG  +D +F++T +N+VFE+TP  TE+G ++EK+IN+TG++GS+KG  SD+
Sbjct: 1560 SSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKGNFSDE 1619

Query: 1614 MFKLHNLMNLVQQQEDPALKS----ISSFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIH 1669
            + +L  L+ L+ ++++   +S    + +  +SFKLN            V GE+ LTN I 
Sbjct: 1620 LLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRIL 1679

Query: 1670 SGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHP 1729
            +GK S L ++PK       S++LYAKR ET + HRN+ L ENQ+               P
Sbjct: 1680 NGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKP 1739

Query: 1730 SIVANFQCDDINLRVMPQTEVIVTFLQEFIAKF-NLVKESFETDDLPKPTPTNDSPKPTP 1788
            +++ + QC   +++ M +T  +V  ++E +    N+ K+   +D L +    N SPK   
Sbjct: 1740 TVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAE--GENKSPKKKL 1797

Query: 1789 TKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDL 1848
                    V+++  C  SNVS +IMPI PF  R ETKK + KF    +QN   ++WD+D 
Sbjct: 1798 KD------VEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDF 1851

Query: 1849 YLGSHLTKQQYFRLSLGNIIVGYT--NGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQ 1906
            +L S LTKQQYFR+S G+  + Y    G  +  I + +VSAS++KLTFSEP+R+L SFLQ
Sbjct: 1852 FLRSDLTKQQYFRISFGDFQITYNLIEGEFI--IVDANVSASMIKLTFSEPNRILSSFLQ 1909

Query: 1907 DEREVSRSVKKLQVLGNLFSSEPEINTIPAGAK-IDWRLNADIKYLGILIPVSTTFFVFE 1965
            DER  S S K L+ L      + E    PA  K + W L+ DIKY GIL+P+STT+FVFE
Sbjct: 1910 DERTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFE 1969

Query: 1966 MHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQK 2025
             H L+ S++D+D  E Y E DE   QVS++N++FLIKDR IPS LSR++D S   S IQK
Sbjct: 1970 THALVLSMSDID-TEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQK 2028

Query: 2026 IMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXX 2085
            +ME   S+Q+ES H R   SPYSLVR++WGG Q L L ++Y+     +LWD         
Sbjct: 2029 MMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDI---KASKL 2085

Query: 2086 XXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTL 2145
                             H+LSYNFC+GW+F     +  G++LG++RLFSAYE G GKLTL
Sbjct: 2086 KKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTL 2145

Query: 2146 VDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDV 2205
            VDAFFSV+ G TS TFY   +E +  NRS+LPN+QI YW+K +  MKDVFIR HGE LDV
Sbjct: 2146 VDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDV 2205

Query: 2206 NFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKK 2265
            +FL++F+ +IE+ LQS QVFQELK  L+ P T                         E  
Sbjct: 2206 SFLTTFITVIESMLQSFQVFQELKTSLIQPNTSTT----------------------ENN 2243

Query: 2266 EDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKN 2325
             +   K +APFLS+I+ VNCQFKYDGG+FKV+SFEDIES+L+PSFE+++PGV ID +YK+
Sbjct: 2244 TEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKH 2303

Query: 2326 NIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXX-XXXXXXXXXXQRVSR 2384
            NIG +KPH IR L+ + STHN LFA CAPL+    + I  MV               +S+
Sbjct: 2304 NIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSK 2363

Query: 2385 -PSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSE 2443
             PSQNIDYKRLL+ FDI FK+ SSEQKLSLSCEPKAKVQA+VGFDSF+  I+TN+LD +E
Sbjct: 2364 APSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETE 2423

Query: 2444 PLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFN 2503
            PL+F+L +K T+++I+HIFS+E S SFGLDLID+ FMFTHP+IINM+G  LIS+V++YFN
Sbjct: 2424 PLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFN 2483

Query: 2504 VKQLQNLYLFLDIWKLSNLLRPKPMKKP-----EDHHVAIDAPPSSPMDVGNIIPWCFTL 2558
            VKQLQNLYLF+DIWKLS+ +RP P  K      E+ H+ +      P ++   IPW FTL
Sbjct: 2484 VKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTL----PQPSNLYGEIPWSFTL 2539

Query: 2559 IFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVEL 2618
            IF NING  D           +++ W ASDHY+ KRQ++ A+ D +   +KGRLSGI EL
Sbjct: 2540 IFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFEL 2599

Query: 2619 DGALWAAEVNWPKYDDP--YPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERD 2676
            DGA W +EV+WPK      YPLV +S  I N+SLK AFDYHMFLIGT+    F LHSE+D
Sbjct: 2600 DGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKD 2659

Query: 2677 TSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDT 2736
              G MPDLLKV  TCE I++CSTALVAAN+LDLYNT+MRMRQD  + YLETLRES+T +T
Sbjct: 2660 IVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLET 2719

Query: 2737 KETVD-YKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGE 2795
            +   D Y+DIL+ LNL+QTDV  +I+ L +Q+SPI+LFD+EVLV+NI N+ A   T AGE
Sbjct: 2720 RGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGE 2779

Query: 2796 KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMH 2855
            KL+T L L++Y+ + +LS+SK E+DED VS ISV DYM YASKI GGTI ++PKL I+M 
Sbjct: 2780 KLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMT 2839

Query: 2856 TFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDE 2915
            ++Q+ NSDILEY Y+ TF DKIAV+WNLGPVNFIKEMWTTH+KALAVRRSQ+++ T    
Sbjct: 2840 SWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQT 2899

Query: 2916 EGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTV 2975
            + +V+KR+++EE +SKL Y+ IEEP+ID PQI+DLGDATP LEWFG+NRK+ P FTHQTV
Sbjct: 2900 DEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTV 2959

Query: 2976 IVPVQKLIHSAEKEYANIVGHS 2997
            +VPVQKL+H+AEK+YA+++ +S
Sbjct: 2960 VVPVQKLVHAAEKQYASLLDNS 2981

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3178 bits (8239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1557/3021 (51%), Positives = 2087/3021 (69%), Gaps = 96/3021 (3%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D VSQF  + L + ++FSW+FLV WILT+ILS++ +FY+GR IA+ I+FI EWLLWK  +
Sbjct: 2    DAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +KVNI+SLR+SLLGGRIFFKN+TII KD TIS L G I+WRYWLF  R P+F      E 
Sbjct: 62   VKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDET 121

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
                +  +N +L CR ++  EG+E+FLYN+TVAYDN I+MFSKEER +FE+FLNE + +D
Sbjct: 122  QTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSD 181

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNYLP 242
             A             K+ D+ +  +   +S D+S ES   NDR+F +EET  + FL +LP
Sbjct: 182  SATV-----------KSMDDSQFDTSESTSTDKS-ESSATNDRVFQEEETDTSSFLRFLP 229

Query: 243  LQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLK 302
            +Q  V+  S ++GNKFTPSLLIVSADSA+ +MD+ QPKEKLD+YK KL+ +  N   +LK
Sbjct: 230  IQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLK 289

Query: 303  QNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWRG 362
            QNIG++E+V +KFKL  GK+S++W++F +    + KPL  +   + +      F  KWRG
Sbjct: 290  QNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRG 349

Query: 363  LSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPTL 422
            L+LYK     + +ND+DDIEFD A HEYAKF+SI+K P+   T + D+PG VPHGAHPT+
Sbjct: 350  LALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTI 409

Query: 423  SSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQ 482
            S +DGPD+GN+GAPP + L+IQ+FGGS+C+GPWAQRQ   +  LL+P +SR  KPVK L 
Sbjct: 410  SVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLT 469

Query: 483  PGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDS 542
            PG RR+YT  ++ + + +D TWRIPTRESSKD EFL+HY+ TN +YRPFGW+DLKFSK++
Sbjct: 470  PGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKET 529

Query: 543  YASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAK 602
              +  FALC T DG +N +KIHL ++E RSSVNHDI +K K  DFD++  FPLGWN++A 
Sbjct: 530  TVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEAT 589

Query: 603  WTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNV 662
            WTIN+ SSQ+E F+LREHITLIADT++DFS+GEPTPYELFRPF+Y+INWK+DGYS+YLNV
Sbjct: 590  WTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNV 649

Query: 663  NDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAPP 722
            NDHNIVNNPLDFNENCYLSFHGD L++D  +PK  I AR TDISY I TPMFRL+LN PP
Sbjct: 650  NDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPP 709

Query: 723  WNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYL 782
            WNTLNEFMKHKEVGR+YDF+  G+YLIY++LD+DNVD I + C+SK T L CYGFV+RYL
Sbjct: 710  WNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYL 769

Query: 783  MNIKMNYFGDFFHFVTSEEYTEKISSK----GYGEGSLFEKYSDDASTFVSDFDKNNEED 838
            +N+KMNYFGDFFHFVTSEEYT  I +      Y   S  ++ S  +   +   D      
Sbjct: 770  INVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRR 829

Query: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898
               ++ R  +D++R TNETDLW TF +WEGALLLPETIYNCDPC+ LHFGEL ID+RS N
Sbjct: 830  LHTELQR--SDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCN 887

Query: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958
            YYMDLLA+++D+ +++Y +  P+EIFE + + NG +   H  +S++ IHGHRMYGLPP E
Sbjct: 888  YYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPME 947

Query: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018
            PTYFC+WDFDLGT+ + S+++F++G  +SF +IGFG+ DLEN+LLYEKE  DDMT+VTVN
Sbjct: 948  PTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVN 1007

Query: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078
            ++   +++  P+L+  A   LNN+ F  IDFENEKYSTR+D+ IP L+ SL+    + + 
Sbjct: 1008 LEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTT 1067

Query: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138
            +   F  ETK+  TNF   ++  +HR  QR+YI ++DAP+HRC FILP  YQ++  YQ+L
Sbjct: 1068 K-KLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQEL 1126

Query: 1139 YGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYN----TTSDCIILNLPYPD---STNLN 1191
            +G+I                T +FII+D L E+     T+S      +P+ D   +T+++
Sbjct: 1127 FGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSP---FRMPFSDQDYATDVS 1183

Query: 1192 SDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFY 1251
             D      D          I+       ERD+++ID  +ISI I P++   I   L  F 
Sbjct: 1184 DDETEEDIDPLEFNTPSEAIQNDKC---ERDSFIIDVSFISIEICPDILDSIGTFLMLFS 1240

Query: 1252 GDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDF 1311
             ++  Q+ID IEI  V RLSN +EG   + N KI IL+ D+FWG R   G+ +YLD +DF
Sbjct: 1241 TENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDF 1300

Query: 1312 EMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTT 1371
             M EK++E+N+EK L E+T L K+ S+R +VN   +  K E +PPALSL++EG + WS+T
Sbjct: 1301 AMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSST 1360

Query: 1372 AKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISR 1431
             +  +NS+ + S D T+DE Q+ WLF +F +Q   I  ++KT + +QK + +SRKELIS 
Sbjct: 1361 VEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISS 1420

Query: 1432 LTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAK 1491
            LT ASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI+TYLP+DW+ T+ +
Sbjct: 1421 LTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINR 1480

Query: 1492 QLKERKYNA-SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWK 1550
             L + K  A ++DAK IF+SVFS+WRNWEFSD+ARSYIY K+FL   + ++  T  K   
Sbjct: 1481 SLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSIT 1540

Query: 1551 AAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKI 1610
                S ++TVY+AG  V+H+FI+T++NL+ E    T++S  ++E + N+TG LG+ KGK+
Sbjct: 1541 IKIASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKL 1600

Query: 1611 SDKMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIHS 1670
            SDK+  + NL+  ++  +    K    F +SFKLN              G T L + +  
Sbjct: 1601 SDKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFG 1660

Query: 1671 GKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHPS 1730
             + S LWE+PK  T +  SL +Y +R E  +KH N+ L E QI               P+
Sbjct: 1661 ARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPT 1720

Query: 1731 IVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTK 1790
            I+ N QC D++L  M  T+++V  ++E +   + +++        +     +S  P P K
Sbjct: 1721 ILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKP-K 1779

Query: 1791 INPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYL 1850
            +N  L      TCFF+N+S ++MPI PF  R E K+++  F+   +     ++WD+D+YL
Sbjct: 1780 VNTIL------TCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYL 1833

Query: 1851 GSHLTKQQYFRLSLGNIIVGYTNGRLVNTIH--NLDVSASIVKLTFSEPHRMLFSFLQDE 1908
             SHLTKQQYFR S G++ +    G +VN  +  NL +SASI+KLT S+  +++ SFLQDE
Sbjct: 1834 TSHLTKQQYFRFSFGDLQL---KGNMVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDE 1890

Query: 1909 REVSRSVKKLQVLGNLFSSEPEINTIPA--GAKIDWRLNADIKYLGILIPVSTTFFVFEM 1966
            + ++ S++    L +LF       + P     K  W ++ +I Y G+L P+ + +F+FE+
Sbjct: 1891 KILTESIEDFITL-DLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFEL 1949

Query: 1967 HTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKI 2026
              LLASL  +  G       + SGQ SV+N+LF IK+R +P  LS+++D S K+SA+QK 
Sbjct: 1950 RMLLASLTKM--GSDIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKK 2007

Query: 2027 MESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXX 2086
              + ++YQIES H R C SP SLVR+LW  +Q+     +Y+ HH  N WD          
Sbjct: 2008 KNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDL-----RSKL 2062

Query: 2087 XXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLV 2146
                            HILSYNFCVGWLF  +  ++ GLILGYNRLFSAYEK  GKLTLV
Sbjct: 2063 NNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLV 2122

Query: 2147 DAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVN 2206
            D FFS++NG +SD F+S+G E+DKYNRS+LPN+QI YW K A  M+D+F+R HGE LDV 
Sbjct: 2123 DVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVT 2182

Query: 2207 FLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKE 2266
            FLSS++ +IE+ L S+Q FQELKK L+  L                       P K+K  
Sbjct: 2183 FLSSYLDVIESALTSVQTFQELKKDLIPGL-----------------------PKKQKVN 2219

Query: 2267 DAPRKD---IAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDY 2323
            D    +   ++PFL++IR ++CQFKYDGG+FK++S ED E+  +PSFE+ SP V IDL+Y
Sbjct: 2220 DDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNY 2279

Query: 2324 KNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVS 2383
            K+     K H IR+LI +NSTHN+L+A+CAPLL    + IQ MV              +S
Sbjct: 2280 KHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHSSSEEST----LS 2335

Query: 2384 RP-SQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTS 2442
            +P SQN+DYKRLL+SFDI  KI S++Q+LSLSCEPKAKVQA++GF SF+F + TNDLD +
Sbjct: 2336 KPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAA 2395

Query: 2443 EPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYF 2502
            EPLSF+L V+ T ++I+HIFSRE S S G+D +DVT MFTHP++IN+ G  LIS++ ++F
Sbjct: 2396 EPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFF 2455

Query: 2503 NVKQLQNLYLFLDIWKLSNLLRPKP----MKKPEDHHVAIDAPPSSPMDVGNIIPWCFTL 2558
            NVKQLQNLYLFLDIW+LS+LL+ KP    +K   D  ++I A  S P    +IIPWCFTL
Sbjct: 2456 NVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSI-AQLSDP---ESIIPWCFTL 2511

Query: 2559 IFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVEL 2618
            IF N+ G VD           +++ WFA+DHY++ R++LHA+ D   L++KGRLSGI EL
Sbjct: 2512 IFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFEL 2571

Query: 2619 DGALWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERD 2676
             GA W +EVNWP     + +PLV+++  I  IS K AFDYHMFLIG + NT  HLHSE+D
Sbjct: 2572 KGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKD 2631

Query: 2677 TSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDT 2736
             +G MPDLLKV   CE I +CSTALVAAN+LD+YNT MRMRQD  +SY+ETLRESN  ++
Sbjct: 2632 VNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAES 2691

Query: 2737 KETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEK 2796
            K  ++Y DIL+ LNL+QTDV VDI TLN+QISPI+LFDVEVLV+ I ++ A  +TH+G+K
Sbjct: 2692 KPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKK 2751

Query: 2797 LETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHT 2856
            L T L +Q+Y+A  SLS+SK EMDE  VSKISV++Y+ YASKIVGGTI +IPKL +SM T
Sbjct: 2752 LMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTT 2811

Query: 2857 FQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEE 2916
            FQ+  SDILEY Y   F DK++VRWNLGP+NFIKEMWTTHI+A+AVRRSQ +    G  E
Sbjct: 2812 FQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSE 2871

Query: 2917 GDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVI 2976
             DVEKR+++EE  S+  Y+A+E P+ID PQI+DLGDATP +EWFG+NRK+FP FTHQT +
Sbjct: 2872 EDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAV 2931

Query: 2977 VPVQKLIHSAEKEYANIVGHS 2997
              VQKL++SAE+EYANI+G S
Sbjct: 2932 FLVQKLVYSAEREYANILGSS 2952

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3142 bits (8146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1524/3019 (50%), Positives = 2087/3019 (69%), Gaps = 93/3019 (3%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            + VSQ   + L   KDFSWVFLVDWILT++  +T++FY+GR  A+ +SFI EWLLWKR +
Sbjct: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+N+E+LRVSLLGGRI FK+L++I KDYTIS L G I+W+YWL   R  + +      D
Sbjct: 62   VKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELI------D 115

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
            ++ +  + N KL C+  LECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 116  NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKN-LFLNYL 241
                            + D+++ +  +ES++  ++++ + NDR + + + GK+  FL +L
Sbjct: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFL 224

Query: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301
            P+++  S  S ++GNKFTPS++I+S +S EG++D   PKE++D+Y+ K  M+ KN  +S+
Sbjct: 225  PIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISI 284

Query: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361
            KQNIGY++ + LKFKL TGK+SKLW  F++    V KP+   R KKN  S   +F+QKW+
Sbjct: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWK 344

Query: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421
            GLSLYK    E   NDLDDIEFDL  HEYAKFTSI+KCP+  ++Y+ D+PG VPHGAHPT
Sbjct: 345  GLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPT 404

Query: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481
            +S IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 405  ISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 464

Query: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541
             PG RR+YTLF++ I + ED TWRIPTRE+SKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 465  PPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKD 524

Query: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601
            +YA+FN ++C T +G QN   +H  ++EIRSSVNHDI +KSK  + D ++G+PLGWN KA
Sbjct: 525  TYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKA 584

Query: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 585  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLN 644

Query: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721
            VNDHNIVNNPLDFNENCYLS HGD L +D+TVP++ I    TDISY I TPMFR+MLN P
Sbjct: 645  VNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTP 704

Query: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781
            PWNTLNEFMKHKEVGRAYDF   G YL+Y+ELD+DNVD + I C+S STVLHCYGFV+RY
Sbjct: 705  PWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRY 764

Query: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD----KNNEE 837
            L N+KMNYFG+FF+FVTSEEYT  + ++  G+ +      D AST  S +     KNN E
Sbjct: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSE 824

Query: 838  DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRST 897
                K P   +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS 
Sbjct: 825  ---AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSC 881

Query: 898  NYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPT 957
            NYYMD++A LD   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPT
Sbjct: 882  NYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPT 941

Query: 958  EPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTV 1017
            EPTYFC+WD +LG + ++S+V+F+KG  +SF KIGFG++DLEN+LLY+ E +DDMT++TV
Sbjct: 942  EPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTV 1001

Query: 1018 NVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEAS 1077
            + +  +I + +P + S++ +   ++ F  IDFENE YS R+D+++P LK+SL     +  
Sbjct: 1002 HAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGV 1061

Query: 1078 KELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQK 1137
             ++SF  FETK+ FTNF  YK+  + R+ QR YIT +D+P+HRC F+LP  YQ+S  YQK
Sbjct: 1062 -DMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQK 1120

Query: 1138 LYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNS 1197
            LYG+I               +T +FII+D + EY T            ++ N   DSF  
Sbjct: 1121 LYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYAT----------LLEAANPFKDSFAE 1170

Query: 1198 YPDTAPHT------------LSDTIIRKSPLPE---DERDNYVIDFRYISISIDPELFFY 1242
             P T   +             S +  +     E   DE+DNYV+D  YI + IDP LF +
Sbjct: 1171 TPSTVEPSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVF 1230

Query: 1243 IEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGI 1302
             + LL   Y ++  QV+D IEIG+VKRLSN QEGI+SI+N  I I + ++ W +    G 
Sbjct: 1231 TKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGF 1290

Query: 1303 ELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMV 1362
            ELYLD +D++M EKS+EKNR   L EV  L ++ ++R +VN K +   +E +PPALSL +
Sbjct: 1291 ELYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGL 1350

Query: 1363 EGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRT 1422
            EG + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  L+  V  +F  +Q  RT
Sbjct: 1351 EGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRT 1410

Query: 1423 QSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLP 1482
             S+ ELIS LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLP
Sbjct: 1411 SSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1470

Query: 1483 DDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQ 1542
            DDW   + K LKERKY ++ DAK+IFMSVFS+WRNWEFSDVARSYIY K+F  +  + +Q
Sbjct: 1471 DDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQ 1530

Query: 1543 KTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGN 1602
              + K  K    S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG 
Sbjct: 1531 NLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGR 1590

Query: 1603 LGSIKGKISDKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGE 1661
            +GS+KGK SD++ KL +L+ LV    ED      +  S+ F++N            V  E
Sbjct: 1591 IGSVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDE 1650

Query: 1662 TSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXX 1721
            T L +    G+ S LWEN K  T +  S+V+++++ E  +KH + +L E Q+        
Sbjct: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILAT 1710

Query: 1722 XXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTN 1781
                   P+I+ N QC D++ R M  TE  VT + E       +KE      +     + 
Sbjct: 1711 TEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKER-----IKFKPKSK 1765

Query: 1782 DSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQF 1841
               +    KIN  L      TC+FSNVS +IMP+ PF  R E K+++  F+   +     
Sbjct: 1766 KKSQFVGQKINTVL------TCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILI 1819

Query: 1842 NIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRML 1901
            +IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R++
Sbjct: 1820 SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIV 1879

Query: 1902 FSFLQDEREVSRSVKKLQVLGNLF--SSEPEINTIPAGAKIDWRLNADIKYLGILIPVST 1959
             SFLQDE+  S+ +  L  L +LF  S+ P+         I+W L+  I Y GILIPV++
Sbjct: 1880 NSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIPVAS 1939

Query: 1960 TFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFK 2019
            T+FVFE+H LL SL + + G +  E  + +GQ S++NILFLIK+R++P  LS+++D S K
Sbjct: 1940 TYFVFELHMLLLSLTNTNNGMLPEET-KVTGQFSIENILFLIKERSLPIGLSKVLDFSIK 1998

Query: 2020 ISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLP 2079
            +S +Q+ +++  S+Q+ES H R C SP SL+R++WG H+LL L  +Y +HH+ N+W+   
Sbjct: 1999 VSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNI-- 2056

Query: 2080 XXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKG 2139
                                   HILSY FC+GWLFQ    +D GL+LGYNRLFSAYE+ 
Sbjct: 2057 ---KMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERD 2113

Query: 2140 CGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLH 2199
             GK T+VD+FFSV+NG TS TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD F R H
Sbjct: 2114 FGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2173

Query: 2200 GETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTV 2259
            GE LDVNF+ SF+ +I++TLQS++ FQELK+ +++                        +
Sbjct: 2174 GEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILD-------------VSENSHSEDSNI 2220

Query: 2260 PGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319
                  E+AP   +APFL++IR VN  FKYDGG+F+VY++EDIE+  +PSFEI+SP VTI
Sbjct: 2221 YAASSVENAP-SSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTI 2279

Query: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXX 2379
            +  YK++   V+PH IRTLITV+ THN L+A CAPLLM  S+ +Q M+            
Sbjct: 2280 NCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMI----KKHSTDEK 2335

Query: 2380 QRVSRPS-QNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTND 2438
               ++PS QN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+
Sbjct: 2336 PNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNE 2395

Query: 2439 LDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDV 2498
             D+  PL F+L +++T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD+
Sbjct: 2396 FDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDL 2455

Query: 2499 EVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNIIPWCFT 2557
             V+FNVKQLQNLYLFLDIW+ S++L  +P ++  +  + + +  S S +D+G  IPWCFT
Sbjct: 2456 NVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFT 2515

Query: 2558 LIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVE 2617
            LIF N++G VD            ++ W A+DHY+ KRQLLHA+ D I LT++GRLSG+ E
Sbjct: 2516 LIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFE 2575

Query: 2618 LDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSER 2675
            +  A W +EV W   K  + +PLV+ S  I ++++K AFDYHMFLIGT+ N  F LH+E+
Sbjct: 2576 VANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEK 2635

Query: 2676 DTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTD 2735
            D  G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR+SN  +
Sbjct: 2636 DAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGE 2695

Query: 2736 TKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGE 2795
            +++ V YKDIL+ L L++TD+ V I++L VQISPISLFDVEVLVV I  V    +TH+G+
Sbjct: 2696 SRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGK 2755

Query: 2796 KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMH 2855
            KL+T L LQ+ +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPKL + M 
Sbjct: 2756 KLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMT 2815

Query: 2856 TFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDE 2915
            T Q+  ++ LEY +  +F DKI+VRWNLGPVNFIKEMWTTH+KALAVRRSQ    + G  
Sbjct: 2816 TLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQT 2875

Query: 2916 EGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTV 2975
            E ++E+ +  EET SK  YIA+EEPQI+ PQI+DLGDATP +EWFG+NRK+FP FTHQT 
Sbjct: 2876 EEELEESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTA 2935

Query: 2976 IVPVQKLIHSAEKEYANIV 2994
            ++PVQKL++ AEK+Y  I+
Sbjct: 2936 VIPVQKLVYLAEKQYVKIL 2954

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3133 bits (8122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1524/3019 (50%), Positives = 2093/3019 (69%), Gaps = 93/3019 (3%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            + VSQ   + L   KDFSWVFLVDWILT+I  +T +FY+GR  A+ +SFI EWLLWKR +
Sbjct: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+N+E+LR+SLLGGRI+FK+L++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 62   IKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELI------E 115

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
            ++  S  +N +L C+ LLECEG+E F+YNRT+AYDN I + SK+ER KFE++LNEH F +
Sbjct: 116  NEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPE 175

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGK-NLFLNYL 241
                            + D+++ +  +ES++  +++S + NDR + +   GK    L++ 
Sbjct: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFF 224

Query: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301
            P+++K++  S ++GNKFTPS++I+S ++ EG++D   PKE+LD+Y+ K  ++ KN  +S+
Sbjct: 225  PIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISI 284

Query: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361
            KQNIGY++ + LKFKL TGK+SKLW  FV+    V KP+   R KK  PS  A F QKW+
Sbjct: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDA-FFQKWK 343

Query: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421
            GLSLYK    +   +DLDDIEFD   HEYAKFTSI+KCP+  L+Y+ D+PG VPHGAHPT
Sbjct: 344  GLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPT 403

Query: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 404  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 463

Query: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541
             PG RR+YTLF++ I++ ED TWRIPTRESSKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 464  PPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKD 523

Query: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601
            +YA+FN ++C T +G +N   +H  ++EIRSSVNHDI +KSK  D D ++G+PLGWN   
Sbjct: 524  TYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNT 583

Query: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW++DGYSIYLN
Sbjct: 584  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLN 643

Query: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721
            VNDHNIVNNPLDFNENCYLS HGD L +DITVP++ I    TD+SY I TPMFR+MLN P
Sbjct: 644  VNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTP 703

Query: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781
            PWNTLNEFMKHKEVGR+YDF   G YL+Y+ELD+DNVD +TI C+S STVLHCYGFV+RY
Sbjct: 704  PWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRY 763

Query: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD----KNNEE 837
            L+N+KMNYFG+FF+FVTSEEYT  + ++  GE        D AST  S++     KN+ E
Sbjct: 764  LINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAE 823

Query: 838  DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRST 897
            D+    P   +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS 
Sbjct: 824  DNG---PMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSC 880

Query: 898  NYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPT 957
            NYYMD++A L+   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPT
Sbjct: 881  NYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPT 940

Query: 958  EPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTV 1017
            EPTYFC+WD +LG + + S+++F+KG  TSF K+GFG++DLEN+LLY+ E ++DMT++TV
Sbjct: 941  EPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTV 1000

Query: 1018 NVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEAS 1077
            + +   I +++P + S++ + + ++ F  IDFENE+YS R+DI++P L +SL     + +
Sbjct: 1001 HAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGT 1060

Query: 1078 KELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQK 1137
               SF NFETK+ FTNF  YK+  + R+ QR YI MND+P+HRC F+LP  YQ+S  YQK
Sbjct: 1061 NT-SFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQK 1119

Query: 1138 LYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNS 1197
            LYG+I               +T ++II+D + EY T            ++TN   D F  
Sbjct: 1120 LYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYAT----------LLEATNPFKDLFAE 1169

Query: 1198 YPDT-----APHTLSDTIIRKSPLP----------EDERDNYVIDFRYISISIDPELFFY 1242
             P T     A  T  D      PL             ERDNYVID  YI + IDP LF +
Sbjct: 1170 TPSTVEPLRASFTEDDDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVF 1229

Query: 1243 IEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGI 1302
             + LL  FY +D  QV+D IEIG+VKRLSN QEGI SI+N  I + + ++ W +    G 
Sbjct: 1230 TKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGF 1289

Query: 1303 ELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMV 1362
            ELYLD ++++M+EKS+EKNR     EV  L K+ ++RA+VN K +   +E +PPALSL +
Sbjct: 1290 ELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGL 1349

Query: 1363 EGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRT 1422
            EG + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI  V  +   +Q  R+
Sbjct: 1350 EGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRS 1409

Query: 1423 QSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLP 1482
             ++ ELIS+LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLP
Sbjct: 1410 STKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1469

Query: 1483 DDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQ 1542
            DDW   + K LKERKY+ +KDAK+IFMSVFS+WRNWEFSDVARSYIY K+FLA+ A+ + 
Sbjct: 1470 DDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKG 1529

Query: 1543 KTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGN 1602
             ++ K  K    S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG 
Sbjct: 1530 NSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGK 1589

Query: 1603 LGSIKGKISDKMFKLHNLMNL-VQQQEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGE 1661
            +GS+KGK SDK+ KL +L+ L V   ED      +  S+ FK+N            V  +
Sbjct: 1590 VGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDK 1649

Query: 1662 TSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXX 1721
            T + +    G+ S LWEN K  T +  SLV+++++ E  +KH +++L E Q+        
Sbjct: 1650 TKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILAT 1709

Query: 1722 XXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTN 1781
                   P+I+ N QC D++ R M  TE +V  + E       VKE  +     KP   N
Sbjct: 1710 TEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKF----KPKSKN 1765

Query: 1782 DSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQF 1841
             S +   ++IN  L      +C+FSNVS +IMP+ PF  R E K+++  F+   +     
Sbjct: 1766 KS-QFVGSRINTVL------SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILL 1818

Query: 1842 NIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRML 1901
            +IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R++
Sbjct: 1819 SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIV 1878

Query: 1902 FSFLQDEREVSRSVKKLQVLGNLFSSEPEINT---IPAGAKIDWRLNADIKYLGILIPVS 1958
             SFLQDE+  S+ +  L  L +LF +   +N     PA   I+W L+ +I Y GIL+PV+
Sbjct: 1879 NSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKETPAKM-INWTLDTNISYFGILVPVA 1937

Query: 1959 TTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSF 2018
            +T+FVFE+H LL SL + + G +  E    +GQ+S++NILFLIK+R++P  LS+++D S 
Sbjct: 1938 STYFVFELHMLLLSLTNTNNG-LLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSI 1996

Query: 2019 KISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFL 2078
            K+S +Q+  ++  S+Q+ES H R C SP SL+R++WG ++LL +  +Y + H+ N+W+  
Sbjct: 1997 KVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNI- 2055

Query: 2079 PXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEK 2138
                                    HILSY FC+GWLFQ     D GL+ GYNRLFSAYEK
Sbjct: 2056 ----RMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEK 2111

Query: 2139 GCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRL 2198
              GK T+VDAFFSVSNG TS TF+S+GNE++KYNRSFLPN+QI YW K   E+KD F R 
Sbjct: 2112 DFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRF 2171

Query: 2199 HGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXT 2258
            HGE LDVNFL SF+ +I++TLQSI+ FQELKK +++                       +
Sbjct: 2172 HGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILD--------------MPHESNMENS 2217

Query: 2259 VPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVT 2318
             P      +     +APFL +IR VNC FKYDGG+F+VY+++DIE+  +PSFE++SP VT
Sbjct: 2218 SPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVT 2277

Query: 2319 IDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXX 2378
            I+  YK++    KPH IRTLITV+ THN L+A CAPLLM  S+ +Q+M+           
Sbjct: 2278 INCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPN 2337

Query: 2379 XQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTND 2438
              + S  +QN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+
Sbjct: 2338 FTKPS--TQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNE 2395

Query: 2439 LDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDV 2498
             D+ +PL F+L ++ T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G  L+SDV
Sbjct: 2396 FDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDV 2455

Query: 2499 EVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNIIPWCFT 2557
             V+FNVKQLQNLYLFLDIW+ S++L  +P ++P +  V +    S S +DVG  IPWCFT
Sbjct: 2456 SVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFT 2515

Query: 2558 LIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVE 2617
            LIF N++G VD            ++ W A+DHY+ KRQLLHA+ D I LT++GRLSG+ E
Sbjct: 2516 LIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFE 2575

Query: 2618 LDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSER 2675
            +  A W +EV WP     + +PLV+ S  I ++++K AFDYHMFLIGT+ N  FHLH+E+
Sbjct: 2576 VANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEK 2635

Query: 2676 DTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTD 2735
            D+ G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR+SN ++
Sbjct: 2636 DSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSE 2695

Query: 2736 TKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGE 2795
            +K+ + YKDIL+ L L++TD+ V+I++L VQISPISLFDVEVLVV I  V    +TH+G+
Sbjct: 2696 SKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGK 2755

Query: 2796 KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMH 2855
            KL+T L LQ+ +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPKL + M 
Sbjct: 2756 KLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMT 2815

Query: 2856 TFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDE 2915
            T Q+  ++ LEY +  +F DKI+VRWNLGP+NFIKEMWTTH+KALAVRRSQ+   + G  
Sbjct: 2816 TLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQT 2875

Query: 2916 EGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTV 2975
            E ++E+ ++ EE  SK  YIA+EEPQI+ PQI+DLG+ATP +EWFG+NRK+ P FTHQT 
Sbjct: 2876 EEELEESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTA 2935

Query: 2976 IVPVQKLIHSAEKEYANIV 2994
            ++PVQKL++ AEK+Y  I+
Sbjct: 2936 VIPVQKLVYLAEKQYVKIL 2954

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3130 bits (8115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1557/3016 (51%), Positives = 2060/3016 (68%), Gaps = 83/3016 (2%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D +SQF  I L K KDFSWVFLVDWIL LI+++ V+FY+ R +A+ ISFI EW LWKR  
Sbjct: 2    DAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSN 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+NIES+R+S LGGR+FFKN+ II +DYTISFL   ++WRYWL   R   + T    E 
Sbjct: 62   VKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDT---PEL 118

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
             D AS   + KL CR  LE EG+E+F+YNR VAYDN I  FSKEER +FE+FLNE VFTD
Sbjct: 119  PDKAS-ANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTD 177

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDES----NESQMANDRIFHDEETGKNLFL 238
                           KA+      +  E +F+ +    ++S   NDR+F +E + +  FL
Sbjct: 178  --------------SKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFL 223

Query: 239  NYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVS 298
            ++LP+  KVSH S ++GNKFTPSL+I S  S  G++D CQP EKLD+YK +  +D K  +
Sbjct: 224  DFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFA 283

Query: 299  VSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQ 358
            + +KQNIG+NEE  +KFK+   ++SK+W  F K        + LS  + N+ S    F++
Sbjct: 284  IDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYE 343

Query: 359  KWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGA 418
            KWRGLSLY+  +F    +D++DI+FD A HEYAKF+SI++ P+AI T+E DIPG VPHGA
Sbjct: 344  KWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGA 403

Query: 419  HPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPV 478
            HPTL++ DGPD+GN+GAPP F LEIQ+ GGS+C+GPWAQRQ+  +  LL+P  SR+ KP 
Sbjct: 404  HPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPT 463

Query: 479  KPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKF 538
            K L PG  R+YT FK  I   E+ TWRIPTRESSKD EFL+HY+ TNE+YRPFGW+DLKF
Sbjct: 464  KRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKF 523

Query: 539  SKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWN 598
            SKD+Y     A C T +G +NT+ IHLGD+EIRSSVNHDI +K KS +F +++GFPLGWN
Sbjct: 524  SKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWN 583

Query: 599  EKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSI 658
            E+A WTI++ S+QLE F+LREHITLIADT++DFS+GEPTPYELFRPF+Y INWK++GYS+
Sbjct: 584  EEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSL 643

Query: 659  YLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLML 718
            YLNVNDHNIVNNPLDFNENCYLSFHGDIL +D+ VPK  + A  T++SY IYTPMFRL+L
Sbjct: 644  YLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVL 703

Query: 719  NAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFV 778
            N PPWNTLNEFMK+KEVGR++DF+ TG+YLIY+ELD+DNVD I I CSS+STVL CYGFV
Sbjct: 704  NTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFV 763

Query: 779  IRYLMNIKMNYFGDFFHFVTSEEYTEKISSK----GYGEGSLFE---KYSDDASTFVSDF 831
            IRYL N+KMNYFGDFFHFVTSEEYT +I +      + +  L+E     S   S   S  
Sbjct: 764  IRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSV 823

Query: 832  DKNNEEDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELA 891
             K    D K+K     +D++R TNETDLW TF +WEGA+LLPETIYNCDPCI LHFGEL 
Sbjct: 824  RKEQTGDSKIK----RSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELL 879

Query: 892  IDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRM 951
            ID RS NYYMDLLAS++DI LR+Y   Q NEI+E+VRQ NG   K +  +S++ IH HRM
Sbjct: 880  IDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRM 939

Query: 952  YGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDD 1011
            YGLPP EPTYFC+WDF LGT+ L  ++ F++G +TSF KI FG  DLEN+LLYEKEV+DD
Sbjct: 940  YGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDD 999

Query: 1012 MTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYG 1071
            MT++TV+VK   I+I   E+ +        + F NI+FENEKY TR+D+RIP+  L +Y 
Sbjct: 1000 MTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYT 1059

Query: 1072 YNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQN 1131
             N   +K+   F FETK+N +NF    +   H++ Q++YIT++DAP+HRC FILP S Q+
Sbjct: 1060 MN--GAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQD 1117

Query: 1132 SVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCI-ILNLPYPDSTNL 1190
            S IYQ L+GSI                T ++I+ D L  +    +      +P+  +T+ 
Sbjct: 1118 SEIYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSP 1177

Query: 1191 NSDSFNSYPDTAPHTLSDTIIRKSPLPEDER----DNYVIDFRYISISIDPELFFYIEKL 1246
               +     DT      D +  K+    D      DN+VID  Y S+SI+P L+ Y++  
Sbjct: 1178 KLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNC 1237

Query: 1247 LNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYL 1306
              HF   D  Q++D IEIG+V  LS+ QEGI +  N K++IL+ D+FWG R   GI LYL
Sbjct: 1238 REHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYL 1297

Query: 1307 DTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVK 1366
            D +D EM +K +E+N E  +TEVT L K+ S+RA++N   S GK + +PPALSL++EG +
Sbjct: 1298 DRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSE 1357

Query: 1367 FWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRK 1426
             WS      +NS+ + S D TIDE Q+ WLF +   Q  L   +    + +Q+ R+ +RK
Sbjct: 1358 IWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRK 1417

Query: 1427 ELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWN 1486
            +L+S+L VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI+TYLP DW 
Sbjct: 1418 QLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWL 1477

Query: 1487 ETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVN 1546
              + +   ++  +   D  + F+SVFS+WRNWEFSD+ARSYIY  +F    ++KQ+ ++ 
Sbjct: 1478 RVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSME 1537

Query: 1547 KGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSI 1606
               K    S++ TVY+ G  V+H+FI+T++N+V E  P  ++S   QEK+INVTG+LG+I
Sbjct: 1538 NSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTI 1597

Query: 1607 KGKISDKMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGETSLTN 1666
            KGK S K+  L  L+  +  +++  LK  + F R FKLN+           V G + + +
Sbjct: 1598 KGKTSHKLINLKKLLPELSMKKN--LKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMS 1655

Query: 1667 TIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXX 1726
             +  GK S LWE+PK    +  S+ +YA+R E  MKH N +L E+Q+             
Sbjct: 1656 RVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWS 1715

Query: 1727 XHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKP 1786
              P+++ N QC DI+ R M  T+V+   + E I     +++ F +D        +  P  
Sbjct: 1716 YKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPV- 1774

Query: 1787 TPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDS 1846
               KIN  L      TC+F+NV+L+IMP+ PF FR   K+++  F+   + +   ++WD+
Sbjct: 1775 MEQKINMVL------TCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDT 1828

Query: 1847 DLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQ 1906
            DL+L SHLTK++YFR S GNI +        N   N+DVSASIVKLT  +  R++ SFLQ
Sbjct: 1829 DLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQ 1888

Query: 1907 DEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEM 1966
            DE+ +  S+++   L      +P  +T  +G  + W L ++I Y G+L+P+S+T+F+ E+
Sbjct: 1889 DEKILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILEL 1948

Query: 1967 HTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKI 2026
            H LL SL  +    I  + +  SGQ S+DN+ FL+K++++P+ LS+I+D S K+S +QK+
Sbjct: 1949 HMLLMSLNKIQ--GISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKL 2006

Query: 2027 MESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXX 2086
              +  S+QIESPH R C SP SL  +LW G+Q L  +  Y + H+   W+          
Sbjct: 2007 KVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALT-NIRYYKEHTSVAWE-----KVINF 2060

Query: 2087 XXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLV 2146
                            H+LSYNFCVGWLF    D + GLI+GY+RLFSAYEK  GKLTL+
Sbjct: 2061 KNTNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLI 2120

Query: 2147 DAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVN 2206
            DA+FSV+NG+TSDTF+S G+E+D+YNRS+LPN+QI YWLK    ++DV++R HGE LDVN
Sbjct: 2121 DAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVN 2180

Query: 2207 FLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKE 2266
            FL+SF+ +IE++L+SIQ FQELK+ LV   +                         +   
Sbjct: 2181 FLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQT-------------------QSTT 2221

Query: 2267 DAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNN 2326
              P  DI+PF + IR +NCQF+YDGG+FKV+S  +  ++L PSFEI+SP V ID++YK N
Sbjct: 2222 QEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYN 2281

Query: 2327 IGDVK-PHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSRP 2385
                + P  IRTLIT+NSTHN LFA+CAPL+   S+ IQ MV              +S+ 
Sbjct: 2282 EKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTN-ISK- 2339

Query: 2386 SQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPL 2445
             QNIDYKR+L+SFD+  ++IS++Q LSL CEP+AKVQA++GF SF F + TND D  EPL
Sbjct: 2340 -QNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPL 2398

Query: 2446 SFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVK 2505
             FAL V+ T ++I+HIFSRE S SFG+D ID+T MFTHPN IN+ G  LISDV V+FNVK
Sbjct: 2399 IFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVK 2458

Query: 2506 QLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNIIPWCFTLIFANIN 2564
            QLQNLYLFLDIWKLSNLL  KPM +       + +  S    D  + IPWCFTLIF+NIN
Sbjct: 2459 QLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNIN 2518

Query: 2565 GKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWA 2624
            G VD            ++ WFA+DHY+S R++LHAY   I LT+KGRLSGI+ELDGA W 
Sbjct: 2519 GDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWI 2578

Query: 2625 AEVNWPKYDD--PYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMP 2682
            +EVNWP Y++   YPLV++S  I  +  KVAFDYHMFL+G + N   H+HSE+D +G  P
Sbjct: 2579 SEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKP 2638

Query: 2683 DLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDY 2742
            DLLKV + CE I +CSTALVAAN+LD+YNT+MR+RQD  +SY+ETL+ESNT++ ++ +DY
Sbjct: 2639 DLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDY 2698

Query: 2743 KDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLH 2802
            KDIL+ LNLIQTDV VDI TLN+QISPISLFD E+LVVNI N+ A  +THAG KL+T L 
Sbjct: 2699 KDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELE 2758

Query: 2803 LQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNS 2862
            +Q+Y+A  +LS+SK E+DED+++ ISVEDYM YA +I GG I + P+L I+M T+QK  S
Sbjct: 2759 MQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKS 2818

Query: 2863 DILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKR 2922
            DILEY Y  +FGDKI+VRWNLGPVNFIKEMW TH++A+AVRRSQ  V      E DV KR
Sbjct: 2819 DILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKR 2878

Query: 2923 MRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKL 2982
            ++ EE  S+  Y+ +EEP+ID PQI+DLGDATP LEWFGLNRK+FP FTHQT ++ VQKL
Sbjct: 2879 IKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKL 2938

Query: 2983 IHSAEKEYANIVGHSQ 2998
            +H+AEKEY +I+GHSQ
Sbjct: 2939 VHTAEKEYGSILGHSQ 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3110 bits (8063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1514/3019 (50%), Positives = 2077/3019 (68%), Gaps = 92/3019 (3%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            + +SQ   + L   KDFSWVFLVDWILT+++ +T++FY+GR  A+ ++FI EWLLWKR  
Sbjct: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRAN 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+N+E+LRVSLLGGRI FK+L++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 62   IKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------E 115

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
            ++  SL +N KL C+  LECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 116  NNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGK-NLFLNYL 241
                            + D+++ +  +ES++  ++++ + NDR + + + GK   FL +L
Sbjct: 176  ----------SFSDGSSADKLD-EDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFL 224

Query: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301
            P+++K +  S ++GNKFTPS++I+S ++ EGV+D   PKE+LD+Y+ K  M+ KN  +S+
Sbjct: 225  PIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISI 284

Query: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361
            KQNIGY++ + LKFKL TGK+SKLW  FV+    V KP+   + KK       +F QKW+
Sbjct: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWK 344

Query: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421
            GLSLYK    +   +DLDDIEFD   HEYAKFTSI+KCP+  + Y+ D+ GFVPHGAHPT
Sbjct: 345  GLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPT 404

Query: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KPVK L
Sbjct: 405  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKL 464

Query: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541
             PG RR+YTLF++ +++ ED TWRIPTRE+SKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 465  PPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKD 524

Query: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601
            +YA+FN  LC T +G QN   +H  ++EIRSSVNHDI +KSK  + D ++G+PLGWN KA
Sbjct: 525  TYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKA 584

Query: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661
             W IN+ S QLE FLLREHITL+ADT+SDFS GEPTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 585  IWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLN 644

Query: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721
            VNDHNIVNNPLDFNENCYLS HGD L +DITVP++ I    TDISY I TPMFR+MLN P
Sbjct: 645  VNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTP 704

Query: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781
            PWNTLNEFMKHKEVGRAYDF   G+YL+Y+ELD+DNVD + I C+S STVLHCYGFV+RY
Sbjct: 705  PWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRY 764

Query: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKN---NEED 838
            L N+KMNYFG+FF+FVTSEEYT  + ++  GE        D AST  S +  +   NE +
Sbjct: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESE 824

Query: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898
            DK  V R  +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS N
Sbjct: 825  DKDPVKR--SDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCN 882

Query: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958
            YYMD++A L+   ++++ +   NE+F+ +R+ NG + + H  +S++ IHGHRM+GLPPTE
Sbjct: 883  YYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTE 942

Query: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018
            PTYFC+WD +LG + ++S+++F+KG   SF KIGFG++DLEN+LLY+ E VDDMT++TV+
Sbjct: 943  PTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVH 1002

Query: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078
             +  KI  ++P + S++ +   ++ F  IDFENE+YS R+D++IP L +SL     +   
Sbjct: 1003 AERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGV- 1061

Query: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138
            + SF  FETK+ FTNF  YK+  + R+ QR YIT +D+P+HRC F+LP  YQ+S  YQKL
Sbjct: 1062 DTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKL 1121

Query: 1139 YGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSY 1198
            YG+I               +T +FII+D + EY T            ++TN   D F   
Sbjct: 1122 YGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYAT----------LLETTNPFKDIFAET 1171

Query: 1199 PDT-----APHTLSDTIIRKSPLP----------EDERDNYVIDFRYISISIDPELFFYI 1243
            P T     A  T  D   R  PL             +R NYVID  YI + +DP LF + 
Sbjct: 1172 PSTVEPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFT 1231

Query: 1244 EKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIE 1303
            + LL  FY +D  QV+D IEIG+VK+LSN QEGI+SI+N  + I + ++ W +    G E
Sbjct: 1232 KSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFE 1291

Query: 1304 LYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVE 1363
            LYLD +D++M+EKS+EKNR   L EV TL ++ ++R +VN K +   +E +PPALSL +E
Sbjct: 1292 LYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLE 1351

Query: 1364 GVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQ 1423
            G + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI   + +F  +Q  R  
Sbjct: 1352 GFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRIS 1411

Query: 1424 SRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPD 1483
            S+ ELIS+LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLPD
Sbjct: 1412 SKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPD 1471

Query: 1484 DWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQK 1543
            DW + + K LKERKY ++KDAK+IFMSVFS+WRNWEFSDVARSYIY K+F  + AE +Q 
Sbjct: 1472 DWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQN 1531

Query: 1544 TVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNL 1603
             + K  K    S Y+TVY  G  V+H+F++  +NLV + TP  T    N+E+ I +TG +
Sbjct: 1532 LMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRV 1591

Query: 1604 GSIKGKISDKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGET 1662
            GS+KGK SD++ KL +L+ LV          + +  S+ FK+N            V  +T
Sbjct: 1592 GSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQT 1651

Query: 1663 SLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXX 1722
             L +    G+ S LWEN K  T +  SLV+++++ E  +KH + +L E Q+         
Sbjct: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATT 1711

Query: 1723 XXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTND 1782
                  P+I+ N QC D++ R M  TE  VT + E       +K+  +     KP     
Sbjct: 1712 EAWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRIKF----KPKSKKR 1767

Query: 1783 SPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFN 1842
            S    P KIN  L      +C+FSNVS +IMP+ PF  R E K+++  F+   +     +
Sbjct: 1768 SQFVGP-KINIVL------SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLS 1820

Query: 1843 IWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLF 1902
            IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R++ 
Sbjct: 1821 IWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVN 1880

Query: 1903 SFLQDEREVSRSVK--KLQVLGNLFSSEPEINTIPAGAK-IDWRLNADIKYLGILIPVST 1959
            SFLQDE+  S+ +            S  P+     A A+ I+W L+  I Y GIL+PV++
Sbjct: 1881 SFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILVPVAS 1940

Query: 1960 TFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFK 2019
            T+FVFE+H LL SL + + G +  EA + +GQ S++NILFLIK+R++P  LS+++D S K
Sbjct: 1941 TYFVFELHMLLLSLTNTNNGMLPEEA-KVTGQFSIENILFLIKERSLPIGLSKLLDFSIK 1999

Query: 2020 ISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLP 2079
            +S +Q+ +++  S+Q+ES H R C SP SL+R++WG H+LL L  +Y R H+ N+WD   
Sbjct: 2000 VSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDI-- 2057

Query: 2080 XXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKG 2139
                                   HILSY FC+GWLFQ    +D GL+LGYNRLFSAYEK 
Sbjct: 2058 ---KMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKD 2114

Query: 2140 CGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLH 2199
             GK T+VDAFFSV+NG  S TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD F R H
Sbjct: 2115 FGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2174

Query: 2200 GETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTV 2259
            GE LDVNF+ SF+ +I++TLQS++ FQELKK +++                         
Sbjct: 2175 GEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILD--------------VSEDSHMEDDN 2220

Query: 2260 PGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319
            P      ++    +APFL +IR VN  FKYDGG+F+VY+++DIE+  +PSFEI+SP VTI
Sbjct: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280

Query: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXX 2379
            +  YK+N  + KPH IR LI V+ T N L+A CAPLLM  S+ +Q M+            
Sbjct: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMI----KKHSTDDK 2336

Query: 2380 QRVSRP-SQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTND 2438
               ++P SQN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+
Sbjct: 2337 PSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNE 2396

Query: 2439 LDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDV 2498
             D+ +PL F+L ++ T+++IRHIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD+
Sbjct: 2397 FDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDL 2456

Query: 2499 EVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPSSP-MDVGNIIPWCFT 2557
             V+FNVKQLQNLYLFLDIW+ S++L  +P++      + + +  S+  +DVG  IPWCFT
Sbjct: 2457 SVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFT 2516

Query: 2558 LIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVE 2617
            LIF N++G VD            ++ W A+DHY  KRQLLHA+ D + LT++GRLSG+ E
Sbjct: 2517 LIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFE 2576

Query: 2618 LDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSER 2675
            +  A W +EV W   K  + +PLV+ S  I ++++K AFDYHMFLIGT+ N  F LH+E+
Sbjct: 2577 VANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEK 2636

Query: 2676 DTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTD 2735
            D  G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR+SN  +
Sbjct: 2637 DAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGE 2696

Query: 2736 TKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGE 2795
            +K+ + YKDIL+ L L++TD+ ++I++L VQISPISLFDVEVLVV I NV    +TH+G+
Sbjct: 2697 SKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGK 2756

Query: 2796 KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMH 2855
            KL+T L LQ+ +   +LS+SK E+DE++ + I+++DY+ YASKIVGGTI DIPKL + M 
Sbjct: 2757 KLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMT 2816

Query: 2856 TFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDE 2915
            T Q+  ++ +EY +  +F DKI+V+WNLGPVNFIKEMWTTH+KALAVR+SQ    + G  
Sbjct: 2817 TLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQT 2876

Query: 2916 EGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTV 2975
            E ++E+ ++ +ET SK  YIA+EEPQI  PQI+DLGDATP +EWFG+NRK+FP FTHQT 
Sbjct: 2877 EEELEESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTA 2936

Query: 2976 IVPVQKLIHSAEKEYANIV 2994
            ++PVQKL++ AEK+Y  I+
Sbjct: 2937 VIPVQKLVYLAEKQYVKIL 2955

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3105 bits (8049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1503/3010 (49%), Positives = 2085/3010 (69%), Gaps = 75/3010 (2%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            + +SQ   + L   KDFSWVFLVDWILT+++ +T++FY+GR  A+ +SFI EWLLWKR +
Sbjct: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+N+E+LRVSLLGGRI FKNL++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 62   IKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------E 115

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
            ++ +S  +  KL C++ +ECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 116  NNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKN-LFLNYL 241
                            + D+++ +  +ES++  ++++ + NDR + + + GK+   L +L
Sbjct: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFL 224

Query: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301
            P+++K S  S ++GNKFTPS++I+S +S +G++D   PKE+LD+Y+ K  M+ KN  +S+
Sbjct: 225  PIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISI 284

Query: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361
            KQNIGY++ + LKFK+  GK+SKLW  FV+    V KP+   + KK+  +   NF+ KW+
Sbjct: 285  KQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWK 344

Query: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421
            GLSLYK    +   +DLDD+EFDL  HEYAKFTSI+KCP+  + Y+ D+PG VPHGAHPT
Sbjct: 345  GLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPT 404

Query: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 405  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 464

Query: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541
             PG RR+YTLF++ I + ED TWRIPTRESSKD EFL+HYK TNE+YRPFGW+DL+F KD
Sbjct: 465  PPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKD 524

Query: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601
            +YA+FN ++C T  G QN   +H  ++EIRSSVNHDI +KSK  D D ++G+PLGWN KA
Sbjct: 525  TYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKA 584

Query: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 585  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLN 644

Query: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721
            VNDHNIVNNPLDFNENCYLS HGD L++D+TVP++ I    TD+SY I TPMFR+MLN P
Sbjct: 645  VNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTP 704

Query: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781
            PWNTLNEFMKHKEVGRAYDF   G+YL+Y+ELD+DNVD + I C+SKSTVLHCYGFV+RY
Sbjct: 705  PWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRY 764

Query: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKN---NEED 838
            L N+KMNYFG+FF+FVTSEEYT  + ++  G+ +     +D AST  S +  +   NE +
Sbjct: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESE 824

Query: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898
            DK  + R  +D++R TNETD+W TF++W+GAL+LPETIY+ DPCIALHF EL +D RS N
Sbjct: 825  DKGPMKR--SDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCN 882

Query: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958
            YYMD++A L+   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPTE
Sbjct: 883  YYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTE 942

Query: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018
            PTYFC+WD +LG + ++S+++F+KG   SF KIGFG++DLEN+LLY+ E ++DMT++TV+
Sbjct: 943  PTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVH 1002

Query: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078
            V+  +I + +P + S++ +   ++ F  IDFENEKYS R+D++IP L +SL     +   
Sbjct: 1003 VEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGV- 1061

Query: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138
            + SF  FETK+ FTNF  YK+  + R+ QR YIT++D+P+HRC F+LP  YQ+S  YQ L
Sbjct: 1062 DTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNL 1121

Query: 1139 YGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEY----NTTSDCIILNLPYPDSTNLNSDS 1194
            YG+I               +T ++II+D + EY     TT+    +    P +   +  S
Sbjct: 1122 YGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRAS 1181

Query: 1195 FNSYPDTAPHTLSDTIIRKSPLPED---ERDNYVIDFRYISISIDPELFFYIEKLLNHFY 1251
            F+   D        +  +     ED   ERDNYV+D  YI + +DP LF + + LL   Y
Sbjct: 1182 FSE--DDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLY 1239

Query: 1252 GDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDF 1311
             ++  QV+D IEIG+VKRLSN QEGI+SI+N  I I + ++ W +    G ELYLD +D+
Sbjct: 1240 SENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDY 1299

Query: 1312 EMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTT 1371
            +M+EKS+EKNR   L EV  L K+ ++R +VN K +   +E +PPALSL +EG + WS+T
Sbjct: 1300 QMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSST 1359

Query: 1372 AKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISR 1431
              + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI  V  +F  +Q  R+ S+ ELIS+
Sbjct: 1360 EDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISK 1419

Query: 1432 LTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAK 1491
            LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLPDDW   + +
Sbjct: 1420 LTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDE 1479

Query: 1492 QLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKA 1551
             LKE+KY ++KDAK+IFMSVFS+WRNWEFSDVARSYIY K+F A   + +Q  + K  K 
Sbjct: 1480 VLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKC 1539

Query: 1552 AFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKIS 1611
               S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG +GS+KGK S
Sbjct: 1540 TMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFS 1599

Query: 1612 DKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIHS 1670
            D++ KL +L+ L+    ED         S+ FK+N            V  +T L +    
Sbjct: 1600 DRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVG 1659

Query: 1671 GKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHPS 1730
            G+ S LWEN K  T +  SLV+++++ E  +KH + +L E Q+               P+
Sbjct: 1660 GRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPT 1719

Query: 1731 IVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTK 1790
            I+ N QC D++ R M  TE +VT + E      ++KE      +     +    +    K
Sbjct: 1720 ILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKER-----IKFKPKSKKKSQFVDQK 1774

Query: 1791 INPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYL 1850
            IN  L      +C+FSNVS ++MP+ PF  R E K+++  F+   +     +IWD+D ++
Sbjct: 1775 INTVL------SCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFM 1828

Query: 1851 GSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDERE 1910
             SH TK+QY R S G+I +     R   ++ N+D+S S++KLTFSEP R++ SFLQDE+ 
Sbjct: 1829 TSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1888

Query: 1911 VSRSVKKLQVLGNLF--SSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHT 1968
             S+ +  L  L  LF  S+ P+         I+W L+  I Y G+L+PV++T+FVFE+H 
Sbjct: 1889 ASQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHM 1948

Query: 1969 LLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIME 2028
            LL SL + + G +  E  + +GQ S++NILFLIK+R++P  LS+++D S K+S +Q+ ++
Sbjct: 1949 LLLSLTNTNNGMLPEET-KVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVD 2007

Query: 2029 SHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXXXX 2088
            +  S+Q+ES H R C SP SL+R++WG H+LL L  +Y R H+ N+W+            
Sbjct: 2008 TEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWN-----TKMFTGK 2062

Query: 2089 XXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDA 2148
                          HILSY FC+GW+FQ    ++ GL+LGYNRLFSAYEK  GK T+VDA
Sbjct: 2063 SDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDA 2122

Query: 2149 FFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFL 2208
            FFSV+NG TS TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD F R HGE LDVNF+
Sbjct: 2123 FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2182

Query: 2209 SSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKEDA 2268
             SF+ +IE+TLQS++ FQELKK +++                       +          
Sbjct: 2183 PSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSS---------- 2232

Query: 2269 PRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIG 2328
                +APFL +IR VN  FKYDGG+F+VY++EDIE+  +PSFEI+SP VTI+  YK++  
Sbjct: 2233 ----LAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDED 2288

Query: 2329 DVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSRP-SQ 2387
             VKPH  RTLITV+ THN L+A CAPLLM  S+ +Q M+               ++P SQ
Sbjct: 2289 KVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMI----KKHSTDEKPNFTKPSSQ 2344

Query: 2388 NIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSF 2447
            N+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+ D+ +PL F
Sbjct: 2345 NVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEF 2404

Query: 2448 ALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQL 2507
            +L +++T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD+ V+FNVKQL
Sbjct: 2405 SLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQL 2464

Query: 2508 QNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPSSP-MDVGNIIPWCFTLIFANINGK 2566
            QNLYLFLDIW+ S++L  +P+++  +  + + +  S+   D G  IPWCFTLIF N++G 
Sbjct: 2465 QNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGD 2524

Query: 2567 VDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAE 2626
            VD            ++ W A+DHY  KRQLLHA+ D I LT++GRLSG+ E+  A W +E
Sbjct: 2525 VDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSE 2584

Query: 2627 VNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDL 2684
            V WP  K  + +PLV+ S  I +I++K AFDYHMFLIGT+ N  FHLH+E+D  G +PDL
Sbjct: 2585 VKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDL 2644

Query: 2685 LKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKD 2744
            L+V  + ++I + STALV AN+LD+YNTI+RMRQD  +SY+ETLR+SN  ++++ + YKD
Sbjct: 2645 LQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKD 2704

Query: 2745 ILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQ 2804
            IL+ L L++TD+ V+I++  VQISPISLFDVEVLV+ I  V    +TH+G+KL+T L LQ
Sbjct: 2705 ILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQ 2764

Query: 2805 LYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDI 2864
            + +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPKL + M T Q+  ++ 
Sbjct: 2765 VLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNN 2824

Query: 2865 LEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMR 2924
            LEY +  +F DKI+VRWNLGPV+FIKEMWTTH+KALAVRRSQ    + G  E ++E+ ++
Sbjct: 2825 LEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELEESIK 2884

Query: 2925 DEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIH 2984
             EE  SK  YIA+EEPQI+ PQI+DLGDATP +EWFG+NRKKFP FTHQT ++PVQKL++
Sbjct: 2885 KEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVY 2944

Query: 2985 SAEKEYANIV 2994
             AEK+Y  I+
Sbjct: 2945 LAEKQYVKIL 2954

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2862 bits (7420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1427/3040 (46%), Positives = 2016/3040 (66%), Gaps = 117/3040 (3%)

Query: 8    FNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVNI 67
            F   SL   ++FSWVFLVDWILT+IL++  LFY+ RA A+ ++FI EWLLWK+ ++KV+I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 68   ESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGAS 127
             +LR+SLL GR+FFKNLTIIDKD TI+ L G I+WRYWL R R  ++     A    G+S
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 128  --------------LQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEE 173
                          +++  KL CR L ECEG E+F+YNRT AYDN + + SK ER KFE+
Sbjct: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 174  FLNEHVFTDRAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETG 233
            F+ E+ F D +                        T S+ + ++E  +ANDR F ++ T 
Sbjct: 190  FMAENDFLDPSSDGSSDDKIEE-------------TSSATNSTDEETIANDRTFQND-TR 235

Query: 234  KNL--FLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLT 291
            K L  +L  LP++  ++  S ++GNKFTP +LI+S +SA  + D  +   KLD+Y+ K  
Sbjct: 236  KTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYE 295

Query: 292  MDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPS 351
            +  KN+ + +KQNI Y+ E    F+   GKLS+LW  F +    V  P   S ++K +P 
Sbjct: 296  VRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFK-SNRRKEQPH 354

Query: 352  VTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIP 411
               NF QKW+GLS+Y+N MF +  ++ DDIEFD++ HEYAKFTS++K PR  + +++D+P
Sbjct: 355  --DNFMQKWKGLSMYRNDMFGEF-DEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMP 411

Query: 412  GFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQI 471
            G+VPHGAHP  S  DGPD+GNN APP +  EI +FGG++CYGPWAQRQ   +QSLL+P +
Sbjct: 412  GWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSV 471

Query: 472  SRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPF 531
            SR  KP+K L+PG +R+YT+ KL I   ED+TWRIPTRESSKD EFL HYK TN+DYRPF
Sbjct: 472  SRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPF 531

Query: 532  GWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNL 591
            GW+D+K S+DS   F+ A+C T+ G +NT+ + L D+EIRSSVNHDIF+KSKS  F+ ++
Sbjct: 532  GWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDI 591

Query: 592  GFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINW 651
            G+PLGWN +A WTI + S+QLE FLLREH+TLIADT++DFS+GEP PYELFRPF+Y I W
Sbjct: 592  GYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKW 651

Query: 652  KLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYT 711
             + GYS YLNVNDHNIVNNPLDFNENCYLS HGD L +++ VPK  I +R T+++Y+IYT
Sbjct: 652  NMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYT 711

Query: 712  PMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTV 771
            PMFRL+LN PPWNTLNEFM++KEVGR++DFR  G+YLIY+ELD+DNVD +T+ CSS+ T 
Sbjct: 712  PMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTA 771

Query: 772  LHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDF 831
            LH YGFVIRYL+N+KMNYFG+FFHFVTSEEYT              ++  DD S++ S  
Sbjct: 772  LHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVS 831

Query: 832  DKNNEEDDK-----VKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALH 886
              ++   DK      K     +D++R +NETD+W TF++W+GAL+LPETIYN DPCIALH
Sbjct: 832  RISSNSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALH 891

Query: 887  FGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINI 946
            F EL +D+RS NYYMD+LA+  DI L++Y   + +EI+E V   NG+D + H  +S+I I
Sbjct: 892  FAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYI 951

Query: 947  HGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEK 1006
            HGHRMYGLPPTEPTYFC+WD D G + ++S + F++GL  +F KIGFG+ DLEN+LLYE 
Sbjct: 952  HGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYET 1011

Query: 1007 EVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLK 1066
            E++DDMT++T+ +    I +++ +  + A+L L    F  IDFENE+YS RMDI+IP L+
Sbjct: 1012 EIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLE 1071

Query: 1067 LSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILP 1126
             +++        +LS  NF+  +NFTNF   ++  +HR +QRDYI +NDAP+HRC F+LP
Sbjct: 1072 FNIFS---NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLP 1128

Query: 1127 ASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYN---------TTSDC 1177
             SYQ S IY +L+G+I               +T E++++D L +Y            S  
Sbjct: 1129 ESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSV 1188

Query: 1178 IILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDP 1237
              L L   ++T   +        + P TLSD  +        E DNYV+    I I I+P
Sbjct: 1189 ENLELSAIEATRAITGIGAERTHSNPITLSDYAV--------ESDNYVVKVESIVIDINP 1240

Query: 1238 ELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQR 1297
             L+  IEKLL H Y  D  Q+ID IEIG+VKRLS+  +G++++ N K++I  F++FWG++
Sbjct: 1241 ALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEK 1300

Query: 1298 DTGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPA 1357
            ++  + ++ D +DF + EK++E+N EK+L E+T L K+ ++R +V  +     T+ +PPA
Sbjct: 1301 ESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPA 1360

Query: 1358 LSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKV 1417
            +++ VEG +FWST  +K +NSI ++S D T+D+ QV W F +   QK     +++++ ++
Sbjct: 1361 ITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRI 1420

Query: 1418 QKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI 1477
            Q  R +S+KELISRLT ASEYYQISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHI
Sbjct: 1421 QNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHI 1480

Query: 1478 MTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQ 1537
            +TYLP DW   V + L++RK++ S+DA+SIFMS+FS+WR+WEFSDVARSYIY K+FL + 
Sbjct: 1481 LTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDH 1540

Query: 1538 AEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYN---QE 1594
            AEK+++++ K +K    + ++TVY+    VDHS +V+ + L+ E TP +TE   N   +E
Sbjct: 1541 AEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQRE 1600

Query: 1595 KVINVTGNLGSIKGKISDKMFKLHNLMNLVQQ--QEDPALKSISSFSRSFKLNIAXXXXX 1652
            ++I+++G +  IKGK+S K+ KL  L+ ++ +  ++ P      +  + FK+N A     
Sbjct: 1601 ELIDISGTVDVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNS 1660

Query: 1653 XXXXXVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQ 1712
                 V   T L   ++ G+ S LWEN +  T +  S+VL++K  E  +KH NS+L E +
Sbjct: 1661 CDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGR 1720

Query: 1713 ITGXXXXXXXXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETD 1772
            ++              P+ + + +   I+ R M +TE +V  +++   K + + E  E +
Sbjct: 1721 VSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELE 1780

Query: 1773 DLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFS 1832
                  PT   P  +          ++  +C FSNVS+DIMP+ PF  +   K+++F ++
Sbjct: 1781 RRLTQHPTVYDPNKS----------NVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYN 1830

Query: 1833 SQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKL 1892
               + ++   + D+D +L S  TK+QY RLS+  + +          + ++++S ++VKL
Sbjct: 1831 KFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKL 1890

Query: 1893 TFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAG----AKIDWRLNADI 1948
            TFSEP  +++SFL+DER  S SV  LQ L  LFS   +  + P       +  W L++ I
Sbjct: 1891 TFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSI 1950

Query: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPS 2008
             Y GILIP+++T++V E H+ ++S+++ + G      D  +G +SV+NILFLIK+ ++P 
Sbjct: 1951 DYFGILIPMTSTYYVMEFHSYVSSISNAN-GAPSGNLD-ITGHMSVENILFLIKESSLPD 2008

Query: 2009 TLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRR 2068
             LS++ID++  +S +Q++ ++  S Q+ES H R C SP SL+R+LWG +Q   L  HY +
Sbjct: 2009 GLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLK 2068

Query: 2069 HHSKNLWDFLPXXXXXXXXXXXXXXXXX---XXXXXCHILSYNFCVGWLFQNNGDTDAGL 2125
            +HSK+LW                              H LSYN CVGWLF+       GL
Sbjct: 2069 YHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGL 2128

Query: 2126 ILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWL 2185
            I GY+RLFSAYE   GKLT++D++F+ + G TS TFY + N ++ +NR +LPN+QI++W 
Sbjct: 2129 ITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWW 2188

Query: 2186 KAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXX 2245
            K    MKDV++R  GETLDV +LS F+  IE+TL SI++FQ+LKK L+            
Sbjct: 2189 KVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELI------------ 2236

Query: 2246 XXXXXXXXXXXXTVPGKEK---KEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDI 2302
                          P +E    KED P       L +I+ VNC FKYDGG + V++  D 
Sbjct: 2237 -----------VETPKREVVHIKEDKPVNSSNNILKNIKSVNCHFKYDGGTYSVFNISDG 2285

Query: 2303 ESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQD 2362
              N  P+ EI+SP +++D+ YK+   + K H IR L+ ++ THNVL+A CAPL+    +D
Sbjct: 2286 SLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVED 2345

Query: 2363 IQHMVXXXXXXXXXXXXQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQ 2422
            ++ +                S   QNIDY++LL  +D+   + S++Q+LSLSCEPKAKVQ
Sbjct: 2346 VRSIFGRYESENKHSETTPTS--VQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQ 2403

Query: 2423 ANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFT 2482
            A+VGF++   ++ TN  D  EPL+F+  +K+T+++I+H+FSRE S SFG+  +D+T +FT
Sbjct: 2404 ADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFT 2463

Query: 2483 HPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPP 2542
            H N IN +G  LISD+++YFNVKQLQNLYLFLDIW+LS LL   P+   ++  +  D   
Sbjct: 2464 HTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELL--NPVTSSQEQVIRKDKKK 2521

Query: 2543 S--SPMDVGNIIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAY 2600
            S   P+   + +PWCFTLIF N+ G +D           + + W A+DH+  KRQ+LHA+
Sbjct: 2522 SVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAF 2581

Query: 2601 IDQIKLTAKGRLSGIVELDGALWAAEVNWPK--YDDPYPLVALSFVISNISLKVAFDYHM 2658
            +D + L ++GRLSG+V +DGA W +EV W +    D  PLVALS     I +K AFDYHM
Sbjct: 2582 VDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHM 2641

Query: 2659 FLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQ 2718
            FLIGTV N +F LHSERD  G  PDLLKV  +CE+I +CSTALVAAN+LD+YNTI+RMRQ
Sbjct: 2642 FLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQ 2701

Query: 2719 DTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVL 2778
            DT +SY+ETL++SN    K+T+ Y+DILK L L++TD+ V I +L +QISPISLFDVEV+
Sbjct: 2702 DTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDVEVV 2761

Query: 2779 VVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASK 2838
            V+N+ +V A  +TH+  KL T L++++Y+A  SLS++K E+DED +SKI+V DYM YASK
Sbjct: 2762 VINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASK 2821

Query: 2839 IVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIK 2898
            I GGTI +IP++ + M T+Q+  SDILEY Y   F DK+AVRWNLGPVNF+KEMWTTH+K
Sbjct: 2822 IRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVK 2881

Query: 2899 ALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLE 2958
            A+AVRRSQ L G+    E DVEKR+++EE ++KL Y+ +EEPQID PQIKDLGDATP +E
Sbjct: 2882 AIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVE 2941

Query: 2959 WFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998
            WFG+NRK+FP FTHQT +VPVQ L++ A+K+YA  +G S+
Sbjct: 2942 WFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2710 bits (7025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1378/3048 (45%), Positives = 1959/3048 (64%), Gaps = 165/3048 (5%)

Query: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65
            SQF  +SL   ++FSWVFLVDW+L  ++++TV+FY+GR  A+ I+ + EW LWK +++K+
Sbjct: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64

Query: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125
            ++ESLR++ L G I F+NL II KD TIS L G + WRY L   R  Q+    + +D  G
Sbjct: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124

Query: 126  ASLQ-----RNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF 180
               +     +N  L CR +L CEG E+F+YNRTVAY+N I+MFS+EER +FE+F+++   
Sbjct: 125  VGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMSKQEM 184

Query: 181  TDRAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMA----------NDRIFHD- 229
            ++                         ++E S D+ +   +           NDR+F + 
Sbjct: 185  SEL---------------------FHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEV 223

Query: 230  EETGKNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTK 289
                K++F+ +LP+++++S  S V+GNKFTPSLLI S  S  GV+D CQPKEKLD+YK  
Sbjct: 224  HNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMH 283

Query: 290  LTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNR 349
              +D  ++ +S++QNI YN +   K     GKLS++W  FVK    +  P   ++   N+
Sbjct: 284  FQVDFIDIDISIRQNIEYNRK---KATFKNGKLSRMWATFVKV---LHIPF-YNKSHNNK 336

Query: 350  PSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFD 409
             + +  F  KW+GL LYK   F+    D D++ FD A HEYAK ++IIK PR +LTY +D
Sbjct: 337  GTESEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYD 396

Query: 410  IPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAP 469
            IPG VPHGAHPTL   +GP++GNNGAPP FG+++Q +G ++CYGPWAQR++  +  +++P
Sbjct: 397  IPGVVPHGAHPTL---EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISP 453

Query: 470  QISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYR 529
             ++R   P+K L PG RR+YT+FK    V +  +WRIPTRE SKD EFL+ +K T+E+YR
Sbjct: 454  TVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYR 513

Query: 530  PFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDL 589
            PFGWLDLKF+ DSY S    LC   +G  N M IH  + E  SSVNHD+ +K    D   
Sbjct: 514  PFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAG 573

Query: 590  NLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTI 649
            ++G+PLGWN  A WTIN+ S+QLETFLLREH+TL+AD  +DFS+GEPTPYELFRPF+Y I
Sbjct: 574  DVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQI 633

Query: 650  NWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNI 709
            NW +DGYSIYLNVNDHNIVNNPLDFNENCYLS HG+ L +D+T P D I     D+ Y I
Sbjct: 634  NWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKI 693

Query: 710  YTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKS 769
             TPMFRL+LN PPWNTLNEFMK+KEVGR+Y F   G Y +Y+ELD+DNVD +++ C+S  
Sbjct: 694  STPMFRLLLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTG 753

Query: 770  TVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSK-GYGEGSLFEKYSDDASTFV 828
            T LHCYGFV+RYLMN+KMNYFGDFFHF+TSEEYT  I +K     G   E+   D ST +
Sbjct: 754  TTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNL 813

Query: 829  SDFDKNNEEDDKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIA 884
            S  D     D  V++   P    +DV+R TNETD+W TF++WEGAL+LPETIYNCDPC+A
Sbjct: 814  ST-DSGGLSDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVA 872

Query: 885  LHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNI 944
            LHFGEL +D+RS NYYMDLLA++    +++Y + Q +E+FE++R+ NGR  K H  ++ +
Sbjct: 873  LHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAAL 932

Query: 945  NIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLY 1004
             IHGHRMYGLPP EPTYFC+W  DL  + + S+ +F KG  T F  IGFG+ +LEN LLY
Sbjct: 933  TIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLY 992

Query: 1005 EKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPL 1064
            + E  DDMT+VTV V+D  +++ N    SRA + + N+ F +IDFENE+YS R+D+++P 
Sbjct: 993  DVETPDDMTSVTVRVRDMNVVVENDS--SRAVVDVPNLTFTSIDFENERYSQRIDLKVPS 1050

Query: 1065 LKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFI 1124
            L + L   + + S+ +   +  TK+  T+F   ++  +HR+ QRDYIT+ND+PF+RC F+
Sbjct: 1051 LSILLLT-SEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFL 1109

Query: 1125 LPASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPY 1184
            LP   Q S +Y+ L GSI               ET +FII+D L E+     C       
Sbjct: 1110 LPCYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRT 1169

Query: 1185 PDSTNLNSDSFNSY-----PDTAPHTLSDTIIR-KSPLPEDERDNYVIDFRYISISIDPE 1238
             D  +  S+SF++      PD   +     + +  SP P ++ DN +ID +++++ +DP 
Sbjct: 1170 VDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPL 1229

Query: 1239 LFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRD 1298
            +  Y++ LL  F+  +   +ID IE+ +VKRL       + + N K+ ++  + FWG ++
Sbjct: 1230 ICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKN 1288

Query: 1299 TGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEG---QP 1355
               ++LY D LDF++ +++ + + E  ++E  TL KL S+RA+V   + R  TEG   +P
Sbjct: 1289 AKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATV---FDRSITEGVEERP 1345

Query: 1356 PALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFE 1415
            PALSL VEG + +S   +K++ S+ L S D T+DE+Q+ WL  +  +Q++LI +++ +F 
Sbjct: 1346 PALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFT 1405

Query: 1416 KVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLR 1475
            K+ +    +R++L+  +T ASE+YQISH+PYVITKPAFI RLS GHVREN SW+IITRLR
Sbjct: 1406 KLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLR 1465

Query: 1476 HIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLA 1535
            HI+TYLP++W    A Q+       S    S   SV S WR WE SD+ RSYIY  +FL+
Sbjct: 1466 HILTYLPNEWRNNSAIQV-------SPTVDSTDASVASHWRRWEISDITRSYIYRTIFLS 1518

Query: 1536 NQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQ-- 1593
            +Q++ Q +++ K  K  F S + T+Y+ G  V H+F++T++N+V EE P    S   Q  
Sbjct: 1519 DQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQAL 1578

Query: 1594 --EKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQEDPALKSISS---FSRSFKLNIAX 1648
              + V+N+T +LG+IKG+++D++ KL N+ +  Q    PALK   +    S+S+K+N+  
Sbjct: 1579 DYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQT---PALKRSKTSINISKSYKVNVLL 1635

Query: 1649 XXXXXXXXXVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSML 1708
                     V G+T LTN I +GKA+ L E  K       S V +AKR E+ +KH + +L
Sbjct: 1636 AFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVL 1695

Query: 1709 FENQITGXXXXXXXXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKES 1768
             E                  PS+  N QC + ++R M  TE++V  +++ +   + +K  
Sbjct: 1696 AEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRH 1755

Query: 1769 FETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKME 1828
            F    + K TP   + + T T ++   L +   T  FS+V+ ++MP+ PF  R E K++ 
Sbjct: 1756 FA---MEKTTP---NVQGTSTNLS-IPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLG 1808

Query: 1829 FKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSAS 1888
               +  ++     +IWD+++ L SH T +QYF  +LG++ V        + I N+ +S S
Sbjct: 1809 LYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTS 1868

Query: 1889 IVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADI 1948
            ++KLT SEP R+L SFLQDE+ +  S+  ++ L  LFS  P        + + W L+A++
Sbjct: 1869 LMKLTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFS--PLARNKTQSSALRWSLDANL 1926

Query: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADE-ASGQVSVDNILFLIKDRTIP 2007
             Y GIL+P+++TFFVFE+H LLA++ +   G+   E D   +GQVS++N L LIK+ ++P
Sbjct: 1927 NYFGILVPMASTFFVFEIHMLLAAMNNASDGQ--DEGDHHVTGQVSIENCLLLIKEPSLP 1984

Query: 2008 STLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYR 2067
            + LS+++D S ++ + QK+  S  SYQIES H R C SP SLV++LWG HQL +L  ++R
Sbjct: 1985 ADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFR 2044

Query: 2068 RHHSKNLWDFLPXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLIL 2127
            +H  ++                             HILSYN C+GW+FQ   D   GLI+
Sbjct: 2045 KHRKQD-----KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLII 2099

Query: 2128 GYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKA 2187
            G++RLFSAYEK  GKLTL+D +FSV+NG+++DTFYS G+E+ +YNRSFL N+QI YWLK 
Sbjct: 2100 GFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKE 2159

Query: 2188 AAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXX 2247
               MKD+FIR++GE L+V+ LS+   IIE+TL SIQ FQ LKK  ++             
Sbjct: 2160 IDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMH------------- 2206

Query: 2248 XXXXXXXXXXTVPGKEKKEDAPR---------KDIAPFLSDIRKVNCQFKYDGGIFKVYS 2298
                            K++  PR          +I+PFLS IR ++CQFKY GG+ K+YS
Sbjct: 2207 ----------------KRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYS 2250

Query: 2299 FEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMA 2358
             +D+     PS EI+SPGV I L Y +N  + +PH IR L++++ THN+L+++C P+L  
Sbjct: 2251 LDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILND 2310

Query: 2359 LSQDIQHMVXXXXXXXXXXXXQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPK 2418
            + +  Q MV                  SQ+IDYK LL+SFDI FK+ S  Q+LSLSCEP+
Sbjct: 2311 IVEASQRMVQKHSPDETPL------ESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPR 2364

Query: 2419 AKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVT 2478
            AKVQA+VGFDSF F + TNDL    P   +L V+  +S++RHIFSRE SASF +D +D T
Sbjct: 2365 AKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFT 2424

Query: 2479 FMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHH--- 2535
             +FTHP++   FG  L+SD+ V+FN+KQLQNL LFLDIW+L+  L  K   K +D     
Sbjct: 2425 SIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRKKQT 2481

Query: 2536 --VAIDAPPSSPMDVGNIIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESK 2593
              + +    S+P      I W FTLIF N+ G VD           + + WFA+DHY ++
Sbjct: 2482 KSMTLSKRTSTPTS----ICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQ 2537

Query: 2594 RQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDD--PYPLVALSFVISNISLK 2651
            R++LHA+ D++ + ++GRLSG+ +L  A W +EVN+P          ++LS  +  +++K
Sbjct: 2538 RRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIK 2597

Query: 2652 VAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYN 2711
             AFDYHMFLIGT+    FHL SE D  G +PDLL V L+C+++D C+TAL AAN+LD+YN
Sbjct: 2598 TAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYN 2657

Query: 2712 TIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPIS 2771
            TI RMRQD  +SY+ETLRESN+T+ + T+ Y DIL+ LNL++TD+  DI T   QISPIS
Sbjct: 2658 TITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPIS 2717

Query: 2772 LFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVED 2831
            LFDVEVLV+NI NV A  +T +GEKL+T LHLQ+ NA  SLS+SK E+DE+ V+KIS+ED
Sbjct: 2718 LFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIED 2777

Query: 2832 YMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKE 2891
            YM+YASKI GGTI  +P+L +SM T+QK  SD++EY +   F D++AV+WNLGP+NFIKE
Sbjct: 2778 YMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKE 2837

Query: 2892 MWTTHIKALAVRRSQS-LVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDL 2950
            MW+THIK+LAVR++QS    +  D++ D++    +EE  +KL Y+ ++EP I+ PQIKDL
Sbjct: 2838 MWSTHIKSLAVRQTQSNKTMSEKDKQADLDP---EEEIKAKLQYVPLDEPYIEMPQIKDL 2894

Query: 2951 GDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998
            GDATP +EWFG++RK+ P  THQ  IV +QKL+H+AEKEYA + G  Q
Sbjct: 2895 GDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGRFQ 2942

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2531 bits (6559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1317/3074 (42%), Positives = 1923/3074 (62%), Gaps = 156/3074 (5%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D  S F  +SLD+ ++FSWVFLVDW+LT I+++TV+FY+GR   + ++FI EW++WKR +
Sbjct: 2    DGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+NIESLR++ LGG I F+NL II +DYTIS L G I+WRYWLF  R  Q+   L+ E+
Sbjct: 62   VKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNEE 121

Query: 123  D---DGASLQRN--EKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNE 177
            +   +G   + N   K  CR LL CEG+E+F+YN+T +Y+N I MFSKEERA+FE+F+++
Sbjct: 122  ERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDD 181

Query: 178  HVFTDRAXXXXXXXXXXXXXKAQDEVEIKSYTESSF----------------------DE 215
               T+               K   E    S T  +                       D 
Sbjct: 182  QTMTE------LFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDG 235

Query: 216  SNESQMANDRIFHDEETG-KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVM 274
               + + ND +F  + +  K++++ +LP+QI     S V+GN+FTPS+L+VSA +++G++
Sbjct: 236  QAPNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGII 295

Query: 275  DYCQPKEKLDIYKTKLTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATA 334
            D C PKEKLD++K KL  +  +V  S+KQNIG+++++   FK T G+LSKLW  F  A  
Sbjct: 296  DLCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKF--ARI 353

Query: 335  FVRKPLGLSRKKKNRPSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFT 394
            F+   LG  +  + +  +T  F + W+GLSLY+  M ED   +L++++FD A HEYA+  
Sbjct: 354  FLLPTLG-PKHLQTQEDIT--FRENWKGLSLYRQNMEED---ELENVDFDFANHEYARVI 407

Query: 395  SIIKCPRAILTYEFDIPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGP 454
            SI+K  + + TYE+DIPG VP     TL    GP++GN+GAPP FG++IQL+G ++CYGP
Sbjct: 408  SILKSAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGP 464

Query: 455  WAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKD 514
            WA+RQ++++++LL+P +SR  KP+K L PG +R+YT+FK  I + E+ TWRIPTRE SKD
Sbjct: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524

Query: 515  AEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSV 574
             EFLRHY  T E++RPFGW+DLKF KDSY   +  +C T +GS N +  H  + EIR+SV
Sbjct: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584

Query: 575  NHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTG 634
            NH++ +++KS DF+ ++G+PLGWN++A W IN++S+QLE F+LREHITLI+D  +DFS+G
Sbjct: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644

Query: 635  EPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVP 694
            +PTPYELFRPF+Y INW LDGYSIYLNVNDHNIVNNPLDFNENCYLS HGD L  D+ +P
Sbjct: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704

Query: 695  KDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELD 754
            +  +  R T+I+Y+I TPMFRL+LN PPWNTLNEFMK+KEVGR+Y+F+  G Y +++ELD
Sbjct: 705  RQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELD 764

Query: 755  VDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEG 814
            +DNVD I++ CSS  T LHCYGFV+RYLMN+KMNYFGDF HFVT+EEYT    ++     
Sbjct: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNE 824

Query: 815  SLFEKYS--DDASTFVSDFDKNNEE----DDKVKVPRGPADVRRKTNETDLWLTFNIWEG 868
            +L +++S  + +ST   + D+ N E    +  + +P+  ++++R  NE D+W  F++WEG
Sbjct: 825  NLGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKR-SELKRTENEMDIWFVFSVWEG 883

Query: 869  ALLLPETIYNCDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVR 928
            AL+LPETIYN DPCIALHF EL +D+RSTNYYMDLLA++++  L++Y +  P+++FE VR
Sbjct: 884  ALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVR 943

Query: 929  QCNGRDVKGHSYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSF 988
            + NGR  K H Y+S++ IHGHRMYGLPPTEPTYFC+W  D+  +++ S+++F KG +T F
Sbjct: 944  KDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCF 1003

Query: 989  QKIGFGFDDLENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNID 1048
             KIGFGF +LEN+LLYE   + DMT+VTV VK+ K ++++ +  SR+ L    + F  ID
Sbjct: 1004 SKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAID 1063

Query: 1049 FENEKYSTRMDIRIPLLKLSLYGYNYEASKELSFF-NFETKINFTNFCNYKNCVQHRALQ 1107
            FENE YS R+D + P +   ++  + E  KE  F  + +T++NFT+F   +    HR  Q
Sbjct: 1064 FENEAYSQRVDFKFPDINFLIFELD-ENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQ 1122

Query: 1108 RDYITMNDAPFHRCGFILPASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDF 1167
            R+YIT++D+ ++RC F+LP  +Q SV+Y++L GSI               ET ++II+D 
Sbjct: 1123 REYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDC 1182

Query: 1168 LHEYNTT---SDCIILNLPYPDSTNLNSDSFNSYPDT---APHTLSDTIIRKSPLPEDER 1221
            L EY  T    D    +      T L ++      ++   +PH     +    P   D  
Sbjct: 1183 LGEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPH-----MPHNPPNNRDRY 1237

Query: 1222 DNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSIN 1281
            +NYV+D  Y+++ + P +   +   L  FY +D T +ID  EI +VK+L N Q G S + 
Sbjct: 1238 NNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVT 1297

Query: 1282 NFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRAS 1341
              ++ +      +   +  G+EL L++ DF++  K+IE   EK + E T    ++++R S
Sbjct: 1298 TSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRIS 1357

Query: 1342 VNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFG 1401
            +   +       +P AL L +E ++ WS+T  + +NS+ +TS   T+DE+Q+  +  +  
Sbjct: 1358 LLEAHP-SSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLF 1416

Query: 1402 DQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGH 1461
             Q +++   + + ++++ LR +++K+LI  LT ASEYYQISHDPYVITKPAFI RLS GH
Sbjct: 1417 GQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGH 1476

Query: 1462 VRENRSWKIITRLRHIMTYLPDDW---NETVAKQLKERKYNASKDAKSIFMSVFSSWRNW 1518
            VRENRSW+IITRLRHI+TYLP+DW   +  V  Q  E   N  +  + IF+SVFS+WRNW
Sbjct: 1477 VRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENP-NVPQRDEDIFVSVFSNWRNW 1535

Query: 1519 EFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNL 1578
            + SD+ RSYIY K+FL    +  +K +    K  F S + TV  +G  V  S I T++N+
Sbjct: 1536 DLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNI 1595

Query: 1579 VFEETP----DTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQEDPALKS 1634
            + +  P     ++E+ + QEKVI +T N+G+IKG+  +++FKL  L +   + E   L +
Sbjct: 1596 IVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSN 1655

Query: 1635 ISSFSRS---------------------------FKLNIAXXXXXXXXXXVFGETSLTNT 1667
            + S SRS                            K+             V G+T LTN 
Sbjct: 1656 LGSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNR 1715

Query: 1668 IHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXX 1727
            I +GK S L EN K  T    S V +A+R E  +KH  ++L E  +              
Sbjct: 1716 IINGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQLGVI 1775

Query: 1728 HPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPT 1787
             P +  N Q  +  +R MP T V+   +++   +  ++   F++ ++   +         
Sbjct: 1776 -PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAV------- 1827

Query: 1788 PTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSD 1847
             TK  P + +  D    F+++S +IM + PF   Q+ K++    S            + D
Sbjct: 1828 -TKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYD 1886

Query: 1848 LYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQD 1907
            +YL S L+ +Q+F+ S  ++         V  +  + +S S++KLT  EP R L + LQD
Sbjct: 1887 VYLKSQLSSEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQD 1946

Query: 1908 EREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMH 1967
            E+ +  SV  +Q L N   S    N         W L+A++KY G+L+PVS+  ++FE+H
Sbjct: 1947 EQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELH 2006

Query: 1968 TLLASLADVDYGEIYREADEA-SGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKI 2026
            +L ASL + +  E Y E D   SGQ+ V++   L+K+ ++P+ LS+++D S +    QK+
Sbjct: 2007 SLFASLTNAN--EQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKV 2064

Query: 2027 MESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXX 2086
              S  SYQIES + R C  P  LV ILW  H L +L +H+++HH+     +LP       
Sbjct: 2065 PNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP----WLPYSSNKTA 2120

Query: 2087 XXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLV 2146
                            HILSYNFCVGWLF+   +++ GLILGY+RLFSAYEK  GKLTL+
Sbjct: 2121 KSGESTLDFRS----IHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLI 2176

Query: 2147 DAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVN 2206
            D + SV+NG TSDTFYS  +E+D Y R++L N+QI YWLK    +KD+F+R HGE +DV 
Sbjct: 2177 DGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVR 2236

Query: 2207 FLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKE 2266
            FLS+  K++E TL SI+ F E+KK  +                                 
Sbjct: 2237 FLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNM-------------------- 2276

Query: 2267 DAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNN 2326
            +A    +APFL+ IR +N Q  + GG+FKVYS  +++S  +P  EI+SPGV + ++Y+ N
Sbjct: 2277 EAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFN 2336

Query: 2327 IGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSRPS 2386
                K H IR   T+  THN+LFA+CAPLL   + +I++M+            + V   +
Sbjct: 2337 ETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPV---T 2393

Query: 2387 QNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLS 2446
             +IDYK LLN +DI F+I S +QKLS SCEPKAKVQ + GF+SF+F + T+ +D+ EP +
Sbjct: 2394 DSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFN 2453

Query: 2447 FALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQ 2506
             +  +    S++RHIFSR+ SA+F LD ID+  MFT+PN+   +G  L+SD+ +Y N+KQ
Sbjct: 2454 VSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV---YGVALVSDMNIYCNMKQ 2510

Query: 2507 LQNLYLFLDIWKLSNLLRPKPMK-KPEDHHVA----IDAPPSSPMDVGNIIPWCFTLIFA 2561
             QNL +FLDIW+LSN  R KP + K ED   A          S  D   + PW FT+IF 
Sbjct: 2511 RQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPWSFTIIFT 2570

Query: 2562 NINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGA 2621
            N+ G VD           + + W  + H   +++  H +   I + ++GRLSG+ ELD A
Sbjct: 2571 NMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQA 2630

Query: 2622 LWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSG 2679
               +E++WP+ D     PL+++S  I+ +S+K AFDYHMFLIG++ +   HLH+E DT  
Sbjct: 2631 SSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYA 2690

Query: 2680 FMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKET 2739
             +PDLL+V L  E I +C+TAL AAN LD+YNTIMRM+QD  +SY+ETL+ESN + +  +
Sbjct: 2691 ILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISYIETLKESNISASSTS 2750

Query: 2740 VDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLET 2799
            V Y+++L  LNL++TD+ V +  L V ISP+SLFD EVLVV++ +V A  +T +GEKL+T
Sbjct: 2751 VAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKT 2810

Query: 2800 YLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQK 2859
             L LQ+ + + SLSSSK E+DE+ VSKI+V+DYM+YASK  GGTI  +P+L +SM T+Q+
Sbjct: 2811 ELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQ 2870

Query: 2860 SNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDV 2919
             +S +LEY +   F DKI+++WNLGPVNFIKEMW TH+++LAVRR+Q  +G +  E    
Sbjct: 2871 QSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQ--LGNSSPELEVA 2928

Query: 2920 EKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPV 2979
             +  +++   SK  Y+ ++EP I+ PQIKDLGDATP LEWFG++RK  P  THQT ++ +
Sbjct: 2929 NESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLI 2988

Query: 2980 QKLIHSAEKEYANI 2993
            QKL+H+AEKEYA +
Sbjct: 2989 QKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2440 bits (6325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1280/3054 (41%), Positives = 1878/3054 (61%), Gaps = 125/3054 (4%)

Query: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65
            SQF SISL + K FSWVFL  W+LT I S+TV+FY+ R      +FI  W +WK+Y++K+
Sbjct: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64

Query: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTE--LNAEDD 123
            NIES+RVS LGG +F KN++II++D+T+SFL  +I WRYWL   R  ++  +  L++E  
Sbjct: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124

Query: 124  DGA------SLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNE 177
             G+      ++++N KL C +L+EC+G E+F+YNR  AY+N +++F+KEER KF  FLNE
Sbjct: 125  QGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLNE 184

Query: 178  HVFTDRAXXXXXXXXXXXXXKAQDEVEIKSYTES-SFDESNESQMANDRIFH-DEETGKN 235
            H   D                + D    K Y ES + + S+ES + NDR +  +++  K+
Sbjct: 185  HDLGD-------IVSEDTNVNSMD----KDYFESVTTENSSESTVINDRTYKKNKDERKS 233

Query: 236  LFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAK 295
            +  N+LP+Q+++ H +  +GN+FTPSL++ S ++  GV+D     EK+D+YK+K+TM  +
Sbjct: 234  ILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQ 293

Query: 296  NVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGL---SRKKKNRPSV 352
            +V++S+K N+ Y+ E   +  +  GKLS++W+ F+     +  P         KK    V
Sbjct: 294  DVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDV 353

Query: 353  TANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPG 412
             + F  KWRGLSLYK+ + +  +  LD+  +D    EYAKF+SI+KCP   L+Y  D PG
Sbjct: 354  ESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPG 413

Query: 413  FVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQIS 472
             VPHGAH T    DGPDIGN+G+PP F +++Q+   S+ YGPW  RQV+++  +L+P +S
Sbjct: 414  IVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVS 473

Query: 473  RDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFG 532
            ++Q P+K L+PG RR++T+FK+ + + ++ +WRIPTRE SKD EF++ +  TN+D+RPFG
Sbjct: 474  KNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFG 533

Query: 533  WLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLG 592
            WLD   +K + A+FNF+L  T DG  N   IH  D E+ +SVNHDI +KSK  D   ++G
Sbjct: 534  WLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIG 593

Query: 593  FPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWK 652
            +PLGWN +A W  ++ + QLETFLL+EHI+L +D  SDF++ +PTPYELFRPF Y++NW 
Sbjct: 594  YPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWD 653

Query: 653  LDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTP 712
            ++GYSIYLNVND NIVNNPLDFNENCYLS HGD L++D  +P   I    T+I++NIYTP
Sbjct: 654  IEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTP 713

Query: 713  MFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVL 772
            MFRL+LN PPWNTL+EFMK KEVGRA+DF   G+YLIY++LD+DNVD IT+ C+S+ST L
Sbjct: 714  MFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTL 773

Query: 773  HCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTE---KISSKGYGEGSLFEKYSDDASTFVS 829
             CYG VIRYLMN++ NYFGDF HF+TSEEY+E   K + +   E   F  YS  +S   S
Sbjct: 774  FCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSF-TYSTTSSVQNS 832

Query: 830  DFDKN---NEEDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALH 886
              D      +E D  K     ADV R  NE D+W TF +W+GAL+LPE +YN + C +L 
Sbjct: 833  SSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLL 892

Query: 887  FGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINI 946
            F EL I  R +NYYMD L +L D+ + ++ N  P+EIF  VR  +      H  +S++ I
Sbjct: 893  FSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTI 952

Query: 947  HGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEK 1006
            H HRM+GLPP + TYFC+W  D G++ ++S ++F+      F K+GFG+ +LEN L+Y+ 
Sbjct: 953  HAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKV 1012

Query: 1007 EVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLK 1066
            E  DDMT +T+  +   I++ +     +A L +  ++  +IDF+NE+YS R++++IP   
Sbjct: 1013 ESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFS 1072

Query: 1067 LSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILP 1126
            +S++       K +    F+TKI+FTNF   ++       QR YIT++D+P+HRC FILP
Sbjct: 1073 ISIFDVRNPTIKPI-LLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILP 1131

Query: 1127 ASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPD 1186
              YQ S +Y +LYG I                T +F+++DFL EY+   +   LN+    
Sbjct: 1132 TMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNI--RS 1189

Query: 1187 STNLNSDS-FNSYPDTAPHTLSDTIIRKSPL-------PEDERDNYVIDFRYISISIDPE 1238
              NL++ S FN Y       +S+  I K+         P+ E DNY+++  YI + I+P 
Sbjct: 1190 INNLDTSSLFNEY--RVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPL 1247

Query: 1239 LFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRD 1298
               +I+ +    Y ++   +ID IE+ +V+RL + ++ +    N K++I + D+FWG R+
Sbjct: 1248 FSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRN 1307

Query: 1299 TGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPAL 1358
            + GIE+YLD LDFEM ++  +   ++SL E T L KL S+R S +          +PPAL
Sbjct: 1308 SEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPAL 1367

Query: 1359 SLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQ 1418
            SL VEG++ WS T     NSI + S D T+D +Q  WL  +   Q E   ++  + + +Q
Sbjct: 1368 SLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQ 1427

Query: 1419 KLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIM 1478
            K     +K LIS+LT ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TRLRHI+
Sbjct: 1428 KRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHIL 1487

Query: 1479 TYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQA 1538
             YLP+ W ++    ++ R   +  D K++F+SVFS+WRNWE SDVARSYIY +VFL    
Sbjct: 1488 NYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFL---P 1544

Query: 1539 EKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVF-----EETPDTTESGYNQ 1593
            + ++  +N   K    S Y T+Y+    VDH+ +VT+ N++      +E P    +  N 
Sbjct: 1545 DIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKN- 1603

Query: 1594 EKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIAXXXXXX 1653
            +K+ ++TG +G+ KG++ D++ +L  L +  + +      +  S  + FK+NI       
Sbjct: 1604 DKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKG 1663

Query: 1654 XXXXVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQI 1713
                    T L + I +GK S  +EN +     + S+V YA R E  +KH   +L +  +
Sbjct: 1664 ELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHL 1723

Query: 1714 TGXXXXXXXXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDD 1773
                           P+I+ N +   +  + +P T+ +V FL+EF  + + +     TD 
Sbjct: 1724 DDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRL-TDK 1782

Query: 1774 LPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSS 1833
              K   T+ SP  +  KI      D+ F     ++S +I+ + PF  +   K+++  F+ 
Sbjct: 1783 DNKKRHTSTSPIFSTKKI------DISFDINIFDISSEIVILSPFTVKHSMKELKIVFNR 1836

Query: 1834 QRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLT 1893
            +   +  F+I D+DLYL S+    QYFRLS  +I +        + +  +++  S++KLT
Sbjct: 1837 EGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLT 1896

Query: 1894 FSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIKYLGI 1953
             ++P ++  S LQDE+   +S++ ++ L  LFSS  E+ T        + +N D+ Y G+
Sbjct: 1897 LADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGL 1956

Query: 1954 LIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRI 2013
            L PV T++F+ E+H+LLA+ ++V Y    +  ++ +  +++ N LF+IK   + + +S++
Sbjct: 1957 LFPVDTSYFILELHSLLATFSNV-YMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKV 2015

Query: 2014 IDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKN 2073
            +D S  +S   KI+ S  S+++ES H R C +P SL++IL G  Q  +   +Y+ H    
Sbjct: 2016 LDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQ 2075

Query: 2074 LWDFLPXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLF 2133
            ++                           H LSYNFC+GW+F+N+  +  GLI+GY+RLF
Sbjct: 2076 IF----KTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLF 2131

Query: 2134 SAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKD 2193
            SAYE   GKLT+VD FFS++NG +SDTFYS GNE++KYNRS+LPNLQI+YWLK    MK 
Sbjct: 2132 SAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQ 2191

Query: 2194 VFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXX 2253
            +F+R +GET+DV FLS+F  II  T++S+Q FQ +KK  V  +                 
Sbjct: 2192 LFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAE------------ 2239

Query: 2254 XXXXTVPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIR 2313
                    K+  ED      + F S ++++NCQ  YDGG+F VY       + + + EI 
Sbjct: 2240 --------KKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEIT 2291

Query: 2314 SPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXX 2373
            +P V ID+DYK  I   KPH IR+ I +  T+N L ++ A  L    + +  MV      
Sbjct: 2292 TPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPK 2351

Query: 2374 XXXXXXQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFA 2433
                  + VS P   IDYKR+L  FD+ F I + +QK+SLSCEP AKV ANVGF+SF+F+
Sbjct: 2352 EQPPAPKTVSPP---IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFS 2408

Query: 2434 ILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGAC 2493
            I+TND D +EPLS +L V + +++I H FS EP+ASF +D +D+T +FTHP+I   +G  
Sbjct: 2409 IITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTT 2465

Query: 2494 LISDVEVYFNVKQLQNLYLFLDIWKLSNL--LRPK---PMKKPEDHHVAIDAPPSSPMDV 2548
            LISDV +YFN+KQLQNL +FLDIW L  L  LRP+   P+KKPE    +     +     
Sbjct: 2466 LISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPESRVSSS----TKSSSN 2521

Query: 2549 GNIIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTA 2608
              IIPW FT+I  +ING +            ++K W +++H++ +R+ L  + D + LT+
Sbjct: 2522 TTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTS 2581

Query: 2609 KGRLSGIVELDGALWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLIGTVLN 2666
             GRL G++++    W   V + + +  D  PLV ++  + N+++K AFDYHMFLIG V N
Sbjct: 2582 VGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHN 2641

Query: 2667 TVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLE 2726
             +F+L SE+D  G +PDLLK+ L C++ID+CSTALVA+N+LD+ NTI R RQD+  SY+E
Sbjct: 2642 ILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIE 2701

Query: 2727 TLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVC 2786
            TL ESN    K ++ Y DILK LNL++TDV ++I+ + VQISPISLFDVEV+V  + NV 
Sbjct: 2702 TLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVS 2761

Query: 2787 ANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFD 2846
            A   T +GEKL T L +++Y A  SLS S  E+DE+ VS+ISV+DYM+YA K+ GG I  
Sbjct: 2762 ARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILS 2821

Query: 2847 IPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQ 2906
            IPKL + M T+Q  NS I+EY +   F DKI+VRWNLGPVNFIKE+W TH+K+LAVRR+Q
Sbjct: 2822 IPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQ 2881

Query: 2907 -------SLV-GTTGDEEGDVEKR----MRDEETLS-----------KLTYIAIEEPQID 2943
                    LV G  G+    V       +R E + +           K  Y+ ++EPQI+
Sbjct: 2882 LKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIE 2941

Query: 2944 TPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHS 2997
             P+IKDL DATP LEWFG+NRKKFP  THQT I+ +QK++H A+KEYA ++G S
Sbjct: 2942 MPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2226 bits (5769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/3102 (38%), Positives = 1821/3102 (58%), Gaps = 161/3102 (5%)

Query: 1    MADTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKR 60
            M+   ++F ++SL + + FSWVFLV WIL ++ + T +FYV +   + ++F  EWLLWK 
Sbjct: 1    MSTLGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKT 60

Query: 61   YRLKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNA 120
              +KV IES+R+S L G IFFKN+ +ID+D TIS L   ++WRYWL   R  ++     A
Sbjct: 61   MNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKA 120

Query: 121  E------DD--DGASLQ------------------------------------------R 130
            +      DD  D  ++                                           +
Sbjct: 121  DTSKPNGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNK 180

Query: 131  NEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEH----VFTDRAXX 186
            N+KL     + C G E+FLYNR  AY+  I+ FSKEE+ +F +FL +H    +F + +  
Sbjct: 181  NKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSE 240

Query: 187  XXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETG------------- 233
                       +  +     S  +S  + ++   ++ D   +D +               
Sbjct: 241  IKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIM 300

Query: 234  KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMD 293
            + L L+ LPL I ++  +  +GNKFT SLL+++   A G++DY  P  KLD++K K+T +
Sbjct: 301  RKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFE 360

Query: 294  AKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRK--KKNRPS 351
              ++ +S+K+NIGYN E+  +F    G L+++W         +  P G  +   +  R  
Sbjct: 361  INDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLI--PTGRLKTWYESLRYK 418

Query: 352  VTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIP 411
                F +KW GL LYK+ +    +   DD++FD A HEYAK ++  K P+ I + E DIP
Sbjct: 419  EDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIP 478

Query: 412  GFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQI 471
            G VPHG+HP LS   GPDIGN+ +PPTF +++QL   S+ +G W  R +  ++ L+ P I
Sbjct: 479  GIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVI 538

Query: 472  SRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPF 531
            S+DQKP+  L+PG  R++++F   + V +D + R+PTRE SKD++FL+ Y  T +D+R F
Sbjct: 539  SKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAF 598

Query: 532  GWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNL 591
            GW+DL F K S    N  +  T+ G +NT+     + E+ +SVNH++  KS SL+   N+
Sbjct: 599  GWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANI 658

Query: 592  GFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINW 651
            G+PLGWN+   W  N+ S QL+ FLLREHITL++D + DFST EPTPYELFR F Y +N 
Sbjct: 659  GYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNL 718

Query: 652  KLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYT 711
            K+ GYS Y NVND NI+NNPLDFNENCYLSFHGD+   +IT+P   +  +   ISY I+T
Sbjct: 719  KIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFT 778

Query: 712  PMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTV 771
            PMFRL LN P WNTL+EFM++KE+GR++DFR +G YLIY+ELD+DNVD +TI   S STV
Sbjct: 779  PMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTV 838

Query: 772  LHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVS-- 829
            L+C+GFVI+Y+MN + NYFG F  F+T+EEY+E I  +     +L    ++D ++     
Sbjct: 839  LYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNLGSINTNDLTSIEGLQ 896

Query: 830  --DFDKNNEEDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHF 887
              D   N+ ED   K  +  +D+ R  NETD+WL F + +GAL+LPE +YN D C++L F
Sbjct: 897  KMDSITNDVEDINQKTIKR-SDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSF 955

Query: 888  GELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIH 947
            GEL I++R+ NYYMD+  +L D  L ++  + P+E+FE + Q   R       IS+I IH
Sbjct: 956  GELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYI-QTRNRSSSVEGNISDITIH 1014

Query: 948  GHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKE 1007
            GHRMYGLPP E TYFC+W  ++GT  ++S++ F+   + S  KIGF   + EN LLYE +
Sbjct: 1015 GHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESD 1074

Query: 1008 VVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKL 1067
             V+DMT ++V+V+  K+I+ +P L +RAE+  +++   NIDFENEKY+ R+D+       
Sbjct: 1075 TVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYF 1134

Query: 1068 SLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPA 1127
            SL     ++ K+ +  +  TK+N TNF    N + H   QR +I ++D+P+HRC F+LP 
Sbjct: 1135 SLDSLKIDSGKK-NILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPE 1193

Query: 1128 SYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDS 1187
             +Q S  Y++LYGSI                T  FI++  L +Y   S+ ++ +     S
Sbjct: 1194 KFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDY---SEFLLSDHHNQMS 1250

Query: 1188 TNLNSDSFNSYPDTAPHTLSDTIIRKSPLPED--ERDNYVIDFRYISISIDPELFFYIEK 1245
             N   +S ++ P      +  T  +     ED  E DN+V++ +Y++++++P++ F IEK
Sbjct: 1251 INAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEK 1310

Query: 1246 LLNHFYGD-DDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIEL 1304
                F         ID IE+ +V RLS+ +E ISS  N  + +   D  WG RD   I  
Sbjct: 1311 FSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGT 1370

Query: 1305 YLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEG 1364
            Y++ L FE++++S   N      ++T L K  S+R  +        ++ +PP LSLM+EG
Sbjct: 1371 YINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEG 1430

Query: 1365 VKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQS 1424
             + WS+T  K + ++ LTS D T+DE Q+ WL  +   Q  L   +  + + +   +   
Sbjct: 1431 FEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASY 1490

Query: 1425 RKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDD 1484
            +K  I+ L  A E YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHI+TYLP+D
Sbjct: 1491 QKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPED 1550

Query: 1485 WNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKT 1544
            W + + ++   ++    K+A S F++VFS+WRNWE SD+ +SYIY  +F+    E  ++ 
Sbjct: 1551 WEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRI 1607

Query: 1545 VNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESG---YNQEKVINVTG 1601
            +    K    + Y T+Y+     D +F++TK+N++     D          QE++++V  
Sbjct: 1608 LQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVT 1667

Query: 1602 NLGSIKGKISDKMFKL-HNLMNLVQQQEDPALKSIS-SFSRSFKLNIAXXXXXXXXXXVF 1659
             +GSIK + ++ + KL  ++  +++   D   +    S ++ FK+N++           F
Sbjct: 1668 KIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQF 1727

Query: 1660 GETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXX 1719
              +SL + + +      +EN    +  + S V YA R   ++KH N++L + Q+      
Sbjct: 1728 YNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFAS 1787

Query: 1720 XXXXXXXXHPSIVANFQCDDINLRVMPQTEVIVTFLQEF----------IAKFNLVKESF 1769
                      S++ NF+C +++ + +P+TE+ V  ++            I+K     ++ 
Sbjct: 1788 TTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNI 1847

Query: 1770 ETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEF 1829
             T+  P     N   K  P   N     ++  +  F+NVS +I  + P   + ET  +  
Sbjct: 1848 NTEHTPSVHEKNKMQKAKPNSKN-----NITLSATFTNVSSEITLLHPIYLKHETNSVNI 1902

Query: 1830 KFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASI 1889
             +++         + D+DLYL S  TK+QY RLS   + +      L   + +L++S+SI
Sbjct: 1903 SYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSI 1962

Query: 1890 VKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADIK 1949
            +KLT S+P RMLFSFLQDE+E+  S+  L+ L +L       ++    +  +W +N   K
Sbjct: 1963 LKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSK 2022

Query: 1950 YLGILIPVSTTFFVFEMHTLLASLADVD--YGEIYREADEASGQVSVDNILFLIKDRTIP 2007
            Y+G+L+P+  T++VFE+H  L+++++ +     +++   +  G +S D+I+FLIKD++IP
Sbjct: 2023 YMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHK---KFHGDLSFDHIIFLIKDQSIP 2079

Query: 2008 STLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYR 2067
               S+I+D S K+S  + +     S++IES   R C +P+SL++ +WG +QLL L + Y 
Sbjct: 2080 HKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYY 2139

Query: 2068 RHHSKNLWDFLPXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLIL 2127
               + N + F                         HILSYNF +GWL+Q++ +T  GLIL
Sbjct: 2140 DQSTVNFFVF---NDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLIL 2196

Query: 2128 GYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKA 2187
            GYNRLFS YE   GKLTLVD FFS++NG + DTFYS G+E  K+NRS+LPN+QI+YW+K 
Sbjct: 2197 GYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKE 2256

Query: 2188 AAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXX 2247
              +MK +FI+ HGETLDVNF  +FV IIE+T++SI +FQ LK+  +NPL +         
Sbjct: 2257 IEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAK------- 2309

Query: 2248 XXXXXXXXXXTVPGKEKKEDAPRKDI-APFLSDIRKVNCQFKYDGGIFKVYSFEDIESNL 2306
                        P +++K ++   +I  P    +++VNC+F YDGG+F+++S   + + L
Sbjct: 2310 ------------PERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKL 2357

Query: 2307 DPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHM 2366
            +P+  I+SP V I L Y     ++K H I  LI +  T NVL + C P L      I+ +
Sbjct: 2358 EPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDI 2417

Query: 2367 VXXXXXXXXXXXXQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVG 2426
            V              V  P   I+   LL +FDI FK+IS  Q ++L CEPKAK+  +VG
Sbjct: 2418 VELQDVNMEENMDNNVKDP---INITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVG 2474

Query: 2427 FDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNI 2486
            F SF F+ILT  L+  +PL  +L + + +++++H FS E SASF +  +DV  +FTHP +
Sbjct: 2475 FGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV 2534

Query: 2487 INMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDA---PPS 2543
               FG  L+ DV+++FN+KQ QN+ +FLDIW +S     K  KK  D +  +DA   P +
Sbjct: 2535 ---FGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKK--DSNTLVDAKSSPIA 2589

Query: 2544 SPMDVGNIIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQ 2603
              +   + +PW F  I  NING ++           +++ W ++DH+ +KRQLLH + D 
Sbjct: 2590 QTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDN 2649

Query: 2604 IKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY-----PLVALSFVISNISLKVAFDYHM 2658
            +K++++GRL G VE+D   W  +VN   Y D Y     PLV L F +  +S+KVAFDYHM
Sbjct: 2650 VKISSEGRLGGFVEIDDITWKLDVN---YVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHM 2706

Query: 2659 FLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQ 2718
            FLI TV +  FH+ SE+D    +PDLL V LTC++I +C+TALVA+N+LD+YNTIMR RQ
Sbjct: 2707 FLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQ 2766

Query: 2719 DTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVL 2778
            D   SY+ETL ESN    K    Y+DILK LNL+QT +  +I+ LN+QISP SL+D EV+
Sbjct: 2767 DNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVI 2826

Query: 2779 VVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASK 2838
            ++ + +V ++ +T  GEK++T L +++YNA  SL+S   E+ E+ ++++S E Y+ YAS 
Sbjct: 2827 IIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYAST 2886

Query: 2839 IVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIK 2898
            +  G IF+IP+L I+M TFQ +++ IL+Y Y  +F  K+ V WNLGP+NFIKE+W TH++
Sbjct: 2887 LTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVR 2946

Query: 2899 ALAVRRSQSLVG--TTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPS 2956
            +L VR  Q +     + + EGD ++ ++    LS + YIA+EEP I+ PQIKDL DATP 
Sbjct: 2947 SLEVRTVQFMGNHDISLENEGDTDESVK---VLSNIEYIALEEPYIEMPQIKDLKDATPP 3003

Query: 2957 LEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998
            LEWFGLNRK FP  THQ+VIVP+QKL++ A+KEYA ++G S+
Sbjct: 3004 LEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSSK 3045

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2146 bits (5561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1114/2600 (42%), Positives = 1604/2600 (61%), Gaps = 75/2600 (2%)

Query: 432  NNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTL 491
            N  APP   +E QLF  S+ YGPWA R +  IQ + +P +SR  +     +PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 492  FKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALC 551
             K+ + + ED +WR+PTRE SKD +FL+ Y  TN+  R FGW DL FS++S A+F  +  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 552  STADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQ 611
               +G  N + +   D E+RSSVNHDIF +SKS   D ++G+PLGWN++  W+    S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 612  LETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNP 671
            LETF LREH+ LIADT SDFS+GEPTPYE FRP +Y ++W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 672  LDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMK 731
            LDFNENCY+S HGD  ++ + +P+  I A  TDI + I TPMFRL+LN PPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 732  HKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFG 791
            +KE+GR YDF   G+Y+IY++LD+DNVD +TI CS++   L  YGFVI YL+N++MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 792  DFFHFVTSEEYTEKISSKGYGEGSLFEKYS----DDASTFVSDFDKNNEEDDKVKV---- 843
            +F HF+T+EEYT+ +        S    +S     ++ + VS+   N +   K  +    
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 844  ---PRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYY 900
               P    D++RK NETD+W TF++WEGALLLPE +YN DPCIAL F EL ID R+ +YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 901  MDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPT 960
            +DLLA+L+    ++      N+IFE V     ++++ H  +SNI+IHGHRMYG PPT P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 961  YFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVK 1020
            YF  W  D+  + + S++ F++G ++   K+GF F +L+N+LLY++ V+D+MT+VTV+  
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1021 DFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKEL 1080
               I++ +    ++  L ++ + F  I+F N++YS+R+D+++P L  + +  N  +  + 
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFD-NGSSMDKT 1248

Query: 1081 SFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYG 1140
              F F+TKINFTNF   K+   H   Q+++I +ND+ FHRC F+L    Q S++Y +LYG
Sbjct: 1249 CLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYG 1308

Query: 1141 SIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSYPD 1200
             I               ET  FII DFL  +   S  ++ ++      + ++        
Sbjct: 1309 GITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHSSNKPLKPPSS 1368

Query: 1201 TAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVID 1260
            +  H +        P       NY+ID  YI++ I+P  F Y    L+ FY ++  + ID
Sbjct: 1369 SVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETID 1428

Query: 1261 SIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEK 1320
             IE+ +V RL    E + S+ N K++I + D F+GQR+T G+ELY+D +D E+++K+ +K
Sbjct: 1429 GIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQKTFQK 1488

Query: 1321 NREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSII 1380
                 L E+  L +  S+RAS+N K      + +PPALSL +EG + WS+TA   +NS+ 
Sbjct: 1489 KSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLN 1548

Query: 1381 LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ 1440
            ++S D T+DE+Q+ WL ++       +  +V + + +QK     +K+L+S LT+ASEYYQ
Sbjct: 1549 ISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQ 1608

Query: 1441 ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA 1500
            ISHDPYVITKPA++ R+S+GHVR+NRSW+I+TRLRHI TYLPDDW   V ++++ +  N 
Sbjct: 1609 ISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMND 1668

Query: 1501 SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITV 1560
              D+  IF++VFS+WRNWE SDVARSYIY K+FL+N     +K +    K    S++ T+
Sbjct: 1669 VSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTI 1728

Query: 1561 YTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNL 1620
            Y+ G  +DH+ I+TK+ ++ E T +T  S   ++ ++N+TG+LGSIKG+ SDK  +L  L
Sbjct: 1729 YSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLEL 1788

Query: 1621 MNLVQQQEDPALKS-------ISSFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIHSGKA 1673
            +    ++ED  +KS       +S  S  F +++             G+T+L+N +  GK 
Sbjct: 1789 IPDFSKEED--IKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNNVTDGKI 1846

Query: 1674 SFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHPSIVA 1733
            S L E      + + S   Y K+ E  +KH   ++ E Q+               P I+ 
Sbjct: 1847 SALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILI 1906

Query: 1734 NFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKPTPTKINP 1793
            N +  D++ + +  TE IV  +++ I ++++    ++  DL K T         P KIN 
Sbjct: 1907 NLRSADLHFKSLASTEKIVKTIED-ITEYSV--HLYKHYDLRKYTTKPTKVDQKPEKIN- 1962

Query: 1794 FLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSH 1853
                D+   C  S VS ++  I PF  R ETK+++  F+         ++WD+D+++ SH
Sbjct: 1963 ---FDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSH 2019

Query: 1854 LTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSR 1913
             TK+QYFR S  +I +        N +  + +SAS+VKLTFSEP R+  SFLQDER    
Sbjct: 2020 HTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITIE 2079

Query: 1914 SVKKLQVLGNLFSSEPEI-----NTIPA-GAKIDWRLNADIKYLGILIPVSTTFFVFEMH 1967
            S ++L+ L  +F S  +      N +P       W L  +I Y GIL+P+++TFFV E+H
Sbjct: 2080 SFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELH 2139

Query: 1968 TLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIM 2027
             LL SL +    EI    ++ SGQ+S++NILFLI DR++P  LS+++D S +IS +QK  
Sbjct: 2140 MLLGSLTNTT-EEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTT 2198

Query: 2028 ESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXXX 2087
             S+ S QIES H R CFSP SLV +LWG  QL     +Y+ H +K  W+           
Sbjct: 2199 SSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNL---SSHKTGT 2255

Query: 2088 XXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVD 2147
                           HILSYNFC+GW+   N     G + GY+RLFSAYEK  GKLTL++
Sbjct: 2256 KSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIE 2315

Query: 2148 AFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNF 2207
             + SV+N  +S+ F+S G E++++NRSFLP++QI+YWLK     KD+FIRLHG+ LDV+ 
Sbjct: 2316 GYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDI 2375

Query: 2208 LSSFVKIIEATLQSIQVFQELKK--VLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKK 2265
            LS+FV IIE   +S Q+F++ +K  ++ N   Q                       +  K
Sbjct: 2376 LSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHH--------------------EHIK 2415

Query: 2266 EDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKN 2325
             +   + +  FLSDI  +NC+FKY+GG  +V+S +D+E +  PS E+ +P V+I L+YK+
Sbjct: 2416 SENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKH 2475

Query: 2326 NIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSR- 2384
                 KPH +R +I ++S+HN+L+++CAP ++   + IQ ++            Q VS+ 
Sbjct: 2476 FDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPK----QSVSKI 2531

Query: 2385 PSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEP 2444
             + N  YKR+L  FDI F+I +++Q LS SCEP AKVQANVG DSF+F I T      +P
Sbjct: 2532 ATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDP 2591

Query: 2445 LSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNV 2504
            LS  L +    ++++HIFS+E SASF L+ ID+TF+FT P    ++   LISD++++FN+
Sbjct: 2592 LSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPT---LYCVGLISDIDIFFNM 2648

Query: 2505 KQLQNLYLFLDIWKLSNLL--RPKPMKKPEDHHVAIDAPPSSPMDVGNIIPWCFTLIFAN 2562
            KQ QNL LFLDIW LS  +  RP   K+    H      P +P   G IIPW F +IF N
Sbjct: 2649 KQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQP-GKIIPWNFNIIFTN 2707

Query: 2563 INGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGAL 2622
            +N  +            + K WF SD Y  KRQ+L  + D + L ++GRLSG++++  A 
Sbjct: 2708 VNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAG 2767

Query: 2623 WAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGF 2680
            W  EVN+   +  Y  P+VA+   I  ++LK AFDYHMF+I  V N  F LHSERD  G 
Sbjct: 2768 WRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGK 2827

Query: 2681 MPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETV 2740
            +PDLL   L CE+I +CST LVA+N+LD+YNTI+R RQDT  SY ETL ESN  DT+  +
Sbjct: 2828 LPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNI 2887

Query: 2741 DYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETY 2800
             Y DILK LNL++TDV +D++ L +QISPISLFD EVLV+NI N+ A  +T + +KL+T 
Sbjct: 2888 PYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTR 2947

Query: 2801 LHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKS 2860
            L LQ+ NA  +LS++K E+DE+ V+KISV DYM YASKI GGTI  IPKL + M T+QK 
Sbjct: 2948 LELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKV 3007

Query: 2861 NSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVR--RSQSLVGTTGDEEGD 2918
             S+ +EY +   F  K++VRWNLGPVNFIKEMW TH+K+LAVR  R +  V  + +E   
Sbjct: 3008 TSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELES 3067

Query: 2919 VEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVP 2978
              + +  E    K TY+A+ EP I+ PQIKDL DATP +EWFGLNRKKFP FTHQT ++ 
Sbjct: 3068 SPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIV 3127

Query: 2979 VQKLIHSAEKEYANIVGHSQ 2998
            VQKL+H+ EKEYA I+GHS+
Sbjct: 3128 VQKLVHAVEKEYAKIIGHSE 3147

 Score =  174 bits (440), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 122/177 (68%), Gaps = 7/177 (3%)

Query: 7   QFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVN 66
           +F S+SL + K FSWVFLV WILT IL + + FY+ R  A+ ++FI +WLLW+ Y++K++
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 67  IESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGA 126
            ES+R+SLL  RI FKNL II ++ TIS L G+I W+YWL   R+  +  EL+ +  +  
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAY--ELHQQQKEHG 123

Query: 127 SLQ-----RNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEH 178
            +      +N +L C+ L +CEG E+F+YN+T AY+N I  FS +E+ K++EFL++H
Sbjct: 124 YITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  134 bits (337), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 107/190 (56%), Gaps = 12/190 (6%)

Query: 238 LNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKE-KLDIYKTKLTMDAKN 296
           LN+ P  +K++  S + GNKFTPSLLI+S  SAEG++D       ++D+YK K+ +D +N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 297 VSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLG----LSRKKKNRPSV 352
             + +K NI Y ++   K       LS+LW  F      +  PL      SR  KN   +
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 353 TAN------FHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTY 406
             N      F +KW+GLSLYK+    +  N  + IEFD   HEYA++ SI+K PR I T 
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAAL-NRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 407 EFDIPGFVPH 416
           E+DIPG VP+
Sbjct: 477 EYDIPGIVPY 486

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2088 bits (5410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1169/3071 (38%), Positives = 1782/3071 (58%), Gaps = 153/3071 (4%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D  SQF +I + K  +FSWVFLVDW+L ++LS++V+FY GRA+A+ I+ + +W+LW+RY+
Sbjct: 2    DAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTEL--NA 120
            +K+NI+SL++S LGGR+FFKNLT+I KD TISFL G  +WRYWL   R    L EL  + 
Sbjct: 62   VKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSR-KTLLEELEKSG 120

Query: 121  EDDDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVF 180
            E+ D    Q++  L CR  LE +G ELF+YNRTVAYD  ++  +K+++  F++F      
Sbjct: 121  EEKD----QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFE---- 172

Query: 181  TDRAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNY 240
                             K +DE      T +S    +     NDR F ++++ +++ L +
Sbjct: 173  ------GGEDSLHSSEEKLEDE------TLASDSSVSNVDSTNDRNFQEQDS-RSMLLQF 219

Query: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300
            LP+ +KV+  + ++GN  TPS++I+  +SAEGV+D CQ  EKLD+YK +  +D  NV + 
Sbjct: 220  LPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLK 279

Query: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKP--LGLSRKKKNRPSVTANFHQ 358
            +K NI + +E  +K  +   ++S++W  F K   F R    L  S  +K        F +
Sbjct: 280  IKPNISFGDENPIKSYIVHSRMSRVWKKF-KKIFFERMSHYLAHSDNQKIMFVKHQQFFE 338

Query: 359  KWRGLSLYKNYMFEDVQNDLD--------DIEFDLAGHEYAKFTSIIKCPRAILTYEFDI 410
            KWRGL+LY  Y      + +         ++  D+  HEYAK+T I+K  +  +TY +DI
Sbjct: 339  KWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDI 398

Query: 411  PGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQ 470
            PG VPHGA  T+   DGPD+GN+GAPP F L+ +L+G ++CYGPWA RQ+ ++Q +L P 
Sbjct: 399  PGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPI 458

Query: 471  ISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRP 530
            +SRD  P+K L PG RR+YT F L +++ ED  WRIPTRESSKD +FL+ Y+ +    RP
Sbjct: 459  VSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERP 518

Query: 531  FGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLN 590
            FGWLD+K +K++       +C T  G +N +  HL   EIRSSVNHDIF K+ +     +
Sbjct: 519  FGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISAD 578

Query: 591  LGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTIN 650
            LG+PLGWN +A+W     S Q+ TF LR+HI L++D   DF +G PTPYELFRPF+Y   
Sbjct: 579  LGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFE 638

Query: 651  WKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIY 710
            W +D YSIYLNVND NI+NNPLDFNENCYLS HGD L +D +V    I   +T ++Y+I 
Sbjct: 639  WSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIR 698

Query: 711  TPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKST 770
            TP F L L+ P W+TL+EFMK+KEVGR+YDF   G+Y  ++++DV N+D I I C SK T
Sbjct: 699  TPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYT 758

Query: 771  VLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGS--LFEKYSDDAS--- 825
             L C GFVIRYLMNI MNYFGDF HF T+EEYT ++  K     +  + +  SD++S   
Sbjct: 759  TLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMS 818

Query: 826  --TFVSDFDKNNE-------EDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETI 876
              +FV++  +  E       ED KVK     AD++RK NE D+W TF + +G L+ PE I
Sbjct: 819  STSFVTNDKETTEYDLHEFNEDPKVK----RADLKRKENEKDVWFTFCVEDGCLVFPENI 874

Query: 877  YNCDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVK 936
            Y+C  CI LHF  L +D+R  NYYMDL ASL    ++++S+  P  IF+ VR C G  V 
Sbjct: 875  YDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGL-VD 933

Query: 937  GH-SYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGF 995
            GH  ++S +NIH HRM+GLP  E TYFCKWDF +G++ ++S++DF KGL+ +F KIGFG+
Sbjct: 934  GHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGY 993

Query: 996  DDLENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYS 1055
             D EN+L+YE     DMT++T+        + +   +    L L+ +    IDFENE+YS
Sbjct: 994  KDYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYS 1053

Query: 1056 TRMDIRIPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMND 1115
             +M  +IP +KL +   + ++SK      FET ++   F   ++   HR LQR++IT++D
Sbjct: 1054 NKMSAKIPNIKLLV---SEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHD 1110

Query: 1116 APFHRCGFILPASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTS 1175
            +P+HRC F+LP  YQ +V+Y KL+G+I                T + I +  L ++    
Sbjct: 1111 SPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDY 1170

Query: 1176 DCIILNLPYPDSTNL---NSDSFNSYPDTAPHTLSDTIIRKSPL----PEDERDNYVIDF 1228
            +C   +  Y   T +   NS        T+      +  +  P     P+ E D+++I+ 
Sbjct: 1171 ECCS-DANYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINL 1229

Query: 1229 RYISISIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKI--- 1285
                I+I+P     +  +   F       +ID+ EI +V++ S +    S++ N ++   
Sbjct: 1230 GKTIIAINPSSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAP 1289

Query: 1286 RILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIEKNREKSL-----------TEVTTLMK 1334
            +I F   F   +    +  Y D L  E+N  S++  ++K              EVT+ +K
Sbjct: 1290 KICF--TFGSPKGKFEVSDY-DHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLK 1346

Query: 1335 LNSIRASVNAKYSRGKTEGQP-PALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQV 1393
             +SI   +N +  + KT  +  P  S++ E ++FWS +++   NS+   ++D  ++ +Q+
Sbjct: 1347 ASSINFFINQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQL 1406

Query: 1394 VWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAF 1453
             WL ++          +  +F K + L    +KELI R  +AS  Y I HD  VITKPA+
Sbjct: 1407 EWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAY 1466

Query: 1454 ITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFS 1513
            ITRLS+ H+RENRSW+IITRLRHI+ YLP  W +   + LK+ ++    DA+  F+ +FS
Sbjct: 1467 ITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFS 1526

Query: 1514 SWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIV 1573
            +WR+WEFSDV + YIY +VFL+ ++ K+ +     +K     +  ++ ++    D  F+V
Sbjct: 1527 NWRSWEFSDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSL-SSSTHEDEDFMV 1584

Query: 1574 TK------SNLVFEE----TPDTTESGYNQEKVINVTGNLGSIKGKISDKMFKLHNLMNL 1623
             K      SN + E     +   TE   + EK+I ++ N+ SI+G + D + KL  + + 
Sbjct: 1585 VKNLKSVISNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIRGDLGDNIVKLVRMYDG 1643

Query: 1624 VQQQEDPALKSIS---SFSRSFKLNIAXXXXXXXXXXVFGETSLTNTIHSGKASFLWENP 1680
            +    D  LK+ S            +           + G+  +  +  +  ++F+   P
Sbjct: 1644 LSNLSDTNLKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVP 1703

Query: 1681 -KGPTKETASLVLYAKRCETSMKHRNSMLFENQITGXXXXXXXXXXXXHPSIVANFQCDD 1739
             K  TK   SL       E  ++H +++L E+ +              H       +   
Sbjct: 1704 SKSETK--VSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGG 1761

Query: 1740 INLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTNDSPKP-TPTKINPFLLVD 1798
            +++  M  TE  + F+    A  + +++   +    K   T  + KP T +++N    V 
Sbjct: 1762 LSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNT---VT 1818

Query: 1799 LDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQ 1858
            LD T   S  SL+I P+ PF   Q T  +E         N    I D D+ L S  +KQ+
Sbjct: 1819 LDAT--LSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQR 1876

Query: 1859 YFRLSLGNIIVGYTNGRLVNTIH-NLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKK 1917
            Y + S   + +  +N    N +  N+ V++ I KLT S+P   ++S ++DE    ++  +
Sbjct: 1877 YLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQ 1936

Query: 1918 LQVLGNLFSSE-PEINTIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADV 1976
            L+ L   F S+  E +       I W L+ +++Y+GI++ + +  +V E++ +L SL++ 
Sbjct: 1937 LKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNN 1996

Query: 1977 DYGEIYREADEAS--GQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQ 2034
                 Y E       G  S++N+L LI    +   LS+++DL+  +   Q+  +   + Q
Sbjct: 1997 ISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQ 2056

Query: 2035 IESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXXXXXXXXXX 2094
            IES H R    P SL ++LW  ++   +   Y+   S                       
Sbjct: 2057 IESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSS---------LLQHKKTAPTDISE 2107

Query: 2095 XXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSN 2154
                     ILSYNFC+GW+F    +TD GLI GY RLF+AY+K  GKLTL+DA+FS+++
Sbjct: 2108 LSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAH 2167

Query: 2155 GRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKI 2214
            G +SDTF+S+G E+D++NRS+LP++QI YW     +  ++F+R+ GE LDVNFLSS + I
Sbjct: 2168 GASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGI 2227

Query: 2215 IEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKEDAPRKDIA 2274
                ++SIQ FQELKK +V+P                      T    EK  ++    + 
Sbjct: 2228 ANGAVKSIQTFQELKKTMVDPFA--------------------TNKTTEKPVNSEAAPLD 2267

Query: 2275 PFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHL 2334
            P LS IR  NC  KY GG+FK++S EDI++N  PSFE+ SP V + +DYK+    +K H 
Sbjct: 2268 PILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHW 2327

Query: 2335 IRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSRPSQNIDYKRL 2394
            IR L+TV+ ++N LF  C P+L  +++D+++M+              +S  S  ++YK+L
Sbjct: 2328 IRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTIS--SSGMNYKKL 2385

Query: 2395 LNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNT 2454
            L +FDI F +   +Q +SLSCEPKAKVQA+VGF+     + TN+LD SEPLS ++ +++ 
Sbjct: 2386 LRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHL 2445

Query: 2455 RSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFL 2514
            R+  RHIFSRE S SF +D ID  F+ THP II  +G  L+SDV++YFN+KQLQ+L LFL
Sbjct: 2446 RATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFL 2505

Query: 2515 DIWKLSN--LLRPKPMKKPEDHHVAIDAPPSSPMDV---GNIIPWCFTLIFANINGKVDX 2569
            DIWK  +  L  PK          + D  P S        N  PW +TLIF+NI G +D 
Sbjct: 2506 DIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDL 2565

Query: 2570 XXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNW 2629
                        ++W  SDH+   RQ L  +++ I L++ GRL G + ++   W++E++W
Sbjct: 2566 GPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISW 2625

Query: 2630 PKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKV 2687
            P     Y  PL++LS  + +++LK +FDYHMFLI  V + +  L++ERD  G + DLL V
Sbjct: 2626 PVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAV 2685

Query: 2688 MLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILK 2747
             +TC +I +  TAL +AN +D+YNTI+RMRQD   SY+ETL++SNT  TK     +++L+
Sbjct: 2686 SVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLE 2745

Query: 2748 VLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYN 2807
             L+L++TD+ V I+   +Q+ P +LFD+EVLV+   ++ A+ +T    K++T L+ QL+N
Sbjct: 2746 SLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHN 2805

Query: 2808 AHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEY 2867
               SLS+ K + +E++VS+I V++Y+ +A+K+ GGTI   P + + M T+Q+ +S+++E 
Sbjct: 2806 FKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIEL 2865

Query: 2868 GYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGD--EEGDVEKRMRD 2925
             Y S+FG K+ V+WNLGP+NFI+EMW TH++ALA+RR   +        E+  +E++++D
Sbjct: 2866 LYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKD 2925

Query: 2926 EETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHS 2985
             +  +K  YI +EEP+I+ PQIKDLGDATP +EWFG+NR++FP  THQ+V+VP+QKL H 
Sbjct: 2926 VDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHM 2985

Query: 2986 AEKEYANIVGH 2996
            AE+EYA ++G+
Sbjct: 2986 AEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1568 (39%), Positives = 910/1568 (58%), Gaps = 86/1568 (5%)

Query: 5    VSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLK 64
             SQF  +SL   +DFSWVFLVDW+L L +S+   FY GR   + ++F+ EWL WKRY++K
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 65   VNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDD 124
            ++I+SL++S LGGRIFFKNLT++ ++ T SFL G I+WRYWL   R   F     +E+ D
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKA--SENID 119

Query: 125  GASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFL--NEHVFTD 182
             +     EKL CR  +EC+G+E F+YN+T A+DN +    +E+  +F++F   N    TD
Sbjct: 120  KSV----EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTD 175

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMA-NDRIFHDEETGKNLFLNYL 241
                             +D    +S+ E+S    +    + NDR F   ++    FL  L
Sbjct: 176  ECSVD------------EDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPP-FLKLL 222

Query: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301
            PL+  V   + V+GNK + S++++S +  +GV+D C P  K+D+YK K+  + +   +SL
Sbjct: 223  PLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISL 282

Query: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDN----FVKATAFVRKPLGLSRKKKNRPSVTANFH 357
            K N+    E  LK  +   KLSKLW      F K  +   K    S K   R     N  
Sbjct: 283  KPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTR-----NPL 337

Query: 358  QKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHG 417
            ++WRGL LY  +  ED   D D  +FDL+ HEYA++T ++KC   +L Y FD PG VPHG
Sbjct: 338  KRWRGLGLY--WKEEDAAWD-DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHG 394

Query: 418  AHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKP 477
            A PT  ++DGPD+GN+G PP + ++IQ+ G SL YGPW+  ++  +Q L +P +SRD +P
Sbjct: 395  ALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQP 454

Query: 478  VKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLK 537
            V+ L PG +R+YT  +L I++  +  WRIPTRE+SKD EFL+ ++ T ++ RPFGWL++ 
Sbjct: 455  VEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVS 514

Query: 538  FSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGW 597
             S+ S   FN A+C TA G  NT+ +H    EIR+SVNHDI + +++      +G+PLGW
Sbjct: 515  LSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGW 574

Query: 598  NEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYS 657
            N+KA+W  +  S+Q + F+L++HITL+ D +SDF +GEPTPYELFRPF YT NW   GYS
Sbjct: 575  NKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYS 634

Query: 658  IYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLM 717
            IYLNVND NIVNNP++FNENCYLSFHGD L ++  VP++ I   +T I+Y ++TP+FRL 
Sbjct: 635  IYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLN 694

Query: 718  LNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGF 777
            +N P WNTL+EFMK KEVGR+ +F  +G+YL +++LDVDN+D I I C SKST L CYG+
Sbjct: 695  MNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGY 754

Query: 778  VIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEE 837
            V+RY + +KMNYFGDF HF T+EEY E++        +   K + D+ T + +  K  +E
Sbjct: 755  VLRYFLGVKMNYFGDFVHFKTTEEYMEELRGT-----NAVTKTTHDSETEIQEAPKQMDE 809

Query: 838  DDK-----VKVP--RGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGEL 890
            D       +K P       ++R  NE D+W TF + +G  +LPE +Y+CD C AL F  L
Sbjct: 810  DSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSL 869

Query: 891  AIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENV-RQCNGRDVKGHSYISNINIHGH 949
             ID+R  NYYMD+ A+L  + +R+  +    E+FE   R   G  V G   +S ++IH H
Sbjct: 870  DIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQKGRALCGELVAGR--LSRLHIHTH 927

Query: 950  RMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVV 1009
            RM+GLPP E TYFCKWDF LGT+ L S++ F  G + +++K+GFGF D EN++ Y+   +
Sbjct: 928  RMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPI 987

Query: 1010 DDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCN--IDFENEKYSTRMDIRIPLLKL 1067
             DMT+VT+ +    I+    ++     + LN         D EN  YS+R+D+ +  L  
Sbjct: 988  LDMTSVTLAID--AIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTA 1045

Query: 1068 SLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPA 1127
            S+   N +++K ++  +F T I  +NFC  ++ + H   Q+ +I  NDAPFHRC F++P 
Sbjct: 1046 SIIDKN-KSNKAIA--SFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL 1102

Query: 1128 SYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEYNTTSDCIILNLPYPDS 1187
            + QNS  Y+ L+G I               E  + + Q +L   N + D +    P  + 
Sbjct: 1103 TLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEV 1162

Query: 1188 TNLNSDSFNSYPDTAPHTLSDTIIRKSPL--PEDERDNYVIDFRYISISIDPELFFYIEK 1245
             N NS S   +       L D     S    P  E +  V++     +SI PE +  I  
Sbjct: 1163 KNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGN 1222

Query: 1246 LLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVF---WGQRDTGGI 1302
             +   +     Q ID+IE+ +V           +  N ++ +   DV    + + +T  +
Sbjct: 1223 AVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDV 1282

Query: 1303 ELYLDTLDFEMNEKSIEKNREKSLT---------EVTTLMKLNSIRASVNAKYSRGKTE- 1352
            E     +    N+ S++ + +K L          + T+L+K+ S+   V  K  + KT+ 
Sbjct: 1283 E---GQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDK-KTKF 1338

Query: 1353 ---GQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNF----FGDQKE 1405
                +  A    V+ ++ WS       +S+ L SI+A++   +  WL +F    F D K+
Sbjct: 1339 AEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQ 1398

Query: 1406 LIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVREN 1465
            LI  +     + +K    + +E   R++ AS+ YQI+HDP VITKPA+ITRL   HVRE+
Sbjct: 1399 LINRLSYCTGQFRK----AEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRES 1454

Query: 1466 RSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVAR 1525
            RSWKI+TRLRHI+ YLP      +   LK  +Y     A+  F+ +FS+W NW++SDV +
Sbjct: 1455 RSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEK 1514

Query: 1526 SYIYNKVF 1533
             Y+Y +VF
Sbjct: 1515 CYMYRRVF 1522

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1224 (33%), Positives = 667/1224 (54%), Gaps = 52/1224 (4%)

Query: 1790 KINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLY 1849
            K+ P   +++D +   +++SL     +   F++ T  + ++ S+       F   D D++
Sbjct: 1779 KVAPQFALNIDISDLTTDISLLSSLAITKNFKKLT--LAYEQSASSALKLAFETLDIDVF 1836

Query: 1850 LGSHLTKQQYFRLSLGNIIVGYTNGRLVN-TIHNLDVSASIVKLTFSEPHRMLFSFLQDE 1908
              S  T QQY ++S  NI       +  N +   + + ++I KL   +P  +     +D 
Sbjct: 1837 --STRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDI 1894

Query: 1909 REVSRSVKKLQVLGNLFSSEPEINTIPAGA-----KIDWRLNADIKYLGILIPVSTTFFV 1963
             +    +  L+      +++ + + +  G         W     + Y+G+LIP+ +T ++
Sbjct: 1895 AQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYI 1954

Query: 1964 FEMHTLLASLADVDYGEIYREADEAS--GQVSVDNILFLIKDRTIPSTLSRIIDLSFKIS 2021
             E++ + A +   ++     E  + +  G +S  +I FLI DR +P  LSR++D +  I 
Sbjct: 1955 TELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIK 2014

Query: 2022 AIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXX 2081
              ++  E   S QIESP+ R   SP+SLVRIL+  ++L  L    +R     L       
Sbjct: 2015 IAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTVGKL------- 2067

Query: 2082 XXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCG 2141
                                  +LSYNFC+GW+F  N   + GLI GY RLF+A+EK  G
Sbjct: 2068 --PESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYG 2125

Query: 2142 KLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGE 2201
            KLTL+DA+FS++ G TSD FY+  N  +  NRSFLP++QI YW+++     ++FIR++GE
Sbjct: 2126 KLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGE 2185

Query: 2202 TLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPG 2261
             LDV FLS  + +    ++S+ +F ELKK  V+P                      +V  
Sbjct: 2186 RLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFK--------------------SVAN 2225

Query: 2262 KEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDL 2321
             ++          P LS I++V+C+ +Y GG+F++YS +D+++   PSF++ SP V I  
Sbjct: 2226 PKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILF 2285

Query: 2322 DYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQR 2381
            DY+  +     H++R  + V S+HN +F  C P+L  +++DI+ ++            + 
Sbjct: 2286 DYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKS 2345

Query: 2382 VSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDT 2441
            VS+ S  +DY+  L   DI F I   +Q++S SCEPKAKVQA++GF+     + TNDLD 
Sbjct: 2346 VSQES--LDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDM 2403

Query: 2442 SEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVY 2501
            SEPLS ++ +    +  RHIFSRE S S  +D +   F+ THP+ I+ +G   I +++VY
Sbjct: 2404 SEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVY 2463

Query: 2502 FNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS------SPMDVGNIIPWC 2555
            FN+KQLQ+L +F++IWK  + +  +P    E H  A+ +           +      PW 
Sbjct: 2464 FNIKQLQDLNIFVNIWKPDSYVFTQPELDSE-HSRALTSEEKPLVAKFKKVSSTTSFPWN 2522

Query: 2556 FTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGI 2615
            F LI + I G +D             + W  +DHY    Q L   +++I L++ GRL G 
Sbjct: 2523 FILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGT 2582

Query: 2616 VELDGALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHS 2673
            + L    W + + WP  +  +  PLV L  ++    LK++FDYH+ LI +V      L +
Sbjct: 2583 LLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFN 2642

Query: 2674 ERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNT 2733
            +RD  G   +LL V ++     +  TAL  AN+LD+YNTI+RMR+D   SY ETL +SNT
Sbjct: 2643 KRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNT 2702

Query: 2734 TDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHA 2793
             DT+     KDIL  L+ ++T++ V +  +++QI P  LFD+EVL     +     +   
Sbjct: 2703 KDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEG 2762

Query: 2794 GEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEIS 2853
             EKL+T+L  Q++    +LS  K ++ E   S+I V++Y+ +A K  GGTI  IP + I 
Sbjct: 2763 DEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIG 2822

Query: 2854 MHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTG 2913
            M T+    ++ +E  Y ++FG KI +RWNLG +NF++EMW TH++A+A+RRS +      
Sbjct: 2823 MTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGF 2882

Query: 2914 DEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQ 2973
             E+  +E+++RD +   +  Y+ +EEP I+ PQ KDLG+ATP +EWFG+NRK+FP  THQ
Sbjct: 2883 FEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQ 2942

Query: 2974 TVIVPVQKLIHSAEKEYANIVGHS 2997
             +IVP+QKL H AE E+A I+G +
Sbjct: 2943 AMIVPLQKLAHIAETEWARILGRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1573 (38%), Positives = 882/1573 (56%), Gaps = 96/1573 (6%)

Query: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65
            S+F  + +   +DFSWVFL DW+L L +S+   FY GR + + I+ I E+L WKRY +KV
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125
                       GR+FFKNLT+I +D T S L G I+WRYWL   R     T L ++ +  
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSR----KTSLESQSEKA 107

Query: 126  ASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTDRAX 185
            A      KL CR  +EC+G+E F+YNRT A+DN +    +E++   ++F     F+D + 
Sbjct: 108  A------KLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF-----FSDPSP 156

Query: 186  XXXXXXXXXXXXKAQDEVEIKSYTESSFDE-SNESQMANDRIFHDEETGKNLFLNYLPLQ 244
                         AQ     KS+ E+S    S  ++  NDR +    +  + FL  LPL+
Sbjct: 157  RATEETSTENDSAAQ-----KSHLETSMSSPSASTESLNDRTYQLPNSMPS-FLRLLPLE 210

Query: 245  IKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLKQN 304
              V   + ++GNK T S+++ S +  +G +D C P  K+D+YK KL  D     +SL+ N
Sbjct: 211  YSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPN 270

Query: 305  IGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVT--ANFHQKWRG 362
            + Y+ +  LK      +L KL   + +    VRK   LSR  K   +     N  ++WRG
Sbjct: 271  LCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRY-LSRGSKTESTRKDLRNPLERWRG 329

Query: 363  LSLYKNYMFEDVQNDLDDI-EFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421
            L LY    +++     DD+  F+L  HEYA+++ ++KC   ++ Y  D PG VPHGA PT
Sbjct: 330  LGLY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPT 385

Query: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481
            L  +DGPD+GN GAPP F L+IQ+FG ++ YGPWA  ++  IQ + +P +SRD  P + L
Sbjct: 386  LEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERL 445

Query: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541
              G  R++T  ++ I++  D  WRIPTRE SKD +FL+ YK T +D RPFGWL+L  ++ 
Sbjct: 446  SAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEG 505

Query: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601
            S    N A+C T+ G  N + +H    EIR+SVNHDI + +++ D +  +G+PLGWN KA
Sbjct: 506  SEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKA 565

Query: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661
            KW  ++ S Q   F+L++HITL+ D +SDF TG+PTPY+LFRPF+Y  NW+L GYS+YLN
Sbjct: 566  KWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLN 625

Query: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721
            VND NIVNNP+DFNENCYLSFHGD L +   VP+D I   +T I YN+YTP+FRL +N P
Sbjct: 626  VNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTP 685

Query: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781
             WNTL+EFMK KEVGRA DF   G+YL +++LDV+N+D I I C S+ T L CYG+V+R+
Sbjct: 686  SWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRF 745

Query: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEEDDKV 841
            L+ +KMNYFGDF HF T+EEY E++    Y E     K + + S   ++     E +DK 
Sbjct: 746  LVGVKMNYFGDFVHFKTTEEYMEELRD-AYVE----PKANSEQSANSTETTTAGEGEDKQ 800

Query: 842  KVPRGPA---------DVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAI 892
              P+             ++R  NE D+W TF + +G L+LP+ +Y+C+ C A  F  L I
Sbjct: 801  NAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDI 860

Query: 893  DVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVR-QCNGRDVKGHSYISNINIHGHRM 951
            D+R  NYYMDL A+L  +I+R  S+  P  +F     +C  R   G   IS+++IH HRM
Sbjct: 861  DLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGS--ISDLHIHAHRM 918

Query: 952  YGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDD 1011
            +GLPP E TYFCKWDF +G + + S++  +     ++ K+ F F D EN++ Y+   + D
Sbjct: 919  FGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILD 978

Query: 1012 MTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYG 1071
            MT++  +  + ++ I++  +     + + N+    +DFENE+YS+R D+ I  + + +  
Sbjct: 979  MTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQV-- 1036

Query: 1072 YNYEASKELSFF-NFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQ 1130
               E  K+ S   +F + +  T FC  KN + H   Q+ +I  NDAPFHRC F+LP + Q
Sbjct: 1037 --KEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQ 1094

Query: 1131 NSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLH-EYNTTSDCIILNLPYPDSTN 1189
             S  Y+KL GSIV              E    I+ +FL  E N+     + N  +     
Sbjct: 1095 RSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ---MGNEHFCSKKE 1151

Query: 1190 LNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNH 1249
             +  +FN        T +D+ +        E ++ V+       SI            + 
Sbjct: 1152 EDGYAFNFASGLMSSTENDSNV--------ESESLVVKLIKPQASISACCIKPFRSFSDQ 1203

Query: 1250 FYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTL 1309
             Y +   Q+IDS EI +V              N K+    F++      +  I    DT+
Sbjct: 1204 AYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTV 1263

Query: 1310 DFEMNEKSIE---------KNREKS-LTEVTTLMKLNSIRASVNAKYSRGKTEG--QPPA 1357
            D  + E S++          + EKS + ++T L+K+ S+   V+     G  E   +   
Sbjct: 1264 DIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQL 1323

Query: 1358 LSLMVEGVKFWSTTAKKVINSIILTSIDATI--DETQVVWLF--NFFGDQKELIGSVVKT 1413
             S  ++ ++FW T+     +S   TSID  +  D+T++  +F  N   +   +   V   
Sbjct: 1324 CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVH 1383

Query: 1414 FEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITR 1473
             E++QK    ++++   R++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITR
Sbjct: 1384 KERLQK----AQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITR 1439

Query: 1474 LRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVF 1533
            LRHI+ YLP      +   LK   + A  +A  IF+++FS WR+WE SDV + Y+Y K F
Sbjct: 1440 LRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF 1499

Query: 1534 LANQAEKQQKTVN 1546
             + Q E Q   +N
Sbjct: 1500 YS-QYEGQAGPLN 1511

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1229 (34%), Positives = 684/1229 (55%), Gaps = 83/1229 (6%)

Query: 1801 FTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYF 1860
            F     + + +I  + P    +  K +  +F  +   + +  + + DL L S +T QQY 
Sbjct: 1764 FEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYL 1823

Query: 1861 RLSLGNI-IVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQ 1919
            ++S   + +    + ++      + + +++ K    +P  ++ +  QD     +++++L+
Sbjct: 1824 KVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLK 1883

Query: 1920 V----LGNLFSSEPEINTIPAGA--KIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASL 1973
            +    LG LF ++     + AGA    +W    D+KY+G+L+P+ TT ++ E++ L +SL
Sbjct: 1884 IHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSL 1943

Query: 1974 ADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSY 2033
            +  +  E         G++SV  I FLI D+ +P  LS++++ +F+I   +    S  S 
Sbjct: 1944 SCDEAAEFSFPL--VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSL 2001

Query: 2034 QIESPHLRFCFSPYSLVRILWGGHQ------LLALHSHYRRHHSKNLWDFLPXXXXXXXX 2087
            QIES H R    P+SL+RIL   ++      L AL  +     S +  DF          
Sbjct: 2002 QIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFF--------- 2052

Query: 2088 XXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVD 2147
                            ILSY+FC+GW+F N+G +++GL  GY RLF+A+EK  GKLTL+D
Sbjct: 2053 ------NISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLD 2106

Query: 2148 AFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNF 2207
            A+F ++ G TS+ FY   +E D+ NRS LP++QI YW +      ++F+R++GE LDV+F
Sbjct: 2107 AYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSF 2166

Query: 2208 LSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKED 2267
            LS  + I     +S+ +FQELK+  ++P                             K +
Sbjct: 2167 LSKSIGIAGGFARSLHLFQELKRQYLDPF----------------------------KPE 2198

Query: 2268 APRKDIA--------PFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319
             P K +         P LS I  VNC+ +Y GG+FK+YS +DI+    PSF++ SP V +
Sbjct: 2199 EPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDV 2258

Query: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXX 2379
              +Y   +   + HL+R L++V+S+HN LF  C P++  ++ DI+ ++            
Sbjct: 2259 IFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVET-- 2316

Query: 2380 QRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDL 2439
             R S   + I+Y+ LL   DI F +   +Q++SLSCEPKAKVQA+VGF+ F   + TND 
Sbjct: 2317 PRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDF 2376

Query: 2440 DTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVE 2499
            D  EPLS +L + N  +  RHIFSRE S S  ++ +   FM THP+ I+ +G   I  ++
Sbjct: 2377 DVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTID 2436

Query: 2500 VYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS--SPMDV-------GN 2550
            VYFN+KQLQ+L +F++IWKL +    K + +PE  +  +  P +   P+          +
Sbjct: 2437 VYFNIKQLQDLNVFINIWKLDS----KILSQPELDNKFVIGPTNLEKPLTSKYKKVISNS 2492

Query: 2551 IIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKG 2610
              PW F +I + I G++D             K W  +DHY    Q L   +D++ L++ G
Sbjct: 2493 SFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDG 2552

Query: 2611 RLSGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTV 2668
            RL G   L    W +++ WP  +  +  PLV L+  +   ++K+ FDYH+ LI +V    
Sbjct: 2553 RLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLS 2612

Query: 2669 FHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETL 2728
              L ++RD  G + +LL V L+ +   +  TAL  AN+ D+YNTI+RMR+D   SYLETL
Sbjct: 2613 LSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETL 2672

Query: 2729 RESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCAN 2788
             +SNT DTK +    +IL  L+ ++T++ V +  +++Q+ P +LFD+EV+     +    
Sbjct: 2673 GDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTF 2732

Query: 2789 VKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIP 2848
             +T   +KL+T L L+++N   +LS+ K ++ E + S+I V++Y+ +ASK+ GGTI   P
Sbjct: 2733 SQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTP 2792

Query: 2849 KLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSL 2908
             + I M T+    ++ +E  Y ++FG KI VRWNLG +NF++EMW TH +A+A+RRS + 
Sbjct: 2793 AILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNG 2852

Query: 2909 VGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFP 2968
               +  E+  +  +++D +   + TYI +EEP I+ PQ KDLG+ATP +EWFG+NRK+FP
Sbjct: 2853 QSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFP 2912

Query: 2969 IFTHQTVIVPVQKLIHSAEKEYANIVGHS 2997
              THQ VIVP+QKL H AE E+A I+G +
Sbjct: 2913 GLTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1362 (38%), Positives = 770/1362 (56%), Gaps = 64/1362 (4%)

Query: 216  SNESQMANDRIFHDEETGKNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMD 275
            S  ++  NDR +    +  + FL  LPL+  V   + ++GNK T S+++ S +  +G +D
Sbjct: 5    SASTESLNDRTYQLPNSMPS-FLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLD 63

Query: 276  YCQPKEKLDIYKTKLTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAF 335
             C P  K+D+YK KL  D     +SL+ N+ Y+ +  LK      +L KL   + +    
Sbjct: 64   ACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLR 123

Query: 336  VRKPLGLSRKKKNRPSVT--ANFHQKWRGLSLYKNYMFEDVQNDLDDI-EFDLAGHEYAK 392
            VRK   LSR  K   +     N  ++WRGL LY    +++     DD+  F+L  HEYA+
Sbjct: 124  VRKRY-LSRGSKTESTRKDLRNPLERWRGLGLY----WKENDPAWDDVFHFELPKHEYAR 178

Query: 393  FTSIIKCPRAILTYEFDIPGFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCY 452
            ++ ++KC   ++ Y  D PG VPHGA PTL  +DGPD+GN GAPP F L+IQ+FG ++ Y
Sbjct: 179  YSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHY 238

Query: 453  GPWAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESS 512
            GPWA  ++  IQ + +P +SRD  P + L  G  R++T  ++ I++  D  WRIPTRE S
Sbjct: 239  GPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPS 298

Query: 513  KDAEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRS 572
            KD +FL+ YK T +D RPFGWL+L  ++ S    N A+C T+ G  N + +H    EIR+
Sbjct: 299  KDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRT 358

Query: 573  SVNHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFS 632
            SVNHDI + +++ D +  +G+PLGWN KAKW  ++ S Q   F+L++HITL+ D +SDF 
Sbjct: 359  SVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFG 418

Query: 633  TGEPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDIT 692
            TG+PTPY+LFRPF+Y  NW+L GYS+YLNVND NIVNNP+DFNENCYLSFHGD L +   
Sbjct: 419  TGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFR 478

Query: 693  VPKDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNE 752
            VP+D I   +T I YN+YTP+FRL +N P WNTL+EFMK KEVGRA DF   G+YL +++
Sbjct: 479  VPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSK 538

Query: 753  LDVDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYG 812
            LDV+N+D I I C S+ T L CYG+V+R+L+ +KMNYFGDF HF T+EEY E++    Y 
Sbjct: 539  LDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRD-AYV 597

Query: 813  EGSLFEKYSDDASTFVSDFDKNNEEDDKVKVPRGPA---------DVRRKTNETDLWLTF 863
            E     K + + S   ++     E +DK   P+             ++R  NE D+W TF
Sbjct: 598  E----PKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTF 653

Query: 864  NIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEI 923
             + +G L+LP+ +Y+C+ C A  F  L ID+R  NYYMDL A+L  +I+R  S+  P  +
Sbjct: 654  IVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHL 713

Query: 924  FENVR-QCNGRDVKGHSYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMK 982
            F     +C  R   G   IS+++IH HRM+GLPP E TYFCKWDF +G + + S++  + 
Sbjct: 714  FSGSEGRCPSRANFGS--ISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCIL 771

Query: 983  GLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNM 1042
                ++ K+ F F D EN++ Y+   + DMT++  +  + ++ I++  +     + + N+
Sbjct: 772  SFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENV 831

Query: 1043 QFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKELSFF-NFETKINFTNFCNYKNCV 1101
                +DFENE+YS+R D+ I  + + +     E  K+ S   +F + +  T FC  KN +
Sbjct: 832  TARGVDFENERYSSRADVDIHSITVQV----KEGGKDGSLIGDFSSSLKITKFCQLKNFL 887

Query: 1102 QHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFE 1161
             H   Q+ +I  NDAPFHRC F+LP + Q S  Y+KL GSIV              E   
Sbjct: 888  VHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVT 947

Query: 1162 FIIQDFLH-EYNTTSDCIILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPEDE 1220
             I+ +FL  E N+     + N  +      +  +FN        T +D+ +        E
Sbjct: 948  MILDEFLKGEKNSLQ---MGNEHFCSKKEEDGYAFNFASGLMSSTENDSNV--------E 996

Query: 1221 RDNYVIDFRYISISIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSI 1280
             ++ V+       SI            +  Y +   Q+IDS EI +V             
Sbjct: 997  SESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQC 1056

Query: 1281 NNFKIRILFFDVFWGQRDTGGIELYLDTLDFEMNEKSIE---------KNREKS-LTEVT 1330
             N K+    F++      +  I    DT+D  + E S++          + EKS + ++T
Sbjct: 1057 KNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDIT 1116

Query: 1331 TLMKLNSIRASVNAKYSRGKTEG--QPPALSLMVEGVKFWSTTAKKVINSIILTSIDATI 1388
             L+K+ S+   V+     G  E   +    S  ++ ++FW T+     +S   TSID  +
Sbjct: 1117 ALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWV 1176

Query: 1389 --DETQVVWLF--NFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHD 1444
              D+T++  +F  N   +   +   V    E++QK    ++++   R++ AS+ YQI HD
Sbjct: 1177 HSDKTELCCIFLKNTAANIDTITEVVSVHKERLQK----AQRDFFYRISTASDEYQIIHD 1232

Query: 1445 PYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDA 1504
            P VITKPA+ITRL   HVREN+SWKIITRLRHI+ YLP      +   LK   + A  +A
Sbjct: 1233 PPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNA 1292

Query: 1505 KSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVN 1546
              IF+++FS WR+WE SDV + Y+Y K F + Q E Q   +N
Sbjct: 1293 GEIFLNIFSKWRSWESSDVEQCYMYRKAFYS-QYEGQAGPLN 1333

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1229 (34%), Positives = 684/1229 (55%), Gaps = 83/1229 (6%)

Query: 1801 FTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYF 1860
            F     + + +I  + P    +  K +  +F  +   + +  + + DL L S +T QQY 
Sbjct: 1586 FEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYL 1645

Query: 1861 RLSLGNI-IVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQ 1919
            ++S   + +    + ++      + + +++ K    +P  ++ +  QD     +++++L+
Sbjct: 1646 KVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLK 1705

Query: 1920 V----LGNLFSSEPEINTIPAGA--KIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASL 1973
            +    LG LF ++     + AGA    +W    D+KY+G+L+P+ TT ++ E++ L +SL
Sbjct: 1706 IHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSL 1765

Query: 1974 ADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSY 2033
            +  +  E         G++SV  I FLI D+ +P  LS++++ +F+I   +    S  S 
Sbjct: 1766 SCDEAAEFSFPL--VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSL 1823

Query: 2034 QIESPHLRFCFSPYSLVRILWGGHQ------LLALHSHYRRHHSKNLWDFLPXXXXXXXX 2087
            QIES H R    P+SL+RIL   ++      L AL  +     S +  DF          
Sbjct: 1824 QIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFF--------- 1874

Query: 2088 XXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVD 2147
                            ILSY+FC+GW+F N+G +++GL  GY RLF+A+EK  GKLTL+D
Sbjct: 1875 ------NISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLD 1928

Query: 2148 AFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNF 2207
            A+F ++ G TS+ FY   +E D+ NRS LP++QI YW +      ++F+R++GE LDV+F
Sbjct: 1929 AYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSF 1988

Query: 2208 LSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKED 2267
            LS  + I     +S+ +FQELK+  ++P                             K +
Sbjct: 1989 LSKSIGIAGGFARSLHLFQELKRQYLDPF----------------------------KPE 2020

Query: 2268 APRKDIA--------PFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319
             P K +         P LS I  VNC+ +Y GG+FK+YS +DI+    PSF++ SP V +
Sbjct: 2021 EPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDV 2080

Query: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXX 2379
              +Y   +   + HL+R L++V+S+HN LF  C P++  ++ DI+ ++            
Sbjct: 2081 IFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVET-- 2138

Query: 2380 QRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDL 2439
             R S   + I+Y+ LL   DI F +   +Q++SLSCEPKAKVQA+VGF+ F   + TND 
Sbjct: 2139 PRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDF 2198

Query: 2440 DTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVE 2499
            D  EPLS +L + N  +  RHIFSRE S S  ++ +   FM THP+ I+ +G   I  ++
Sbjct: 2199 DVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTID 2258

Query: 2500 VYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS--SPMDV-------GN 2550
            VYFN+KQLQ+L +F++IWKL +    K + +PE  +  +  P +   P+          +
Sbjct: 2259 VYFNIKQLQDLNVFINIWKLDS----KILSQPELDNKFVIGPTNLEKPLTSKYKKVISNS 2314

Query: 2551 IIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKG 2610
              PW F +I + I G++D             K W  +DHY    Q L   +D++ L++ G
Sbjct: 2315 SFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDG 2374

Query: 2611 RLSGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTV 2668
            RL G   L    W +++ WP  +  +  PLV L+  +   ++K+ FDYH+ LI +V    
Sbjct: 2375 RLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLS 2434

Query: 2669 FHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETL 2728
              L ++RD  G + +LL V L+ +   +  TAL  AN+ D+YNTI+RMR+D   SYLETL
Sbjct: 2435 LSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETL 2494

Query: 2729 RESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCAN 2788
             +SNT DTK +    +IL  L+ ++T++ V +  +++Q+ P +LFD+EV+     +    
Sbjct: 2495 GDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTF 2554

Query: 2789 VKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIP 2848
             +T   +KL+T L L+++N   +LS+ K ++ E + S+I V++Y+ +ASK+ GGTI   P
Sbjct: 2555 SQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTP 2614

Query: 2849 KLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSL 2908
             + I M T+    ++ +E  Y ++FG KI VRWNLG +NF++EMW TH +A+A+RRS + 
Sbjct: 2615 AILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNG 2674

Query: 2909 VGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFP 2968
               +  E+  +  +++D +   + TYI +EEP I+ PQ KDLG+ATP +EWFG+NRK+FP
Sbjct: 2675 QSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFP 2734

Query: 2969 IFTHQTVIVPVQKLIHSAEKEYANIVGHS 2997
              THQ VIVP+QKL H AE E+A I+G +
Sbjct: 2735 GLTHQGVIVPLQKLAHLAESEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1578 (32%), Positives = 813/1578 (51%), Gaps = 112/1578 (7%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D  ++F +I +   + F WVFLV+W   +++++   FY+ RAI + ++ I  W++WKRY+
Sbjct: 2    DFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            + +NI+SL  S++GG+++FKN++I D+D TIS L G  +WRYWL  PR P  L   N  D
Sbjct: 62   VVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPR-PTQLKNSNIND 120

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
            ++           CR  LEC+GVELF+YN+   Y++ +   +K ++    +F        
Sbjct: 121  ENSK---------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF-------- 163

Query: 183  RAXXXXXXXXXXXXXKAQDEVEI--KSYTESS-----FDESNESQMANDRIFHD--EETG 233
                            A D+  I  +  T+SS      DES+E       I +    ++ 
Sbjct: 164  ----------------ATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSA 207

Query: 234  KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMD 293
              L+L++LP ++ +S  + VVGNK TPS+ I+     EG++D   P   LD YK +   +
Sbjct: 208  VPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFE 267

Query: 294  AKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAF-VRKPLGLSRKKKNRPSV 352
              +  VS+K NI +      K     GK   LW        F +   L  +  KK     
Sbjct: 268  LSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTG- 326

Query: 353  TANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPG 412
               F   W+GL++Y     +      D+I FDL  HEYAK+T+I+   R  L Y +D PG
Sbjct: 327  QEEFLTSWKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPG 383

Query: 413  FVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQIS 472
             +      T + I G + G+    P + +++QL+  +  YGPWA RQ+ +   + +P +S
Sbjct: 384  VI------TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVS 437

Query: 473  RDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFG 532
            RD    +    G+ R +  F+  IV+ ED  WRIPT+E SKDA FL  YK+TN++ R FG
Sbjct: 438  RDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFG 497

Query: 533  WLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLG 592
            W+D+K +KD+  S    L ++  G +NT   +L +  I +SVNHD+   +K+        
Sbjct: 498  WIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQS 557

Query: 593  FPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWK 652
            +P  WN    W ++  SS LE F+LR+H  L+ D  +DF++G+  PYELFRP LY  +W 
Sbjct: 558  YPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWD 617

Query: 653  LDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTP 712
            +  YS+YLN ND NIVNNPLDFNENCY+S HG+   + + +P + I   +  ISY IYTP
Sbjct: 618  ISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTP 677

Query: 713  MFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVL 772
             F + L  PPW+TL+EFM  + VGR+++F  +G+YL YN++D+DNVD I + C +     
Sbjct: 678  KFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATF 737

Query: 773  HCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD 832
              YGF++RY+MN+K+NYFG+F  F T+EEY+E+++ +      +F    DD +T +   +
Sbjct: 738  LAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTEL--VE 795

Query: 833  KNNEEDDKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFG 888
             N+  +    +  G     A ++R  NE D+W+TF   +G  +LPE+ Y+   C  LHF 
Sbjct: 796  PNSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFD 855

Query: 889  ELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHG 948
             +  D+R  +YY DL  S++   +++Y +V  N +F+              Y+S  NIH 
Sbjct: 856  NITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHI 915

Query: 949  HRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEV 1008
            HRM+GLPP E TY  K D  LG +  ES+++ +KG +    K  FGFD+ E+VL YE   
Sbjct: 916  HRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMAR 975

Query: 1009 VDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIP---LL 1065
              D++ ++    D  I ++N + +    L + N+    +DF   KYS R +I IP    L
Sbjct: 976  SFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFL 1035

Query: 1066 KLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFIL 1125
              S+  +N      +      T I+F  F    +      LQ  +I ++DAPF RC F+ 
Sbjct: 1036 VSSMDDHN------IVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLH 1089

Query: 1126 PASYQNSVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHE-YNTTSDCIILNLPY 1184
            P  YQ S +Y+ LY SI                 F+ I ++ L + Y         ++  
Sbjct: 1090 PQEYQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISN 1149

Query: 1185 PDSTNLNSDSF-----NSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPEL 1239
                 LN D F     NS+       L+  I+ +      E  ++V +  +I+I I  ++
Sbjct: 1150 DTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDEL----HEVRSFVFELPHINIDIHIDV 1205

Query: 1240 FFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKI-------RILFFDV 1292
                  L         +  ID + + +V   S    G SS+   K+       R+  ++ 
Sbjct: 1206 LEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEY 1265

Query: 1293 F-------WGQRDTGGIELYL--------DTLDFEMNEKS-IEKNREKSLTEVTTLMKLN 1336
            +       +   D   ++L L        ++ + EMN K+ +    + +L     L K N
Sbjct: 1266 YALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKEN 1325

Query: 1337 SIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWL 1396
             I  S ++++S   T  +       +EG  F+      ++    L      I++     +
Sbjct: 1326 FIYPSESSEFSYKSTFEE-------LEGYAFYD---DDLVTDANLQRGCVFINQEHSDSI 1375

Query: 1397 FNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITR 1456
              F         + +K+    +      ++EL+ R+  A + Y I HDP VITKPA ITR
Sbjct: 1376 SEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITR 1435

Query: 1457 LSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWR 1516
            LSR HVRE+RSW+I+TRLRH++ YLP  W ET + +L++ K+ + +DAK  F+ +F+ WR
Sbjct: 1436 LSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWR 1495

Query: 1517 NWEFSDVARSYIYNKVFL 1534
            +WEF+DV R ++Y K ++
Sbjct: 1496 SWEFADVERCFLYKKTYI 1513

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1235 (34%), Positives = 652/1235 (52%), Gaps = 77/1235 (6%)

Query: 1786 PTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWD 1845
            P    + P  +V ++       +++ +  ++PF  R   K+ E      R      ++ D
Sbjct: 1759 PDSQVLKPIAMVKMNIAA----INIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSLQD 1814

Query: 1846 SDLYLGSHLTKQQYFRLSLGNI-IVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSF 1904
            + + L S   ++ Y + S   + ++G   G   N +  + + +S  KL+  EP + +  F
Sbjct: 1815 TSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDN-LGRISLDSSFSKLSIFEPKKNMRLF 1873

Query: 1905 LQDEREVSRSVKKLQVLGNLF---SSEPEINTIPAGAKIDWRLNADIKYLGILIPVSTTF 1961
            L D   + ++VK +++L +      S    N  P    I  +LN +++Y+G+L+   TT 
Sbjct: 1874 LSD---IEQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTL 1930

Query: 1962 FVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKIS 2021
            +V E + L  S +  D           S   S ++I FLIKDR +  TLS+++D S +I 
Sbjct: 1931 YVLEFNNLEFSFSK-DKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIK 1989

Query: 2022 AIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHY-----RRHHSKNLWD 2076
             I+  + +  S QIES +L    SP SLVR+L   ++   + S Y     R   S +   
Sbjct: 1990 VIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIKPRSTSSNSTLS 2049

Query: 2077 FLPXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAY 2136
             LP                       HILSYN C+GWLF    + + GLI GY RLF+ Y
Sbjct: 2050 ILPISIKS-----------------AHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVY 2092

Query: 2137 EKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFI 2196
            +K  GKLTL+DA+FSV++G +S T+Y DGNE+   NRS+LP++QI YWL+     KD+FI
Sbjct: 2093 DKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFI 2152

Query: 2197 RLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXX 2256
            R++GE LDV+ L+ +  I++   QS+  F++LK+ +++PL                    
Sbjct: 2153 RVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLK---------------VTSN 2197

Query: 2257 XTVPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPG 2316
              + G+    D P        S +R +NC   Y G   K+YS +DI+     SFEIRSP 
Sbjct: 2198 DPILGEWNYLDNP------LASSVRSINCIINYAGSSMKLYSRDDIQHG-TCSFEIRSPA 2250

Query: 2317 VTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXX 2376
             T+ +DYK      K H IRTL TVN+THN LF  C PLL  +      M+         
Sbjct: 2251 HTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSN 2310

Query: 2377 XXXQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILT 2436
                  S  ++ I+Y+ LL +FDI   I   +Q++SL+CEP AK+QA +GF+ F   I T
Sbjct: 2311 GAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFT 2369

Query: 2437 NDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLIS 2496
            N +   EPL  ++ + N  ++ RH+FSRE S+S  L  I + F  TH   I+ +G+ LIS
Sbjct: 2370 NSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLIS 2429

Query: 2497 DVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPSSP----MDVGNII 2552
                YFNVKQ+++L LFL+IW +        +        + ++ PS P    + +    
Sbjct: 2430 KPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPSMPKLQRVPINATF 2489

Query: 2553 PWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRL 2612
             W + LI + I  ++D               W  S H     Q L   + +I +++ GRL
Sbjct: 2490 SWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRL 2549

Query: 2613 SGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFH 2670
             G V +   +W +++ WP  ++ +  PLV LS  +   + K++FDYHMF I T+ N    
Sbjct: 2550 GGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIE 2609

Query: 2671 LHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRE 2730
            L +++D  GF+ DLL V ++ + I +  T+L  ANL D+Y+TI RMR D+  + L+ L E
Sbjct: 2610 LFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-E 2668

Query: 2731 SNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVK 2790
            SN      + D   +L  L  ++T++ V+   LN+ I   +L   EV+V+    V AN K
Sbjct: 2669 SNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTK 2728

Query: 2791 THAGE------KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTI 2844
              A        K++T L  QL +   SLSS K ++DE+ + KI V DY+  AS I GG I
Sbjct: 2729 NEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGII 2788

Query: 2845 FDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRR 2904
             + P + ++M+T+Q   S+++E  Y S+FG+ +++ WNL P+NFIK+MW+ HI A+ +R 
Sbjct: 2789 LEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRH 2848

Query: 2905 SQ----SLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWF 2960
             Q    S +    DE  D+E ++   +  +K  Y  +EEP I+ P+IKDLGDATP +EWF
Sbjct: 2849 MQKGNSSEIHIPKDE--DIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWF 2906

Query: 2961 GLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVG 2995
            GLNR +FP  THQ V+VP+QKL   AEKEY  I+G
Sbjct: 2907 GLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1597 (32%), Positives = 807/1597 (50%), Gaps = 125/1597 (7%)

Query: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62
            D+ S F  IS+   KD S  FLVDWIL +IL I   FY+GR +AW ++   ++ +W++Y+
Sbjct: 2    DSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYK 61

Query: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122
            +K+N++S++VS LGGRIFFKNLT++  D+TISFL G  +WRYWL   RI     +  +ED
Sbjct: 62   IKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGI--DFESED 119

Query: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182
             D +    N KL CR LL+C+G+E+F+YN+   Y++ ++          + F N  V  D
Sbjct: 120  GDAS---ENAKLPCRFLLQCDGLEVFVYNKIDVYESVLR----------DHFTN--VTKD 164

Query: 183  RAXXXXXXXXXXXXXKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLNYLP 242
                           KA    ++ + +  S+   ++S  A             LF    P
Sbjct: 165  GQETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKL-----SAKTKLF----P 215

Query: 243  LQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLK 302
            +Q++ + A+ V+GN+ T  + +   + A+GV D       LD Y+TK+++D  +    L+
Sbjct: 216  IQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELR 275

Query: 303  QNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWRG 362
             N+GY  +  +K  +    + K+W    K    + K L L  + K   +  A +   W+G
Sbjct: 276  TNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLL-LPNQGKTINNQQA-YIDSWKG 333

Query: 363  LSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPTL 422
            L LY  +  + VQ +  D    L   EYA+++ ++K  R  LTY FDIPG VP  +    
Sbjct: 334  LDLY--HHTKAVQEENVDTTV-LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSIN 390

Query: 423  SSIDGPDIGN---NGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQ-KPV 478
            S  D  +  N   +   P FG +I ++  ++ YGPWA + +  I  L +P +SRDQ K  
Sbjct: 391  SQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKAT 450

Query: 479  KPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKF 538
            KP +PG  R+Y  FKL +   +     IPTRESSKD EF++ YK T + +R FGWL++  
Sbjct: 451  KP-EPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSL 509

Query: 539  SKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWN 598
            ++     FN ALCS AD   N + + L + EI+SSVNH++  +  +     N+G+P GWN
Sbjct: 510  NEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWN 569

Query: 599  EKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSI 658
            ++A W   + S   E FLLR+HI+LI+D  +DFS  +   YELFRPF Y I W    Y +
Sbjct: 570  KQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKL 629

Query: 659  YLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLML 718
            +LNVND NI+NN LD NENC+LS  GDILN  I +P   I     + ++ + +P+ +L +
Sbjct: 630  FLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSI 689

Query: 719  NAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFV 778
            + P WNTL+EF+     G   DF  TG Y+ +  +DVDN D I I   S ST    +GFV
Sbjct: 690  HPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFV 749

Query: 779  IRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEED 838
            +RYLMNIK+NYFGDF HF T+EEY+  +S +            +D  T   +F +    D
Sbjct: 750  LRYLMNIKLNYFGDFNHFKTTEEYSNDLSME------------EDTKTKTKNFQEQPTND 797

Query: 839  DKVKVPRG-----------------PADVRRKTNETDLWLTFNIWEGALLLPETIYNCDP 881
             +                        + + R  NETD+W+TF + +G +++PE +Y+C  
Sbjct: 798  VESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQR 857

Query: 882  CIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYI 941
               L F  L  D+R TNY+MDL A    I L   +       F  V        +   Y+
Sbjct: 858  SFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYL 913

Query: 942  SNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENV 1001
             ++N+HGHRM+G+PP E TY CKWD  +G++  +S+  F+   + + QK+GF + D EN+
Sbjct: 914  DDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENI 973

Query: 1002 LLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIR 1061
            L+Y     +D+T++T+++     I+      S A L LN++   + D  N +YS R+D+ 
Sbjct: 974  LIYSIHKPEDVTSLTISIGRVSSIVRTNHGGS-ATLSLNDITINSWDLSNSRYSKRVDLL 1032

Query: 1062 IPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRC 1121
            +  + +          K+   F  +T +  T F    N   HR  Q++ + +ND+PFHRC
Sbjct: 1033 VAAISVCAID-----EKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRC 1087

Query: 1122 GFILPASYQN-SVIYQKLYGSIVXXXXXXXXXXXXXEETFEFIIQDFLHEY----NTTSD 1176
             F+L     N S +Y  L GSI               +TF+ I +  L  Y    N  +D
Sbjct: 1088 KFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTD 1147

Query: 1177 CIILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTI---IRKSPLPEDERDNYVIDFRYISI 1233
             I       D+ NL  D  +   D     LS+T+   +      E E +N  ++   +S+
Sbjct: 1148 II-------DTKNLTDDRPD---DKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSV 1197

Query: 1234 SIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINN---FKIRILFF 1290
             + P+ F + E   +         ++D  E+ +V   S     +  I N   F   ++  
Sbjct: 1198 FVTPKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFS-----VGHITNGKFFNSSVMLK 1252

Query: 1291 DVFWGQRDTGGIEL----YLDTLDFEMNEKSI------------EKNREKSLTEVTTL-M 1333
            +V     D   ++      LD L+  ++  S+            + N    +T+ +T+  
Sbjct: 1253 NVKVNISDETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISC 1312

Query: 1334 KLNSIRASVNAKYSRGKTEGQPPA-LSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQ 1392
              +S++ ++        T+  P A   +++     +S   K  ++ +I  SI + I +  
Sbjct: 1313 NFDSLQFNIFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGK--VSKLIFGSIKSAILDAD 1370

Query: 1393 VVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPA 1452
            V W   +     +      K+  ++ KLR+   KE I R+    +   I   PY+ITKPA
Sbjct: 1371 VEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPA 1430

Query: 1453 FITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAK--QLKERKYNASKDAKSIFMS 1510
            +ITRLS+ HVR+  SWKIITRLRH+  +     +ET ++   + E   N  KD KS F+ 
Sbjct: 1431 YITRLSKFHVRDTASWKIITRLRHVSKH-TSHVSETTSQCDDIPEEVRNICKD-KSQFLD 1488

Query: 1511 VFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNK 1547
            +F  W+NW+  +V +S ++  +F       ++   N+
Sbjct: 1489 IFVDWKNWDVYEVEQSSLFTLLFSGESTVHEEDLFNE 1525

 Score =  592 bits (1526), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 393/1251 (31%), Positives = 642/1251 (51%), Gaps = 99/1251 (7%)

Query: 1772 DDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIM--PIVPFQFRQETKKMEF 1829
            DD+   TP +DS K           VDL +       SL +     VPF  R     ++F
Sbjct: 1739 DDMKAITPDHDSEKKNGH-------VDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDF 1791

Query: 1830 KFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASI 1889
             F +    +   N   ++L L  +  + +  R+S     V Y +  L+  I    +   I
Sbjct: 1792 NFKNLSGISIIVNY--TELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTDI---GLDTDI 1846

Query: 1890 VKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFS-SEPEINTIPAGAKIDWRLNADI 1948
            VKLT S+ +R+    L D    + S + +++  N  + +EP     P      +++NA  
Sbjct: 1847 VKLTLSD-NRVYIEELTDSLNGTVS-ELIKIFKNKNADNEP---AAPKFKPCSFKMNA-- 1899

Query: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVS--VDNILFLIKDRTI 2006
             Y+G+L  + TT +V E +    S A          A++   ++S  + N+  L+ +  +
Sbjct: 1900 IYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEV 1959

Query: 2007 PSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILW----GGHQLLAL 2062
              TLS+I D+ F +  I+  ++   + QIE+PH R   +P +L+ +++        L  +
Sbjct: 1960 LPTLSKIFDIGFALKLIEDDIKK--TLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKV 2017

Query: 2063 HSHYRRHHSKNLWDFLPXXXXXXXXXXXXXXXXXXXXXXCHILSYNFCVGWLFQNNGDTD 2122
                + + S N  +  P                       +ILS   C+GW+F+ + D +
Sbjct: 2018 KQKGKFNSSSNAIEIPPYFETLS----------------VNILSNKLCLGWIFEEDTD-E 2060

Query: 2123 AGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQII 2182
             G+++GY  LF+AYEK  GKLT+VD + + + G+ S+ F+   N   + NRS L ++QI 
Sbjct: 2061 NGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANGVPELNRSHLSSMQIN 2119

Query: 2183 YWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQE-LKKVLVNPLTQXXX 2241
            +W       KD+F+R++ + LDV  L++ V+I+     SI+ FQ+ L K+          
Sbjct: 2120 FWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQKKLAKI---------- 2169

Query: 2242 XXXXXXXXXXXXXXXXTVPGKEKKEDAPRKDIAPFLSD------IRKVNCQFKYDGGIFK 2295
                                  KK      ++A  LSD      IR +NC  KY GGI  
Sbjct: 2170 -------------------SNIKKSSISTHNVAENLSDKVSILSIRSINCIAKYGGGIIN 2210

Query: 2296 VYSFEDI-ESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAP 2354
            +Y+ +DI + +   S E+ SP + + LDY +N    K H IR+L+ V STHN+LF+ C P
Sbjct: 2211 LYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVP 2270

Query: 2355 LLMALSQDIQHMVXX--XXXXXXXXXXQRVSRPSQNI--DYKRLLNSFDILFKIISSEQK 2410
            +L+ L+ +IQ  +              Q  +  +Q I  DYK L    D    I    Q 
Sbjct: 2271 VLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQN 2330

Query: 2411 LSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASF 2470
            ++L+CEP+AK+QA++GF +F  ++ T+  D SEPLS +L       + RHIFSRE S+S 
Sbjct: 2331 ITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSA 2390

Query: 2471 GLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKK 2530
            G++ + + FM TH N I  +G  LISD++ Y N+KQLQ + LFLDIW        K  K 
Sbjct: 2391 GINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKT---KKAQKL 2447

Query: 2531 PEDHHVAIDAPPSSPMDVGN-IIPWCFTLIFANINGKVDXXXXXXXXXXXMRKAWFASDH 2589
                H      P +  +     IPW + +IF N +  +D           +   W +S H
Sbjct: 2448 GSGPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHH 2507

Query: 2590 YESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISN 2647
                   +  Y+D++   + GRL G+ E+    + + ++WP  D+ +  PL+ L+F +S+
Sbjct: 2508 RVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSH 2567

Query: 2648 ISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLL 2707
            +S K+ FDYH FLI  V +    + +ERD SG + DLL V ++   +++  TAL +ANL 
Sbjct: 2568 LSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLY 2627

Query: 2708 DLYNTIMRMRQDTNVSYLETLRESNTTDT-KETVDYKDILKVLNLIQTDVVVDINTLNVQ 2766
            D+Y T  RMR +   SY++TL+ESN   + K      ++L  L L +T++  +I +  + 
Sbjct: 2628 DIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGSFRLY 2686

Query: 2767 ISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSK 2826
            + P +LFD EVLV+    +     T   +K +T L  Q+ + + SL+  K E+ E+  ++
Sbjct: 2687 VFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAE 2746

Query: 2827 ISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPV 2886
            +SVE+Y   A+ + G  I   P + + + T+QK     +E+ Y S+FGDK+ ++WNL P+
Sbjct: 2747 LSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPI 2806

Query: 2887 NFIKEMWTTHIKALAVRRSQSLVGTTGD--EEGDVEKRMRDEETLSKLTYIAIEEPQIDT 2944
            NFI+EMW TH++AL+VRR  +    +    E+ ++ ++++     +K  YI +EEP I+ 
Sbjct: 2807 NFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEM 2866

Query: 2945 PQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVG 2995
            P ++DLG+ATP +EWFG+NRK+FP   HQ ++VP+QKLI+ AE +Y   +G
Sbjct: 2867 PLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1538 (30%), Positives = 774/1538 (50%), Gaps = 121/1538 (7%)

Query: 33   LSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVNIESLRVSLLGGRIFFKNLTIIDKDYT 92
            + I  +FYVGR + + +S  A  +LWK+YR+ V+I+SL  S L G++ FKN+++  +D  
Sbjct: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 93   ISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGASLQRNEKLACRLLLECEGVELFLYNR 152
            IS L G I+WRYWL    I ++     A   DGA         CR  L+ EG E F+YNR
Sbjct: 61   ISVLKGTITWRYWL----IGRYRRSGTA---DGAR-------RCRFALKFEGFEYFVYNR 106

Query: 153  TVAYDNTIKMFSKEERAKFEEFLNEHVFTDRAXXXXXXXXXXXXXKAQDEVEIKSYTESS 212
               YD   +    E+ +                             A+  V + S  E  
Sbjct: 107  NGVYDRIARELDGEDTS-----------------------------AEPTVSVPSVEEVI 137

Query: 213  FDESNESQMANDRIFHDEETGKNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEG 272
                  +++ +D           L   +LP++   +  + V+GNK T S+ I++ +   G
Sbjct: 138  ------AELQDDP----------LIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAG 181

Query: 273  VMDYCQPKEKLDIYKTKLTMDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKA 332
             +    P +       +      N +V++K NI Y  +  +K  +   + ++LW  +   
Sbjct: 182  TVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTL 241

Query: 333  TAFVRKPLGLSRKKKNRPSVTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAK 392
               V +   L  K+K     T  ++  WRGLS+Y   + E++    ++++FD+  HEYAK
Sbjct: 242  LGTVLEAT-LHAKRKKEQHQTPKWYDNWRGLSMYDVNLDEELD---EEVKFDIEHHEYAK 297

Query: 393  FTSIIKCPRAILTYEFDIPGFV-----PHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFG 447
             T+++K  +  +TY + +PG        +  +P L   + P++ ++       ++I ++ 
Sbjct: 298  CTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLL---ERPELDHS-------VDILVYD 347

Query: 448  GSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIP 507
             +  YGPWA RQV     + +P + R+ K   P +  ++     FKL + + ED   R+P
Sbjct: 348  ANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVP 407

Query: 508  TRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGD 567
             +ESSKDA FL  YK T ++ RPFGW+D++ +K+S  +   A   T +G +N +  +L D
Sbjct: 408  MKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVD 467

Query: 568  SEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKAKWTINVASSQLETFLLREHITLIADT 627
            + I +SVNHD  +K+KS D  ++  +P GW +KA+W  NV S+Q E F+LR+H+ LI+D 
Sbjct: 468  TTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDL 527

Query: 628  MSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDIL 687
            ++DFS GE   YE FRPF Y   W + GYS YLNVND NI+NNP+DF ENCYLS HGD  
Sbjct: 528  VTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDA 587

Query: 688  NVDITVPKDRIDARATDISYNIYTPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNY 747
             +  ++P   I  +   + +NI+TP F L LNAPPW+T +E + +KE+GR+ +F   G+Y
Sbjct: 588  EITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSY 647

Query: 748  LIYNELDVDNVDMITIICSSKSTVLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKIS 807
              Y+E+DVDNVD + I C +   V+ CYG +++ ++N+K+NYFG+  HF T+EEY E++ 
Sbjct: 648  TSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQ 707

Query: 808  SKGYGEGSLFEKYSDDASTFVSDF---DKNNEEDDKVKVPRGPADV-----RRKTNETDL 859
             +     S    ++ D +   SD    + N   D       GP  +     +R  NE D+
Sbjct: 708  RRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDV 767

Query: 860  WLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQ 919
            W TF    G    PE IY  D C+  +F  L   +R  NYY+D   SLD I  ++++++ 
Sbjct: 768  WFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDID 827

Query: 920  PNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVD 979
               +F+ +           +Y+S  +   H+M G+ P+E +Y C++D  + T+ +  ++ 
Sbjct: 828  ARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLA 887

Query: 980  FMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELIL 1039
             +K  V + + + FGF D+EN L YE+E V D+  ++  +++  + + N +      L L
Sbjct: 888  VLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSL 947

Query: 1040 N--NMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNY 1097
            N       + D  NE+YS R D+ IP L   +Y  + E++       F T +  T F  +
Sbjct: 948  NLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGDSEST---CLGAFSTGVTVTLFERF 1004

Query: 1098 KNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKLYGSIVXXXXXXXXXXXXXE 1157
            +   + R LQR +I +NDAPFHRC F+LP  Y+   IY+ LYG I               
Sbjct: 1005 EQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISA 1064

Query: 1158 ETFEFIIQDFL----HEYNTTSDCIILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRK 1213
            + FE I +  L     EY + S   I +    DS +     +++    A    S ++  +
Sbjct: 1065 DNFEVIFEKLLGEIYQEYASDSSYQITD----DSISSTEHDYHNQTVNAAIGTSSSLFIR 1120

Query: 1214 SPLPEDERDNYVIDFRYISISID---PELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKR- 1269
            S   +    +++++F  I   +D    E    I K L     D   + IDS+EIG++ + 
Sbjct: 1121 SQNHQQTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLD---EAIDSLEIGIINQF 1177

Query: 1270 LSNFQE--GISSINNFKIRILFFDVFWGQRDTGG------IELYLDTLDFEMNEKSIEKN 1321
            +  F E  GIS     ++R+L  ++     +         +   +  LD     KS + N
Sbjct: 1178 IQTFGEDNGIS-----EVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPN 1232

Query: 1322 REKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPAL-SLMVEGVKFWSTTAKKVINSII 1380
             +    + T   K++ IRA++  +        QP  L S  +E ++ + +  K  +    
Sbjct: 1233 LKPDPEKTTLCYKIDYIRANI-VQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNN 1291

Query: 1381 LTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQ 1440
            + S   T+       LF F          + +     +     S++E +  +      Y+
Sbjct: 1292 VQSCSVTLSPGTDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYE 1351

Query: 1441 ISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNA 1500
            I HDP VITKPA ITR S  H+R   SW+II RLRHI+ YLP +W+++  + L  + + +
Sbjct: 1352 IQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTS 1411

Query: 1501 SKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQA 1538
             ++A   F+S+FS WR+WE +DV  S+++ KVF   ++
Sbjct: 1412 PEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRS 1449

 Score =  536 bits (1382), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 371/1227 (30%), Positives = 588/1227 (47%), Gaps = 86/1227 (7%)

Query: 1806 SNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLG 1865
            +N++L +  + PF      +  E +  S  +  F  N  +S + + S   K  YF+ +  
Sbjct: 1711 ANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHT 1770

Query: 1866 NIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLF 1925
             + +  T+        ++     I+KL+  +    +   LQD +    S+K L  + N+ 
Sbjct: 1771 CLKLSGTSSS-ARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNIS 1829

Query: 1926 SSEPEINTIPAGAKIDW------RLNADIKYLGILIPVSTTFFVFEMHTLLA-----SLA 1974
             S P      A A   W       L+    Y G+L+    T ++ E +   A      L 
Sbjct: 1830 QSSPT-----ASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLP 1884

Query: 1975 DVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQ 2034
            D        + D      S+++  FLIKDR I   L++++D +   + +        S Q
Sbjct: 1885 DAITPRPCFKVDH-----SIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQ 1939

Query: 2035 IESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPXXXXXXXXXXXXXXX 2094
            IES HL+   +P ++VR+L   ++   +   +     ++++                   
Sbjct: 1940 IESTHLKITLAPMTVVRLLSLINEFGIIRKQFTE---ESIYTPSSAHNNSTATECLEPSV 1996

Query: 2095 XXXXXXXCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSN 2154
                    HILS++F + WLF     +  GLI GY+RLFS YEK  GKLTL++A+FS + 
Sbjct: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056

Query: 2155 GRTSDT-FYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVK 2213
               S+  FYS    + + N S+L ++Q+ YW    +E  D+FIR+HG  L V+  +  V 
Sbjct: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116

Query: 2214 IIEATLQSIQVFQELKKVLVNPLTQXXXXXXXXXXXXXXXXXXXTVPGKEKKEDA----- 2268
            ++E T+QSIQ F  LKK LV+P                          + KK+D+     
Sbjct: 2117 LLEETIQSIQTFNNLKKALVDPF-------------------------RTKKQDSDISKE 2151

Query: 2269 PRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIG 2328
            P        + +R +NC   Y G   K++S  D   +  P  E+ SP   + +DYK    
Sbjct: 2152 PYNWNNQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPN 2209

Query: 2329 DVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVXXXXXXXXXXXXQRVSR-PSQ 2387
              K H  RTLIT   THN  ++  A L+  L      ++               S    +
Sbjct: 2210 LEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVE 2269

Query: 2388 NIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSF 2447
              D   LL S D++  +   +Q+++ SCEPKAKVQA VGF+ F   I  N+++  E L  
Sbjct: 2270 GSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCL 2329

Query: 2448 ALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQL 2507
            A+ ++N  +  RHI+SRE  AS  L  I + F      +  ++G+ LIS    YFN+KQL
Sbjct: 2330 AIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQL 2389

Query: 2508 QNLYLFLDIWKLSNLLRPKPMKK---PEDHHVAIDAPPSS------PMDVGNIIPWCFTL 2558
            Q+L LF+D W      +  PM     PE   V +D    S           +   W +++
Sbjct: 2390 QDLKLFIDQW----FPQKTPMNTGSYPEG--VLVDDISRSIGSKFYKGSSSSSFTWGYSV 2443

Query: 2559 IFANINGKVDXXXXXXXXXXXMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVEL 2618
            I A    +++               W  S       Q L   + ++ +T+ GRL G   +
Sbjct: 2444 IVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLV 2503

Query: 2619 DGALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERD 2676
              A  + E+ WP   D +  PLV +      +  K++FDYH F I ++      L +ERD
Sbjct: 2504 RNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERD 2563

Query: 2677 TSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDT 2736
              G + DLL V ++ E +++  TAL AAN+ D+ N+I R+++D  +SYL +   S+    
Sbjct: 2564 EDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSD 2623

Query: 2737 KETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEK 2796
            +   D   I   L+L++T + +++    +QISP SLFD +VL++    + AN    A  K
Sbjct: 2624 EPEED-GGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIK 2682

Query: 2797 LETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHT 2856
            ++T LH QL +   +L      +DE  ++ + V  Y+  +S I GG IF  P + ++M T
Sbjct: 2683 IKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTT 2742

Query: 2857 FQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRR------SQSLVG 2910
            +Q+  S+++E  Y ++FG  + +RWNLGP++FIK+MW  H+ A+ +R       ++S V 
Sbjct: 2743 WQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVA 2802

Query: 2911 TTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIF 2970
             T      V   M      S   Y+ ++EP I+ P+IKDLGDATP +EWFG+NR KFP F
Sbjct: 2803 VTPLNSKAVPLEMH---LGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGF 2859

Query: 2971 THQTVIVPVQKLIHSAEKEYANIVGHS 2997
            THQ VIVP+QKL  +AEKEY  I+G +
Sbjct: 2860 THQFVIVPLQKLARTAEKEYEKILGRA 2886

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 40/60 (66%)

Query: 6  SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65
          S+F  + +   +DFSWVFL DW+L L +S+   FY GR + + I+ I E+L WKRY +KV
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>SAKL0H21868g Chr8 (1908378..1910726) [2349 bp, 782 aa] {ON} highly
            similar to uniprot|P07264 Saccharomyces cerevisiae
            YGL009C LEU1 Isopropylmalate isomerase catalyzes the
            second step in the leucine biosynthesis pathway
          Length = 782

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 1771 TDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFK 1830
            +D + K TP  D+  P PT + PFL ++          ++D   I+P QF +  K+   K
Sbjct: 532  SDHVTKETPVKDAKAPVPTGMQPFLTLN-GIAAPLDKANVDTDAIIPKQFLKTIKRTGLK 590

>KLLA0B03894g Chr2 complement(352195..356871) [4677 bp, 1558 aa] {ON}
            similar to uniprot|P47170 Saccharomyces cerevisiae
            YJR138W IML1
          Length = 1558

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 2113 WLFQNNGDTDAGLILG--YNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEE-- 2168
            W F+ NG+     ++   + ++F  + K  G    +   F  S  R+  +F    + E  
Sbjct: 312  WHFEENGEETFHKVVNSLFPKIFRKW-KNIGTHHSISIMFCASIDRSDSSFNDVTSGERL 370

Query: 2169 ---DKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSI 2222
               D Y R+ +  + I++W++    ++  FIR+  +  +V  L+  V +I+ +L S+
Sbjct: 371  KNTDDYYRAVVDQVNIVHWVEIMKTLRKEFIRIAQDLRNVK-LNENVSVIKGSLPSV 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 320,791,870
Number of extensions: 14741731
Number of successful extensions: 41619
Number of sequences better than 10.0: 38
Number of HSP's gapped: 41892
Number of HSP's successfully gapped: 63
Length of query: 2998
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2870
Effective length of database: 38,804,151
Effective search space: 111367913370
Effective search space used: 111367913370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)