Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020208.259ON1444144468980.0
Suva_10.1708.259ON1416144035710.0
KAFR0B027108.259ON1416145235690.0
Skud_12.1548.259ON1417144635520.0
YLR086W (SMC4)8.259ON1418144135350.0
Smik_12.1458.259ON1418144935140.0
NCAS0B050008.259ON1409144135100.0
TDEL0F038608.259ON1399137234490.0
Kpol_392.88.259ON1427138733910.0
ZYRO0C01716g8.259ON1413139733510.0
SAKL0H17094g8.259ON1422141633460.0
NDAI0B019708.259ON1415142732450.0
AGR089C8.259ON1370138032270.0
Kwal_56.238258.259ON1396139431240.0
Ecym_43118.259ON1376139531230.0
KLTH0G13750g8.259ON1399139031130.0
TPHA0J007208.259ON1393141230340.0
TBLA0E044108.259ON1422138330310.0
CAGL0L12188g8.259ON1398139329800.0
KLLA0F19085g8.259ON1372139529130.0
Skud_6.648.68ON12307654647e-46
Suva_6.528.68ON12647844522e-44
NCAS0C040008.68ON12237724485e-44
CAGL0F02079g8.68ON12237444291e-41
Smik_6.718.68ON12287724281e-41
YFL008W (SMC1)8.68ON12254343913e-37
TPHA0P003408.68ON12194243602e-33
Kwal_23.50438.68ON12251673431e-31
KLTH0A02706g8.68ON12281533403e-31
TDEL0C009608.68ON12221553342e-30
KLLA0D07502g8.68ON12431543289e-30
AGL023W8.68ON12221563191e-28
NDAI0G033208.68ON12312232536e-21
ZYRO0F03828g8.68ON12172162511e-20
TDEL0H026107.186ON11701862446e-20
TBLA0G035308.68ON12321812447e-20
KNAG0G009108.68ON12261932393e-19
KAFR0C032008.68ON12232182375e-19
Kpol_1063.207.186ON11711842366e-19
ZYRO0D15642g7.186ON11701842341e-18
TPHA0C044407.186ON11701842322e-18
AGR236W7.186ON11701862312e-18
NDAI0G020707.186ON11711862313e-18
Kwal_55.204217.186ON11701862294e-18
SAKL0F07282g7.186ON11701862294e-18
KLTH0E04774g7.186ON11701862285e-18
TBLA0D046107.186ON11741842285e-18
Ecym_73038.68ON12221542286e-18
KAFR0G029307.186ON11701862278e-18
Skud_6.1197.186ON11701842261e-17
NCAS0E019207.186ON11701862261e-17
KNAG0L011607.186ON11701872251e-17
YFR031C (SMC2)7.186ON11701842241e-17
Smik_7.3467.186ON11701842223e-17
CAGL0D05258g7.186ON11701862223e-17
Ecym_43907.186ON11701862205e-17
Kwal_14.24351.295ON12472762197e-17
Kpol_1011.58.68ON12211642188e-17
KAFR0A016101.295ON12272612107e-16
ZYRO0G21296g1.295ON12272312091e-15
Kpol_1018.21.295ON12111862091e-15
Smik_10.1671.295ON12292552091e-15
Suva_6.1047.186ON1170732034e-15
Suva_6.1491.295ON12302562035e-15
YJL074C (SMC3)1.295ON12302562027e-15
KLTH0H09966g1.295ON12242532001e-14
KNAG0B052301.295ON12252391991e-14
NCAS0A093301.295ON12271251973e-14
TDEL0D016201.295ON12232431973e-14
TPHA0I010901.295ON12162691963e-14
NDAI0G056301.295ON12291061921e-13
CAGL0H02805g1.295ON12192061911e-13
Skud_10.1701.295ON12302561902e-13
TBLA0C027401.295ON11191481883e-13
Ecym_63221.295ON12321081856e-13
AAL182W1.295ON12311021768e-12
KLLA0A00286g1.295ON1224971741e-11
KLLA0D16005g7.186ON11701411695e-11
SAKL0B02288g8.68ON12281791597e-10
SAKL0D06116g1.295ON12292051444e-08
KLTH0D02816g7.101ON10941631274e-06
SAKL0B09526g7.101ON10991631231e-05
KNAG0L006307.101ON11082311231e-05
ZYRO0G01584g7.101ON10882161194e-05
Skud_15.1217.101ON1093831141e-04
TDEL0H034907.101ON1103851132e-04
AEL337C7.101ON10971571104e-04
TPHA0L006007.101ON1117831105e-04
NCAS0I005707.101ON10953871095e-04
TBLA0E021907.101ON10891741095e-04
Kpol_1044.137.101ON11032291096e-04
Smik_15.1317.101ON1093831096e-04
YOL034W (SMC5)7.101ON1093831086e-04
Suva_15.1337.101ON1092831060.001
Ecym_26257.101ON10971661060.001
Kwal_26.72047.101ON11171621050.001
CAGL0H05071g4.237ON11101051050.002
KAFR0D013307.101ON1080831050.002
ZYRO0B12122g4.237ON1109781020.004
KLLA0F07997g7.101ON11191411010.004
NDAI0A084507.101ON1119831010.005
NCAS0J013904.237ON109668960.018
CAGL0F01155g7.101ON110585950.021
Skud_12.4684.237ON112068950.024
TBLA0I028904.237ON109866950.024
Suva_10.5004.237ON111568950.024
YLR383W (SMC6)4.237ON111468950.025
Smik_12.4704.237ON111468950.026
NDAI0J021804.237ON110868940.027
KNAG0B060104.237ON111768940.032
Ecym_53444.237ON110254930.044
TBLA0A053001.67ON70763920.051
KLTH0D14080g4.237ON1102240920.053
Kpol_483.104.237ON1118119920.053
KLLA0E05303g4.237ON109892910.069
SAKL0H03322g4.237ON111173890.13
TPHA0B008404.237ON111966880.15
AER044W4.237ON110354870.19
KNAG0F006501.110ON130647860.29
NCAS0B087001.67ON71572840.39
Kwal_26.93804.237ON110285840.41
KAFR0A060404.237ON110268810.94
TDEL0G028102.351ON109471791.8
ZYRO0A07524g2.351ON109071782.4
TPHA0F011902.263ON65896754.8
AFR683C1.67ON67782755.2
NDAI0D018305.267ON189087746.7
Skud_12.2531.67ON69295738.0
ZYRO0F17050g1.67ON71454738.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02020
         (1444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  2661   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1380   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1379   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1372   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1366   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1358   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1356   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1333   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1310   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1295   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1293   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1254   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1247   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1207   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1207   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1203   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1173   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1172   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1152   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1126   0.0  
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   183   7e-46
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   178   2e-44
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   177   5e-44
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   169   1e-41
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   169   1e-41
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   155   3e-37
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   143   2e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   136   1e-31
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   135   3e-31
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   133   2e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   130   9e-30
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   127   1e-28
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             102   6e-21
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   101   1e-20
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    99   6e-20
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    99   7e-20
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    97   3e-19
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    96   5e-19
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    96   6e-19
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    95   1e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    94   2e-18
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    94   2e-18
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    94   3e-18
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    93   4e-18
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    93   4e-18
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    92   5e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    92   5e-18
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    92   6e-18
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    92   8e-18
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    92   1e-17
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    92   1e-17
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    91   1e-17
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    91   1e-17
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    90   3e-17
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    90   3e-17
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    89   5e-17
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    89   7e-17
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...    89   8e-17
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    86   7e-16
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    85   1e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    85   1e-15
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    85   1e-15
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    83   4e-15
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    83   5e-15
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    82   7e-15
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    82   1e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    81   1e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   3e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    80   3e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    80   3e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    79   1e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    78   1e-13
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    78   2e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    76   6e-13
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   8e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    72   1e-11
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    70   5e-11
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    66   7e-10
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    60   4e-08
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    54   4e-06
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    52   1e-05
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    52   1e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    50   4e-05
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    49   1e-04
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    48   2e-04
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    47   4e-04
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    47   5e-04
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    47   5e-04
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    47   5e-04
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    47   6e-04
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    47   6e-04
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    46   6e-04
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.001
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    45   0.001
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    45   0.001
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    45   0.002
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.004
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    44   0.004
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    44   0.005
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.018
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    41   0.021
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    41   0.024
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    41   0.024
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.024
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.025
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.026
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.027
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.032
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    40   0.044
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.051
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    40   0.053
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    40   0.053
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.069
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    39   0.13 
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    39   0.15 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    38   0.19 
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    38   0.29 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.39 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.41 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.94 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    35   1.8  
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    35   2.4  
TPHA0F01190 Chr6 complement(270259..272235) [1977 bp, 658 aa] {O...    33   4.8  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   5.2  
NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {...    33   6.7  
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...    33   8.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   8.9  

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 2661 bits (6898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1327/1444 (91%), Positives = 1327/1444 (91%)

Query: 1    MLDTPSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPL 60
            MLDTPSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPL
Sbjct: 1    MLDTPSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPL 60

Query: 61   DFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXX 120
            DFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMY   
Sbjct: 61   DFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQS 120

Query: 121  XXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFK 180
                           KLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFK
Sbjct: 121  PPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFK 180

Query: 181  SYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFT 240
            SYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFT
Sbjct: 181  SYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFT 240

Query: 241  NLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVT 300
            NLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVT
Sbjct: 241  NLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVT 300

Query: 301  KLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQK 360
            KLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQK
Sbjct: 301  KLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQK 360

Query: 361  TVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVN 420
            TVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAA                 TQYHLYVN
Sbjct: 361  TVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVN 420

Query: 421  NDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRK 480
            NDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRK
Sbjct: 421  NDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRK 480

Query: 481  REINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLS 540
            REINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKN                 VNDLS
Sbjct: 481  REINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLS 540

Query: 541  KQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIR 600
            KQREVEE             TVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIR
Sbjct: 541  KQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIR 600

Query: 601  DSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLN 660
            DSKRKVGAEI                    VTDLNKSKRNLVKEKQEGDKECKDAGVKLN
Sbjct: 601  DSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLN 660

Query: 661  EMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYD 720
            EMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYD
Sbjct: 661  EMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYD 720

Query: 721  VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPR 780
            VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPR
Sbjct: 721  VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPR 780

Query: 781  LFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSG 840
            LFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSG
Sbjct: 781  LFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSG 840

Query: 841  GGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900
            GGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC
Sbjct: 841  GGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900

Query: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQ 960
            DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIK         GNLEALNQ
Sbjct: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQ 960

Query: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXX 1020
            ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQA          
Sbjct: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVK 1020

Query: 1021 XXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ 1080
              NTELKKARKSLIA           IAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ
Sbjct: 1021 KLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ 1080

Query: 1081 ELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVT 1140
            ELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVT
Sbjct: 1081 ELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVT 1140

Query: 1141 HTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI 1200
            HTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI
Sbjct: 1141 HTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI 1200

Query: 1201 SMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLV 1260
            SMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLV
Sbjct: 1201 SMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLV 1260

Query: 1261 EFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAEL 1320
            EFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAEL
Sbjct: 1261 EFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAEL 1320

Query: 1321 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1380
            ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1321 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1380

Query: 1381 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE 1440
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE
Sbjct: 1381 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE 1440

Query: 1441 DLIQ 1444
            DLIQ
Sbjct: 1441 DLIQ 1444

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1380 bits (3571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1440 (51%), Positives = 974/1440 (67%), Gaps = 33/1440 (2%)

Query: 1    MLDTPSSK--KRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVS 58
            M D+P SK  KR+T  E  ++       +E      E+  +   K+   DSL  L+SS  
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKA---EKQNDRTEKTPDPDSLS-LESS-- 54

Query: 59   PLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYX 118
               + K+ TPRKL++   EN+YA SQPT SA+SSL VP LQ    P    SRGR  K Y 
Sbjct: 55   ---YAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAP----SRGRDYKAYS 107

Query: 119  XXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHN 178
                             +LEL+QLSP+KNSR+ELQKLYD+H     +  RL+I KLVL N
Sbjct: 108  QSPPRSPGRSPTR----RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLEN 163

Query: 179  FKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSER 238
            FKSYAG+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 164  FKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEE 223

Query: 239  FTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTE 298
            F NL  CSV VHF YV DE +  +  D  E +  LVITRKAF+NNSSKY+INGKESN+T+
Sbjct: 224  FPNLQSCSVAVHFEYVVDEPSGTSRID--EEKPGLVITRKAFRNNSSKYYINGKESNYTQ 281

Query: 299  VTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIE 358
            VTKLLK +GIDLDHKRFLILQGEVENIAQMK+KAEK+++DGLLEYLEDIIGT +YKPLIE
Sbjct: 282  VTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIE 341

Query: 359  QKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLY 418
             +  +IE +NE+C+EKENRF IV+ EKNSLE  K+ A                  Q+ L 
Sbjct: 342  DRLSQIETLNEICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLL 401

Query: 419  VNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQ 478
             +N K+ +TL +  SL  DFE EK++  + +KEV+ +++   E K+ ++S  ++EK+L  
Sbjct: 402  QSNSKLASTLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLAL 461

Query: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVND 538
             KRE+ +  VSLEE TKNL  K+ KA+  ++S+   IS+                  V D
Sbjct: 462  EKRELESTRVSLEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKD 521

Query: 539  LSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598
            L++  E E              T   S EI   EK+LEP + ++QEKKSQI+L E E+ L
Sbjct: 522  LNQSLEEERRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSL 581

Query: 599  IRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVK 658
            + +++ K+                        + DL K+ ++L+  + +G+K+   A +K
Sbjct: 582  LEETQVKLKKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLK 641

Query: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718
            L EM+ ILN+HRQ+ MEARS++S A+NK+KVLT+L R+Q+SGRINGFHGRLGDLG+I D 
Sbjct: 642  LKEMQTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDN 701

Query: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778
            +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ P+ TPENV
Sbjct: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENV 761

Query: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838
            PRLFDLVKPK+ +F+ A YSVLRDTLVA+DLKQAN VAYGKRRFRVVT+DG+LIDISGTM
Sbjct: 762  PRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTM 821

Query: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898
            SGGG+ V KGLM +    S   + ++ E++ K+E EL+ REK F VA++T H MEQEL+K
Sbjct: 822  SGGGNHVVKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKK 881

Query: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEAL 958
            + D+EP +E +I +  ++ D+L  ++ L   Q+ E    Y+KS+            LE L
Sbjct: 882  VRDQEPDMESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHL 941

Query: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXX 1018
              E   LQ ++KT  ER+  L+D+IM+IGG+ LQ+QNSKV SL+QRIDIL A        
Sbjct: 942  RGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSG 1001

Query: 1019 XXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINL 1078
                  ++ K +K L             +   + ++E  K  L+  +  +  I + K +L
Sbjct: 1002 IKKSVGDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDL 1061

Query: 1079 EQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRD 1138
            E++ E   +K+ E    ++EFK++++E++NK+E+ NS+L+Y+K +  Q  +ELN   +RD
Sbjct: 1062 EEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRD 1121

Query: 1139 VTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASD 1198
            VTHTL +L   +    +++     +    ++  E  G    G E  N            D
Sbjct: 1122 VTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGET-QGEEGDN-----------DD 1169

Query: 1199 EISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKR 1258
               M++D+  D VS+GIPRLS+ EL  ++ + L  +I +L  +I+  +++I +LEEYA+R
Sbjct: 1170 RHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARR 1229

Query: 1259 LVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNA 1318
            L EFK+RK+DLN +V +R+++   +E LKKKR++EFM GF+IISMTLKEMYQMITMGGNA
Sbjct: 1230 LAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNA 1289

Query: 1319 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1378
            ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1290 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1349

Query: 1379 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N TK+ T++N
Sbjct: 1350 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKN 1409

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1379 bits (3569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1452 (51%), Positives = 975/1452 (67%), Gaps = 48/1452 (3%)

Query: 1    MLDTPSSKKRRTVG-EDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSP 59
            M  TP SKK++ V  E+ +TP Q+   E+D   ND                 K    V+ 
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQN---EQD---ND-----------------KTHPEVTA 37

Query: 60   LDFKKTVTPRKLIIGPSENKYALSQP----TTSASSSLQVPALQQKLVPLSQDSRGRRIK 115
              F K+ TPRKL++G ++NKY LSQP    ++  SSSLQVP LQ    PLSQ SRGR  K
Sbjct: 38   SSFLKSHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQP---PLSQPSRGRDKK 94

Query: 116  MYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNA-KIGKMNRLYIHKL 174
             Y                  KLELIQLSPIKN+R+ELQKLY++ N  K+    RLYI KL
Sbjct: 95   AYSQSPPRSPGRSPVR----KLELIQLSPIKNNRIELQKLYNSKNQNKV----RLYIDKL 146

Query: 175  VLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 234
            VL +FKSYAG Q +GPF+ SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIH
Sbjct: 147  VLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIH 206

Query: 235  KSERFTNLNFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGK 292
            KSE F N+  CSVEVHF+YV DE     DG +  +E    LV+ RKAFKNNSSKY+INGK
Sbjct: 207  KSEAFPNIQSCSVEVHFQYVIDE----NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGK 262

Query: 293  ESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKH 352
            ESN+TEVT+LLKE+GIDLDHKRFLILQGEVENIAQMKAKAEK+ +DGLLEYLEDIIGT  
Sbjct: 263  ESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSK 322

Query: 353  YKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXX 412
            YK LIE K VEIEA+NE+C+EKE RF IV+ EKNSLE DKDAA                 
Sbjct: 323  YKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKL 382

Query: 413  TQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTE 472
            TQY LY  N K+ TTL +I + +   ++E+ ++ +   E++     + E+   + +   +
Sbjct: 383  TQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQ 442

Query: 473  EKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXX 532
            E+ L+Q+KRE + Q VS+EE  KNL QK  KA+ T+   +  I KN              
Sbjct: 443  ERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNY 502

Query: 533  XXXVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLV 592
                ++L K+ + E              T   S +I+  EK++EP  ++IQEK+ QI+L 
Sbjct: 503  DSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLA 562

Query: 593  EMEIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKEC 652
            E EI L+++S+ K+   +                    + +L K + +L KE   G+ EC
Sbjct: 563  ESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESEC 622

Query: 653  KDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDL 712
              A  K  EM+ ILNSHRQ+ ++ARS +  A+NK+ VL++L R+Q+SGRINGFHGRLGDL
Sbjct: 623  SRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDL 682

Query: 713  GIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPI 772
            G+IAD+YD+AISTAC RLDD+VV+SVECGQ CIE+LRKNKLGYARF++LDKL+ F +  +
Sbjct: 683  GVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQL 742

Query: 773  QTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLI 832
            QTPENV RLFDLV+P + +F+ A YSVLRDTLVA D++QANRVAYGKRR+RVVTLDG+LI
Sbjct: 743  QTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLI 802

Query: 833  DISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSM 892
            DISGTM+GGGS V KGLM L        E++   D++K+E +LA RE  F +A +T   M
Sbjct: 803  DISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEM 862

Query: 893  EQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXX 952
              EL++L D+EP++ELEI+K L+D+D+L  Q+ L   QL E   +Y   I          
Sbjct: 863  NNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAE 922

Query: 953  GNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXX 1012
              L+ L  E + L+DQS++  E+++ LK+EIM+IGG ELQ+QNSKVSSL +RI I+ A  
Sbjct: 923  AFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKH 982

Query: 1013 XXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQ 1072
                        EL+K ++               +   +      +  L +     + I 
Sbjct: 983  KKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIIL 1042

Query: 1073 DEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELN 1132
            +EK +L  + E+  +K+ +  E++NE+K+ ++E++NK+E+ NS+L Y KK+   L +EL 
Sbjct: 1043 NEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQ 1102

Query: 1133 NFRLRDVTHTLDLLREEEGTEA--NQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLS 1190
            ++ +RDVT +L+ ++ E    +   +Q +   D ++S+  N      +  +E+ +  S +
Sbjct: 1103 SYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQN 1162

Query: 1191 NSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIE 1250
               +   D   MD+D+  + VS+GIP+L+D +L +ID D+L  EINQLQ ++ N + +IE
Sbjct: 1163 EIEEKEQDADIMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIE 1222

Query: 1251 ILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQ 1310
            +LEEY +RL EFKKRK+DLN +V  R+++   +E+LKK R++EFMEGFSIIS+TLKEMYQ
Sbjct: 1223 LLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQ 1282

Query: 1311 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1370
            MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK
Sbjct: 1283 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1342

Query: 1371 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
            PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  NM
Sbjct: 1343 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNM 1402

Query: 1431 TKNATIRNREDL 1442
            T++AT++N++ L
Sbjct: 1403 TQSATLKNKDIL 1414

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1372 bits (3552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1446 (50%), Positives = 981/1446 (67%), Gaps = 44/1446 (3%)

Query: 1    MLDTPSSKKRRTVGEDAVTPCQDLALEEDTTRNDER--NKNNATKSSLHDSLPKLQSSVS 58
            M D+P SKK++       T   +L+L +     + R  N+ N T+ +   + P L+SS  
Sbjct: 1    MCDSPLSKKQKR----KATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESS-- 54

Query: 59   PLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYX 118
               + ++ TPRKL++   EN+YA SQPT SA++SL VP LQ    P    SRGR  K Y 
Sbjct: 55   ---YARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQ----PPKVSSRGRDYKAYS 107

Query: 119  XXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHN 178
                             +LEL+QLSP+KNSR+ELQKLYD+H +   +  RL+I+KLVL N
Sbjct: 108  QSPPRSPGRSPAR----RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDN 163

Query: 179  FKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSER 238
            FKSYAG Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 164  FKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223

Query: 239  FTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTE 298
            F +L  CSV VHF Y+ DE +  +  D  E +  LVITR+AFKNNSSKY+IN KES++TE
Sbjct: 224  FPDLQACSVAVHFEYIIDEPSGTSRID--EEKPGLVITRRAFKNNSSKYYINEKESSYTE 281

Query: 299  VTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIE 358
            VTKLLK++GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT +YKPLIE
Sbjct: 282  VTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIE 341

Query: 359  QKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLY 418
            ++  +IE++NE+C+EK NRF IVD EKNSLE  K+ A                  Q+ + 
Sbjct: 342  ERLSQIESLNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKML 401

Query: 419  VNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQ 478
             +N K+ +TL +I SL  +FE EK++  + ++EV+ ++    + K+ ++S T+ EK+L  
Sbjct: 402  QSNSKLASTLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSL 461

Query: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVND 538
             KRE+    VSLEE TKNL  K+ KA+  ++S+K  IS++                 + D
Sbjct: 462  EKRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKD 521

Query: 539  LSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598
            L++  E E              T   S +I   EKE EP + ++QEKKSQI+L E E+ L
Sbjct: 522  LNQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSL 581

Query: 599  IRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVK 658
            + +++ K+                        V DL++  ++L+  + +G+++ + A +K
Sbjct: 582  LEETRAKLKKNAEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLK 641

Query: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718
            L EM+ ILN+HRQ+ MEARS++S AQNKN VLT+L ++Q+SGRINGFHGRLGDLG+I + 
Sbjct: 642  LKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNS 701

Query: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778
            +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ PI TPENV
Sbjct: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENV 761

Query: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838
            PRLFD+VKPK+ +F+ A YSVL+DTLVA+DLKQAN+VAYGKRRFRVVT+DG+LIDISGTM
Sbjct: 762  PRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTM 821

Query: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898
            SGGG+ V KGLM L T  S   E ++ E++ K+E ELA REK F VA++T H ME+EL+K
Sbjct: 822  SGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKK 881

Query: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEAL 958
            + D+EP LE +IS+  ++ D+LT ++ L   Q  E    Y+K++           NLE L
Sbjct: 882  VRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHL 941

Query: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXX 1018
              E + LQ +++T  E++  L+D+IM+IGG++L  QNSKV SL QRIDIL          
Sbjct: 942  RGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSG 1001

Query: 1019 XXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINL 1078
                  ++ K +K L             +   + + +  K +L + + ++  I + K  L
Sbjct: 1002 IKKSEGDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSEL 1061

Query: 1079 EQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRD 1138
            + + E   ++L E  EN++EFK++++E++NK+E+ NS+L ++K E  Q  +ELN+  +RD
Sbjct: 1062 KDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRD 1121

Query: 1139 VTHTLDLLRE------EEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNS 1192
            VTHTL +L        E+G +  Q      D+ +   D+E +   D    N +       
Sbjct: 1122 VTHTLQMLDNNQMDVVEDGIKDEQD--ADQDKPSGIPDDEKIQEKDDADNNHH------- 1172

Query: 1193 VKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEIL 1252
                    SM++D+    +S+GIP+L ++EL  +D + L  +I+ L  +IN  S++I +L
Sbjct: 1173 --------SMNIDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVL 1224

Query: 1253 EEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMI 1312
            EEY +RL+EFK+RK+DLN +V +R+++   +E LKK R++EFM GF+IISMTLKEMYQMI
Sbjct: 1225 EEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMI 1284

Query: 1313 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1372
            TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PT
Sbjct: 1285 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPT 1344

Query: 1373 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTK 1432
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK +N TK
Sbjct: 1345 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTK 1404

Query: 1433 NATIRN 1438
            + T++N
Sbjct: 1405 STTVKN 1410

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1366 bits (3535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1441 (51%), Positives = 981/1441 (68%), Gaps = 33/1441 (2%)

Query: 1    MLDTPSSK--KRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVS 58
            M D+P SK  KR++  E  ++  Q  A EED+      N+ N ++++    LP L++S S
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDA-EEDSQV---ENRVNLSENTPEPDLPALEASYS 56

Query: 59   PLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYX 118
                 K+ TPRKL++   EN+YA SQPT S ++SL VP LQ    P    SRGR  K Y 
Sbjct: 57   -----KSYTPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQ----PPKTSSRGRDHKSYS 107

Query: 119  XXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHN 178
                             +LEL+QLSP+KNSR+ELQK+YD H +   + +RL+I++LVL N
Sbjct: 108  QSPPRSPGRSPTR----RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLEN 163

Query: 179  FKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSER 238
            FKSYAG+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 164  FKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223

Query: 239  FTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTE 298
            F +L  CSV VHF+YV DE +  +  D  E +  L+ITRKAFKNNSSKY+IN KES++TE
Sbjct: 224  FPSLQSCSVAVHFQYVIDESSGTSRID--EEKPGLIITRKAFKNNSSKYYINEKESSYTE 281

Query: 299  VTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIE 358
            VTKLLK +GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT +YKPLIE
Sbjct: 282  VTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIE 341

Query: 359  QKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLY 418
            ++  +IE +NE+C+EKENRF IVD EKNSLE  K+ A                  Q+ L 
Sbjct: 342  ERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLL 401

Query: 419  VNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQ 478
             +N K+ +TL +I S   D E EK +  + +K+V+ ++    E K+ ++S +++EK+L+ 
Sbjct: 402  QSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVL 461

Query: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVND 538
             +RE+    VSLEE TKNL  K++KA+ T++S+K  IS+                  + D
Sbjct: 462  ERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKD 521

Query: 539  LSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598
            L++  E E              T   S EI   EKELEP + ++QEK+SQI+L E E+ L
Sbjct: 522  LTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSL 581

Query: 599  IRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVK 658
            + +++ K+   +                    + DL K   +L  E+ +G+K    A +K
Sbjct: 582  LEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLK 641

Query: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718
            L EM+ +LN+HRQ+ MEARS++S AQNK+KVLT+L R+Q+SGRINGFHGRLGDLG+I D 
Sbjct: 642  LKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDS 701

Query: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778
            +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ PI TPENV
Sbjct: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENV 761

Query: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838
            PRLFDLVKPK  +F+ A YSVLRDTLVA++LKQAN VAYGK+RFRVVT+DG+LIDISGTM
Sbjct: 762  PRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTM 821

Query: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898
            SGGG+ V KGLM L T  S   + ++ E++ K+E EL+ RE  F VAS+T H ME+EL+K
Sbjct: 822  SGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKK 881

Query: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEAL 958
            L D EP LE +ISK  ++ D+L  ++ L   Q+ E    Y K++           NLE L
Sbjct: 882  LRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERL 941

Query: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXX 1018
              E   LQ ++KT  E++  L+DEIM+IGG +LQ+QNSKV S+ Q++DIL A        
Sbjct: 942  RGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSA 1001

Query: 1019 XXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINL 1078
                  ++ K +K L             +   + + +  K +L + + ++    + K+ L
Sbjct: 1002 SKKSGGDVVKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVEL 1061

Query: 1079 EQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRD 1138
            +++ E   +++ +  E++NEFK+I++E++NK+E+ NS+L+Y+K E  Q  + LN   +RD
Sbjct: 1062 KEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRD 1121

Query: 1139 VTHTLDLLREEEGTEANQQPTTGTDETTSNV-DNEMLGAADAGVENMNTSSLSNSVKVAS 1197
            VTHTL +L + +            D    +V +N+ L       E  + S + ++     
Sbjct: 1122 VTHTLGMLDDNK-----------MDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCD 1170

Query: 1198 DEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAK 1257
            +   M++D+  D VS+GIPRLS+ EL  +D + +  +IN+L  ++   +++I +LEEYA+
Sbjct: 1171 NYHPMNIDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYAR 1230

Query: 1258 RLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGN 1317
            RL EFK+RK+DLNN+V +R+++   +  LKKKR++EFM GF+IISMTLKEMYQMITMGGN
Sbjct: 1231 RLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGN 1290

Query: 1318 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1377
            AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1291 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350

Query: 1378 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIR 1437
            DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N TK+ TI+
Sbjct: 1351 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIK 1410

Query: 1438 N 1438
            N
Sbjct: 1411 N 1411

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1358 bits (3514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/1449 (51%), Positives = 977/1449 (67%), Gaps = 49/1449 (3%)

Query: 1    MLDTPSSK--KRRTVGE-----DAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKL 53
            M D+P SK  KR+ V E     D     Q+L  E+   R+++    N+         P L
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNS---------PAL 51

Query: 54   QSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR 113
            ++S     + K+ TPRKL++   EN+YA SQPT SA++SL VP LQ    P    SRGR 
Sbjct: 52   ETS-----YAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQ----PPGTSSRGRD 102

Query: 114  IKMYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHK 173
             K Y                  +LEL+QLSP+KNSR+ELQKLY++H +   +  RL+I++
Sbjct: 103  YKAYSQSPPRSPGRSPTR----RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINE 158

Query: 174  LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
            LVL NFKSYAG Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI
Sbjct: 159  LVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218

Query: 234  HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKE 293
            HKSE F NL  CSV VHF YV DE +  +  D  E +  LVITRKAFKNNSSKY+INGKE
Sbjct: 219  HKSEAFPNLQSCSVAVHFEYVIDESSGTSRID--EEKPGLVITRKAFKNNSSKYYINGKE 276

Query: 294  SNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHY 353
            S++TEVTKLLK +GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT +Y
Sbjct: 277  SSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANY 336

Query: 354  KPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXT 413
            KPLIE++  +IEA+NE+C+EKENRF IVD EKNSLE  K+ A                  
Sbjct: 337  KPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLF 396

Query: 414  QYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEE 473
            Q+ +  +N K+ +TL +I SL  DFE EK +  + +K+VE ++    E K+ ++S  + E
Sbjct: 397  QFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSRE 456

Query: 474  KSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXX 533
            K L+  +RE+    VSLEE TKNL  K++K++ T + +K  IS+                
Sbjct: 457  KDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHE 516

Query: 534  XXVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVE 593
              + DL++  E E              T   S EI   EKELEP + ++QEK+SQI+L E
Sbjct: 517  SEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAE 576

Query: 594  MEIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECK 653
             E+ L+ +++ K+   +                    + +L K   +L  E+ +G++   
Sbjct: 577  SELSLLEETQSKLKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFS 636

Query: 654  DAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLG 713
             A +KL EM+ +LN+HRQ+ MEARS++S AQNK+KVLT+L ++Q+SGRINGFHGRLGDLG
Sbjct: 637  SAHLKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLG 696

Query: 714  IIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQ 773
            II + +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ PI 
Sbjct: 697  IIDNSFDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPIS 756

Query: 774  TPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLID 833
            TPENVPRLFDLVKPK+ +F+ A YSVLRDTLVA+ LKQAN VAYG++RFRVVT+DG+LID
Sbjct: 757  TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLID 816

Query: 834  ISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSME 893
            ISGT+SGGG+ V KGLM L T  S   + ++ E++ K+E EL+ RE  F VA++T H ME
Sbjct: 817  ISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEME 876

Query: 894  QELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXG 953
             EL+ L D+EP +E +ISK  ++ D++T ++ L   Q+ E    Y  ++           
Sbjct: 877  AELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMK 936

Query: 954  NLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXX 1013
            NLE L  E   LQ ++KT  E++  L+ EIM+IGG++LQ+QNSKV SL QR+DIL A   
Sbjct: 937  NLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLK 996

Query: 1014 XXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQD 1073
                       ++ K +K L             +   KA  E  K++ LD++++ +    
Sbjct: 997  KVKSGIKKSEGDVLKFQKQLKNSERDVELSSNEL---KAIEEKLKHTKLDLSEN-DIKMT 1052

Query: 1074 EKINLEQELENFSDKLH----ESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLE 1129
            E  NL  EL+  S++L     E+ EN++EFK++++E++NK+E+ NS+L ++KKE  Q  +
Sbjct: 1053 ETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEK 1112

Query: 1130 ELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSL 1189
             L+   +RDVTHTL++L      + N      TD    N   + +       E  +  ++
Sbjct: 1113 GLSELSIRDVTHTLEIL------DNNTMDIVKTD----NKIEQAVVKEKRSSETQDEKNI 1162

Query: 1190 SNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINI 1249
                +   D  SMD+D+  + V +GIPR S++EL  +D + L +EI++L  +I+  +++I
Sbjct: 1163 QEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDI 1222

Query: 1250 EILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMY 1309
             +LEEYA+RL EFK+RK+DLN +V +R+++   +E LKKKR++EFM GF+IISMTLKEMY
Sbjct: 1223 GVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMY 1282

Query: 1310 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1369
            QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY
Sbjct: 1283 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1342

Query: 1370 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N
Sbjct: 1343 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDN 1402

Query: 1430 MTKNATIRN 1438
             T++ T++N
Sbjct: 1403 RTRSTTVKN 1411

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1356 bits (3510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1441 (51%), Positives = 974/1441 (67%), Gaps = 45/1441 (3%)

Query: 5    PSSKKRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPLDFKK 64
            P++K+++    ++ TP Q           +++  N + +S L    P+ Q S+SP++  K
Sbjct: 4    PNTKRQKVTEPESKTPEQG---------TEDQQANASLRSPLQR--PEHQQSISPINNSK 52

Query: 65   TVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR-IKMYXXXXXX 123
            + TPRKLI+G ++N+YA SQP+ S+SS      LQ    P S  SRGR+ IK Y      
Sbjct: 53   SHTPRKLILGQNDNRYAFSQPSVSSSSFQVP-TLQP---PDSSSSRGRKDIKSYSQSPPR 108

Query: 124  XXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183
                        +LELIQLSP+KN+R++L++LYDAHN++  K  RL+I+KL L+NFKSYA
Sbjct: 109  SPGRSPKR----RLELIQLSPVKNNRIKLRELYDAHNSQ-SKKERLFINKLTLNNFKSYA 163

Query: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243
            G+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+F +L 
Sbjct: 164  GQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLT 223

Query: 244  FCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301
             CSV+V F Y  DE+    DGDT   E +  LVI+RKAFKNNSSKY+INGKESN+T+VTK
Sbjct: 224  SCSVDVEFLYAIDEH----DGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279

Query: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361
            LLKE+GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT  YK LIE+  
Sbjct: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339

Query: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNN 421
            +EIE++NE+CIEKENRF IVD EKNSLE  K+ A                  QY+L+ NN
Sbjct: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNN 399

Query: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481
             K+  TL +I +L  ++  EK ++     E+   +  ++ES++ +  L  EEK  ++ KR
Sbjct: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKR 459

Query: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSK 541
             +  + VSL+E  KNL QK  K +  + +++  IS                   +  L++
Sbjct: 460  ILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQ 519

Query: 542  QREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601
            Q + E              T   S+EI   E +LEP N ++QEKK++I+LVE +I L+++
Sbjct: 520  QLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQE 579

Query: 602  SKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661
             + K+  +I                    + +L K + ++ KE   G+ EC D   KL E
Sbjct: 580  GQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKE 639

Query: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721
            MK +LN  RQ+  EAR  ++  QN+ KVLT+L ++Q+SGRI GFHGRLGDLG I + YDV
Sbjct: 640  MKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDV 699

Query: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781
            A+STACPRLDD+VVE+VECGQ CIE+LRKNKLGYARF++LDKL+ F+ + IQTP+NVPRL
Sbjct: 700  AVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRL 759

Query: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841
            FDL+KPK+ +F PA YSVLRDTLVAKDLKQANRVAYG+RR+RVVTLDG+LID+SGTMSGG
Sbjct: 760  FDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGG 819

Query: 842  GSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCD 901
            G+ V KGLM L  K     + ++ ED++++E +L+ +EK F++A+  F+ ME EL+KL +
Sbjct: 820  GNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNN 879

Query: 902  REPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQE 961
            R+P++ELEISK +++ID  + +I+    QL EK+N     ++          NL+ L +E
Sbjct: 880  RKPEIELEISKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEE 939

Query: 962  LKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXX 1021
               LQD++K   ++++ LK++IM+IGG ELQ+QNSKV+S+ QRIDIL A           
Sbjct: 940  HLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKK 999

Query: 1022 XNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQE 1081
             +TEL+KA+K+L+            I     R +   +SL +I+KS+E  Q  K  L+ E
Sbjct: 1000 SDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDE 1059

Query: 1082 LENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTH 1141
             +   DK+ +  EN+NEFK+ ++E+ NK+E+ N +L+++K +   L + L+   LR +  
Sbjct: 1060 CDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQ 1119

Query: 1142 TLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEIS 1201
             L  L EE   +A   P  GT              +D  + +     L+N+     D+ S
Sbjct: 1120 VLMALDEESEAKA---PNNGT-------------LSDEQIHDQTGHELTNT--AVQDDDS 1161

Query: 1202 MDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVE 1261
            MD+D+  +++S G+P LSD ELS +D   +  E++ L+ +I +   NIE+LEEY KRL E
Sbjct: 1162 MDIDNGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTE 1221

Query: 1262 FKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELE 1321
            FK RK+DLN++V +R  +   +EELKK RY EFM GF IISMTLKEMYQMITMGGNAELE
Sbjct: 1222 FKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELE 1281

Query: 1322 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1381
            LVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEID
Sbjct: 1282 LVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1341

Query: 1382 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRED 1441
            AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK EN T +ATI+NRE 
Sbjct: 1342 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREI 1401

Query: 1442 L 1442
            L
Sbjct: 1402 L 1402

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1333 bits (3449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1372 (50%), Positives = 941/1372 (68%), Gaps = 21/1372 (1%)

Query: 67   TPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXXXXX 126
            TP+KL+IG +++  + SQP  S SSSLQ P+LQ      +  SRGR  + Y         
Sbjct: 42   TPKKLVIGTNDDTTSQSQPIVS-SSSLQAPSLQHP----NSSSRGREQRTYSQSPPRSPG 96

Query: 127  XXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQ 186
                     KLELI++SP+K +RLELQ+LYDA  ++     RL I+KLVL +FKSYAG Q
Sbjct: 97   RSPTR----KLELIKISPVKKNRLELQRLYDAEQSQRNAA-RLCINKLVLQDFKSYAGRQ 151

Query: 187  TIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCS 246
             +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE   NL  CS
Sbjct: 152  VVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCS 211

Query: 247  VEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQ 306
            VEVHF+YV DE    T  D  E + TLV+TRKAFKNNSSKY++N KESN+TEVT+LLK++
Sbjct: 212  VEVHFQYVVDEPDGTTRID--EEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKE 269

Query: 307  GIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEA 366
            GIDLDHKRFLILQGEVENIAQM+ KAEK+ EDGLLEYLEDI GT  YKP IE    EIE 
Sbjct: 270  GIDLDHKRFLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEV 329

Query: 367  MNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKT 426
            +NE CIEKENRF IVD EK+SLE  KD A                  QY ++ N+ K+ +
Sbjct: 330  LNESCIEKENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTS 389

Query: 427  TLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQ 486
            TL +   L+   +QE +++S+ +KEV++L++   +    + +L  EEK+L+ +KR ++ Q
Sbjct: 390  TLDKSSKLKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQ 449

Query: 487  SVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSKQREVE 546
             V++EE  K+++QK  KA+  ++S++  ++                   + DL+++   E
Sbjct: 450  RVAIEEKIKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITE 509

Query: 547  EXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKV 606
                          TV  S  IA  EK+LEP + ++Q+K+++I+L E E+ L++D+  ++
Sbjct: 510  RAKLEDVKISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARI 569

Query: 607  GAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAIL 666
              +I                    + +L + + ++  E      EC  A  +L +M  IL
Sbjct: 570  NKDIEQLKNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEIL 629

Query: 667  NSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTA 726
             + RQ+T++AR+  S+AQNK+ VLT+L ++Q+SGRI+GFHGRLGDLG+I ++YDVAISTA
Sbjct: 630  IAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTA 689

Query: 727  CPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVK 786
            CPRL+D+VVESVECGQ CIE+LRKNKLGYARF++LDKL++F    IQTPENVPRLFDLVK
Sbjct: 690  CPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVK 749

Query: 787  PKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVF 846
            PK+ +F PA YSVLRDTL A+ L QANRVAYGK+RFRVV+LDG+LIDISGTMSGGGS V 
Sbjct: 750  PKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVV 809

Query: 847  KGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQL 906
            +GLM L+   S + +IFS E++ +LE EL  +EK F +AS+TF  ME +L+KL DR P++
Sbjct: 810  RGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEI 869

Query: 907  ELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQ 966
            +L++SK +++ ++   +++L    L E+    +K+             ++ L  E + L 
Sbjct: 870  QLKVSKLVMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALS 929

Query: 967  DQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXXXNTEL 1026
            DQ+ T+ ++++ LKD+IM IGGSELQ+QNSKV+S  QR++IL +              EL
Sbjct: 930  DQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENEL 989

Query: 1027 KKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFS 1086
            KK+ K +             IA  K  A+  + +L  + KS++  QD    + ++L+   
Sbjct: 990  KKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLK 1049

Query: 1087 DKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLL 1146
             +L +      EFK++++E+ +K+E+ N++L ++ KE  QL  +LNN ++RDVT TL LL
Sbjct: 1050 QRLAQMEAGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLL 1109

Query: 1147 REEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVDD 1206
             E E T  ++ P    ++ T          ADA  +    S +S   + ++DE+ M+VD+
Sbjct: 1110 DEGESTNNSKMPNELQEKRTE--------GADATRQEGEESDVSMEEEKSNDEV-MEVDE 1160

Query: 1207 CGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRK 1266
                +  G+PR+S+ EL ++D ++L  +I  LQ+++++V++++EILEEYAKRL E K+RK
Sbjct: 1161 KPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRK 1220

Query: 1267 IDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSL 1326
            +DLN +VGER+ +   + ELKK+R++EFM+GF IISMTLKEMYQMITMGGNAELELVDSL
Sbjct: 1221 VDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSL 1280

Query: 1327 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1386
            DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1281 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340

Query: 1387 RNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438
            RNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +NMTK+A+++N
Sbjct: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKN 1392

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1310 bits (3391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1387 (51%), Positives = 932/1387 (67%), Gaps = 15/1387 (1%)

Query: 55   SSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRI 114
            ++VS L+FK + TP+KLI+   ++           SSSLQ P+L     P    SRGR  
Sbjct: 46   AAVSHLNFK-SQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHP---PTESSSRGRTA 101

Query: 115  KMYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKL 174
            + Y                  KLELIQLSP+KNSR+ LQK+Y++ N K  ++ RL I KL
Sbjct: 102  RTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNEK--QIERLCIDKL 159

Query: 175  VLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 234
            VLH+FKSYAG Q +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIH
Sbjct: 160  VLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIH 219

Query: 235  KSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKES 294
            KSE F +L  CSVEVHF YV D+    T  +T++ +  LVITRKAFKNN+SKY+INGKES
Sbjct: 220  KSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEK--LVITRKAFKNNTSKYYINGKES 277

Query: 295  NFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYK 354
            N+T VTKLLK++GIDLDH RFLILQGEVENIAQMK KAE D +DGLLEYLEDIIGT  YK
Sbjct: 278  NYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYK 337

Query: 355  PLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQ 414
            PLIE+K  EIEA+NE+CIEKENRF IVD EK SLE  KD A                  Q
Sbjct: 338  PLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQ 397

Query: 415  YHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEK 474
            Y L+ +N K+ TTL ++ +++ +FE+ K++HS    ++  +  S  E   N+ +   +EK
Sbjct: 398  YKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEK 457

Query: 475  SLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXX 534
             L  +KR  +T+ VSLEE  KN+ +K KK +  +E     IS                  
Sbjct: 458  KLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYES 517

Query: 535  XVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEM 594
             +++L+ Q ++E              T+ FSDEI+  EKELEP N ++Q KKSQI++ E 
Sbjct: 518  QLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKES 577

Query: 595  EIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKD 654
            EI LI++ + K+  +I                    +  L      + KE   GD E  +
Sbjct: 578  EISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTN 637

Query: 655  AGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGI 714
            A  KL EMKA+LN HRQK ++AR+++S  +NKN+VL SL R+Q+SGRI+GF+GRLGDLG 
Sbjct: 638  AKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGA 697

Query: 715  IADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQT 774
            I D+YD+AISTACPRL+D+VVE+VECGQ CIE+LRKNKLGYARF++L+KL+ FDM+ I T
Sbjct: 698  IDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIST 757

Query: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDI 834
            P NVPRLFDLV   + +F PA YSVLRDTLV  +LK ANRVAYG +RFRVVTL G+LID+
Sbjct: 758  PNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDV 817

Query: 835  SGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQ 894
            SGTMSGGG++  +GLM LT   +   + +++ED++K+E ELAAREK F++A+ETF  ME 
Sbjct: 818  SGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMET 877

Query: 895  ELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGN 954
            ELR+L DR+P +ELEISK  ++I +   + +L + QL EK    ++ +            
Sbjct: 878  ELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHE 937

Query: 955  LEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXX 1014
            L  L  + K LQ ++K+  +R+ FLKDEIM++GG +LQ+Q+SKV S+ Q+ DIL      
Sbjct: 938  LGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKK 997

Query: 1015 XXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDE 1074
                     TELK+  K               + +   +      SL +    L  ++  
Sbjct: 998  DKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFS 1057

Query: 1075 KINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134
            +    Q  EN  D+L E  EN+N FK  QLE +NK E+ N++L+++KK+      EL + 
Sbjct: 1058 REESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSL 1117

Query: 1135 RLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAAD--AGVE-NMNTSSLSN 1191
            ++RD+THTL  L +    + +++  +  D   S   N  LG ++   GVE   N S +S 
Sbjct: 1118 KIRDITHTLQEL-DNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176

Query: 1192 SVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEI 1251
                A++++ M++D+  + +S+GIPR+S+ E   +D + L  +  QLQ +I+ V++NI++
Sbjct: 1177 D---ANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDV 1233

Query: 1252 LEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQM 1311
            LEEYA+R+ E+K+RK+DLNN+V ER ++  ++++LKK R+ EFM+GF +IS+TLKEMYQM
Sbjct: 1234 LEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQM 1293

Query: 1312 ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP 1371
            ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP
Sbjct: 1294 ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP 1353

Query: 1372 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMT 1431
            TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N T
Sbjct: 1354 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQT 1413

Query: 1432 KNATIRN 1438
            K+AT++N
Sbjct: 1414 KSATLQN 1420

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1397 (50%), Positives = 961/1397 (68%), Gaps = 32/1397 (2%)

Query: 49   SLPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQD 108
            SLP   SS +   F    TPRKL++G  +N+YA     + +SSSLQVP LQ    P +  
Sbjct: 35   SLPTTSSSQNT--FAHAKTPRKLVVGNGDNRYA-HSSQSISSSSLQVPPLQ----PPATS 87

Query: 109  SRGRRIKMYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNR 168
            SRGR  K Y                  KLELIQ+SP+KNSRLELQK+YDA   +  +  R
Sbjct: 88   SRGRGSKTYSQSPPRSPGRSPTR----KLELIQISPLKNSRLELQKIYDAQQNQ-ARHTR 142

Query: 169  LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
            L I +L+L +FKSYAG Q +GPF+ SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR
Sbjct: 143  LCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 202

Query: 229  LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
            LSDLIHKSE + +L  CSVEVHF+YV DE +  T  D  E +  LV+TRKAF+NN+SKY+
Sbjct: 203  LSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRID--EEKPNLVVTRKAFRNNTSKYY 260

Query: 289  INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
            +N +E+N+ EVTKLLK++G+DLDHKRFLILQGEVENIAQMK+KAE++ EDGLLEYLEDII
Sbjct: 261  VNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDII 320

Query: 349  GTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXX 408
            GT  YKPLIE+   ++E++N++CIEKENRF+IVD EKNSLE  K+ A             
Sbjct: 321  GTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVS 380

Query: 409  XXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTS 468
                 QYH+  +N K+K TL +I +L    E+E  +++   KE++ L+   DE ++ L +
Sbjct: 381  KSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKN 440

Query: 469  LTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXX 528
               EEK L+ +KRE++ ++V  EE  KN ++K  KA+ T+ S    IS +          
Sbjct: 441  CNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQL 500

Query: 529  XXXXXXXVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQ 588
                   + +L++Q EVE+             T   S EIA +EKELEP N ++QEKK+Q
Sbjct: 501  QVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQ 560

Query: 589  IKLVEMEIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEG 648
            I+L E +I LI++++ K+  EI                    +  L+   +++ +E   G
Sbjct: 561  IQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTG 620

Query: 649  DKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGR 708
            +KEC +A ++L EM+ ILN+ RQK ++ARS +S A+NK+KVLT+L R+Q+SGRI+GFHGR
Sbjct: 621  EKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGR 680

Query: 709  LGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFD 768
            LGDLG+I ++YDVAISTACPRL+D+VVE+VECGQ CIE+LRKNKLGYARF++LDKL++F+
Sbjct: 681  LGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFN 740

Query: 769  MSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLD 828
            +  I TPE+VPRLFDL+ PK+ +F+ A +SVL +TLVA DLKQANRVAYGK+RFRVVTLD
Sbjct: 741  LDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLD 800

Query: 829  GQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASET 888
            G LIDISGTMSGGGSRV +GLM +    +   EI+S E++ +LE+ L  REK F VAS+T
Sbjct: 801  GNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDT 860

Query: 889  FHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXX 948
             + ME++L+ L ++EP +E  IS+  ++I++   +I++   Q+ E    Y  +       
Sbjct: 861  IYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVEL 920

Query: 949  XXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDIL 1008
                 ++++L  E K +Q+Q+K+   R+  LK+EIM IGG+EL++Q+SKV S+ QRIDI+
Sbjct: 921  RETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIV 980

Query: 1009 QAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSL 1068
             +              E+ K+ K  +            I   K   E  ++SL  +++S+
Sbjct: 981  VSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESV 1040

Query: 1069 ESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLL 1128
             S+Q  K  L +E     DKL++ NE++  FK+ ++E++N++E+ NS+  +LKKE     
Sbjct: 1041 TSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYE 1100

Query: 1129 EELNNFRLRDVTHTLDLLREEE--GTEANQQPTTGTDETTSNV-----DNEMLGAADAGV 1181
            E+L + ++RDVT  L  L++E    ++ ++ P +  +E+ S+V     +N+ L A D   
Sbjct: 1101 EKLGDLKIRDVTQILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQD--- 1157

Query: 1182 ENMNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSF 1241
                   + ++ K   ++  MDV+D G+   +G+ + S+ EL  I+ + L +EI  LQ+F
Sbjct: 1158 ------QVQDAEKQGDNQ--MDVEDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNF 1209

Query: 1242 INNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSII 1301
            ++  + +I++LEEYA+RL+EFK R++DLN +V ERN++   ++ELKKKR++EFM+GF II
Sbjct: 1210 LDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGII 1269

Query: 1302 SMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLA 1361
            SMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLA
Sbjct: 1270 SMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLA 1329

Query: 1362 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQL 1421
            LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL
Sbjct: 1330 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1389

Query: 1422 VGIYKHENMTKNATIRN 1438
            VGIYK +N TK+ATI+N
Sbjct: 1390 VGIYKRDNKTKSATIKN 1406

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1293 bits (3346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/1416 (49%), Positives = 941/1416 (66%), Gaps = 20/1416 (1%)

Query: 31   TRNDERNK--NNATKSSL----HDSLPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQ 84
            TR D+R +  +N T S +      SL  ++SS +  D   + TPRKL++G  E KYA S 
Sbjct: 12   TRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGSPEKKYAYS- 70

Query: 85   PTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXXXXXXXXXXXXXXKLELIQLSP 144
               S SSSL VP LQ    P    SRGRR   Y                  +LELIQLSP
Sbjct: 71   -QPSTSSSLSVPNLQP---PNVDGSRGRR--FYSQSPPRSPHRSPNRSPTRRLELIQLSP 124

Query: 145  IKNSRLELQKLYDAHNAKIGK-MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNG 203
            +KN+R ELQK+YD  N    + ++RL I KL LHNFKSYAG Q IGPF  SFSAVVGPNG
Sbjct: 125  VKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNG 184

Query: 204  SGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTD 263
            SGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE + NL  CSV++HFRYV DE    T 
Sbjct: 185  SGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTR 244

Query: 264  GDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVE 323
             D  + +  +VITRKAF+NNSSKY+I+GKESN+TEVT+LL++QGIDLDHKRFLILQGEVE
Sbjct: 245  SD--DEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVE 302

Query: 324  NIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDD 383
            +I+QMK KAE++++DGLLEYLEDIIGT  YK  IE   VEI+ +N++C+EKENRF +V+ 
Sbjct: 303  SISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEK 362

Query: 384  EKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQ 443
            EKNSLE  KD A                  QYH++ +  K+  TLG+I  L     QEK 
Sbjct: 363  EKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQEKA 422

Query: 444  RHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKK 503
            ++ QF +EV  L+   ++ K  +  L  E K L  ++R ++ +  S+EE  +NLD+K  K
Sbjct: 423  KYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLK 482

Query: 504  AKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSKQREVEEXXXXXXXXXXXXXTVT 563
            A+  ++S+++ ++ +                 +  L++    E              T  
Sbjct: 483  AEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSE 542

Query: 564  FSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIXXXXXXXXXXXXX 623
             S EIA+ E++LEP N ++QEKKSQ+KL E +I ++++SK K    I             
Sbjct: 543  ISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFAEK 602

Query: 624  XXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTA 683
                   +  L   + N++K    G+KEC  A  KL EMK +L SHRQ+ MEARST+S  
Sbjct: 603  NNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLSNV 662

Query: 684  QNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQT 743
            +NKNKVL++L+R+Q+SGRI GFHGRLGDLG I D YDVAISTACPRLDD+VV++VECGQ 
Sbjct: 663  ENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQ 722

Query: 744  CIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDT 803
            CIE LRKNKLGYARF++LDKL++F++SPIQTPE VPRLFDLV+ K  +F PA YSVLRDT
Sbjct: 723  CIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDT 782

Query: 804  LVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIF 863
            LV  DLKQANRVAYGKRRFRVVTLDG+LID SGT+SGGG+ V KGLM  + +  G    +
Sbjct: 783  LVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK-SKQQPGAG--Y 839

Query: 864  SLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQ 923
            + E+++ +E EL  REK F +A ETFH ME+ L+K  DREP++E+EI+K+ +DI++ + +
Sbjct: 840  TPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTE 899

Query: 924  IQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEI 983
            ++L + QL E   D +               L+ L++E   +++++K   + ++ LK++I
Sbjct: 900  LKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKI 959

Query: 984  MRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXX 1043
            M+IGG++LQLQNSKV+S+N++I+I+ +              +LK+               
Sbjct: 960  MKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDIESC 1019

Query: 1044 XXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQ 1103
               I+         +  +  ++ SL   +  K  +E+E E     L E   N ++FK+++
Sbjct: 1020 NLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVE 1079

Query: 1104 LELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTD 1163
            +E+ N++E+ N + S++KKE     +ELN+ ++RD+T TL  L E +  E N+      D
Sbjct: 1080 IEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFEVQD 1139

Query: 1164 ETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI-SMDVDDCGDLVSQGIPRLSDKE 1222
            E       EM    +A   +   ++    V+    EI SMD+D+  +  S G+P+ S+ +
Sbjct: 1140 EEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETSNGLPKFSEAQ 1199

Query: 1223 LSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSI 1282
            L +I  +++  +I++L  +++N  ++I++LEEYA+RL E+KKRK+DLN +V +R+++   
Sbjct: 1200 LQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKN 1259

Query: 1283 MEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1342
             EELKKKR ++FMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKK
Sbjct: 1260 CEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKK 1319

Query: 1343 SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            SWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKN
Sbjct: 1320 SWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1379

Query: 1403 AQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438
            AQFIVISLRNNMFELA+QLVGIYK+ NMT++ T++N
Sbjct: 1380 AQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQN 1415

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1254 bits (3245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1427 (48%), Positives = 936/1427 (65%), Gaps = 29/1427 (2%)

Query: 19   TPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPLDFKKTVTPRKLIIGPSEN 78
            +P +   LE  T    E N+    +S L     +   S+SP    K+ TPRKLI+  S+N
Sbjct: 9    SPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSLSPPAISKSHTPRKLILHQSDN 68

Query: 79   KYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR-IKMYXXXXXXXXXXXXXXXXXXKL 137
            +YA SQPT SASS LQVP+LQ      S  SRGRR IK+Y                  KL
Sbjct: 69   RYAFSQPTVSASS-LQVPSLQPPET-SSSSSRGRRDIKVYSQSPPRSPGRSPTR----KL 122

Query: 138  ELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFSA 197
            ELIQLSP+KN+R+  +KL + +N++I K  RL+I+KLVL+NFKSYAGEQ IGPF+ +FSA
Sbjct: 123  ELIQLSPVKNNRI--RKLQELYNSQIKK-ERLFINKLVLNNFKSYAGEQVIGPFNTNFSA 179

Query: 198  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDE 257
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE F NL  CSV+V F+YV D+
Sbjct: 180  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDK 239

Query: 258  YTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLI 317
                +  D  + +  L+ITRKAFKNNSSKYFINGKES++TEVTKLLKE+GIDLDHKRFLI
Sbjct: 240  SNGSSKID--DNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLI 297

Query: 318  LQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENR 377
            LQGEVENIAQMK KAE++ +DGLLEYLEDIIGT  YK  IE+ T+E++ +NE+CIEKENR
Sbjct: 298  LQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENR 357

Query: 378  FRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTD 437
            F IV+ EKNSLE  K+AA                  QY++   ++K+ +TL ++  L+ +
Sbjct: 358  FEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEE 417

Query: 438  FEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNL 497
            ++ E  +     +E   L+++  +    + S+  + K+   +KRE+  +  SLEE  K+ 
Sbjct: 418  YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKSY 477

Query: 498  DQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSKQREVEEXXXXXXXXXX 557
             +K +KA  ++  SK L+                    +  L  + + E+          
Sbjct: 478  TRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLSL 537

Query: 558  XXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIXXXXXXX 617
               T   S+EIA  E+ELEP   ++QEKK +I++ E +I L+++++ K+  EI       
Sbjct: 538  KDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKNDL 597

Query: 618  XXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEAR 677
                         + DL      +  E   G+ EC +A  K+ +M+ +L + RQK M+AR
Sbjct: 598  KCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDAR 657

Query: 678  STVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVES 737
            S ++T +NK+KVL++L ++Q+SGRI+GF+GRLGDLG+I ++YD+AISTA  RLDD+VV+S
Sbjct: 658  SRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDS 717

Query: 738  VECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIY 797
            VECGQ CIE+LRKNKLGYARF++L+KL+   +  IQTPENV RLFDLVKP +  F PA Y
Sbjct: 718  VECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFY 777

Query: 798  SVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVS 857
            SVLR+TLVAKDLKQANRVAYG  RFRVVT+DG+LIDISGT++GGG +  +GLM L  K  
Sbjct: 778  SVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQ 837

Query: 858  GTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDI 917
               +I+S +D++K+E EL  RE  F  A++T+  MEQ L++L DR+P+LELEISK L+D 
Sbjct: 838  ENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDT 897

Query: 918  DALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQDQSKTSSERVS 977
            D  +++++ T+ QL +K   YE+  +           L  L +E + L D +K  SE++ 
Sbjct: 898  DISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKID 957

Query: 978  FLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXX 1037
             LK  IM IGG +LQ+QNSKV+S+ Q IDI+++              E++++ K+L    
Sbjct: 958  KLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAE 1017

Query: 1038 XXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVN 1097
                     +       E  + SL  I+++   +++E   LE E  N  +K++E+     
Sbjct: 1018 LDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGT 1077

Query: 1098 EFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQQ 1157
            +FK+ ++++++++E+ N++L ++K+   +  E+L    LR+ T          G E +  
Sbjct: 1078 KFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIF-------GDEGDNN 1130

Query: 1158 PTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVK--VASDEISMDVDDCGDLVSQGI 1215
               G D T+              +++ N     N+++    S E  M++DD  D  S GI
Sbjct: 1131 SINGVDRTSH--------GGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGI 1182

Query: 1216 PRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGE 1275
            PR+S  +L  ID   L  EI QL+ ++   ++NI++LEEYA+RL ++  RK+DLN +V  
Sbjct: 1183 PRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVER 1242

Query: 1276 RNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1335
            R  L  +++ELKKKRY+EFM+GF IISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTF
Sbjct: 1243 REALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTF 1302

Query: 1336 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1395
            SVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1303 SVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1362

Query: 1396 IKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNREDL 1442
            IKERTKNAQFIVISLRNNMFELA+QL+GIYK +N TK+A IRN++ L
Sbjct: 1363 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1247 bits (3227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1380 (48%), Positives = 904/1380 (65%), Gaps = 34/1380 (2%)

Query: 67   TPRKLIIGPSENKYALSQPTT-SASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXXXX 125
            TP KL+    + K  +S+ ++ S +  L+ P+LQ  +    Q SRGR             
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVA--HQISRGR------SQYSQSP 65

Query: 126  XXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYAGE 185
                       +ELIQLSPIKNSRLELQ+LYD    K+    RL I  LVL NFKSYAG 
Sbjct: 66   PRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKV---ERLCIRTLVLENFKSYAGR 122

Query: 186  QTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFC 245
            Q +GPF +SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE++ +L+FC
Sbjct: 123  QVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFC 182

Query: 246  SVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLL 303
            SVE+ F+YV DE     DG T  +  +  L + RKAFKNN+SKY++NGKES +TEVT+LL
Sbjct: 183  SVEIQFQYVVDE----PDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLL 238

Query: 304  KEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVE 363
            +++GIDLDHKRFLILQGEVE+IAQMK KAE + +DGLLEYLEDIIGT  YK  IEQ  VE
Sbjct: 239  RDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVE 298

Query: 364  IEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNNDK 423
            ++++N++C+EKENRF +V+ EK SLE  KD A                  QYHL+ N  K
Sbjct: 299  VDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSK 358

Query: 424  IKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREI 483
            +  TL  + +     EQEK +  +  KE+  L ++ ++  N L S+    K  + + R++
Sbjct: 359  LAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQL 418

Query: 484  NTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSKQR 543
              + VS EE  K+L QK  KA+ T+ + +  I +                  +  L+   
Sbjct: 419  ERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTI 478

Query: 544  EVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSK 603
               +             T   + E+A +EKELEP   +++EKKS+IKLVE EI +I+++ 
Sbjct: 479  VDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEAD 538

Query: 604  RKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMK 663
             K+ +EI                    +  LN    ++      G++EC  A  KL EMK
Sbjct: 539  LKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMK 598

Query: 664  AILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAI 723
             +L +HRQ+  +ARS VS+A+NKNKVLT+L R+Q+SGRI+G+HGRLGDLG I D+YD+AI
Sbjct: 599  KVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAI 658

Query: 724  STACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFD 783
            STACPRLDD+VV++VECGQ CIE LRKNKLGYARF++LDKL++F++ P  TPENVPRLFD
Sbjct: 659  STACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFD 718

Query: 784  LVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGS 843
            LVKPKE +FAPA YSVLRDTLV  DL QANRVAYGK+R+RVVTLDG+LIDISGTM+GGG 
Sbjct: 719  LVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGD 778

Query: 844  RVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDRE 903
            R   GLM  T +    S +++ E+++++E EL  REK F VA ETF  ME  L+   DR+
Sbjct: 779  RAASGLMKSTQQ----SSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQ 834

Query: 904  PQLELEISKKLIDIDALTQQIQ--LTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQE 961
            P++E+E+SK+ +DI+ ++ +++  + R    E+SN  + SI+           L ALN +
Sbjct: 835  PEIEVELSKQKMDIETISAELESKIERKLELERSN--KTSIEDSSELRTAEEKLAALNAD 892

Query: 962  LKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXX 1021
            L      S++ ++R+  L+ +IM IGG ELQ  NSKV SLNQ+I I+ A           
Sbjct: 893  LNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKK 952

Query: 1022 XNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQE 1081
               ELK+ARK  I            I   K+  +     + ++ K L  +Q+E   L  E
Sbjct: 953  AELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDE 1012

Query: 1082 LENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTH 1141
                  +L + NE ++ + +I++EL  ++++  ++ +YLKKE  +   +L++ +LRD+  
Sbjct: 1013 HAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQ 1072

Query: 1142 TLDLLREEEGTEA-NQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEI 1200
             +  L E +  ++ +  PT   D    N+ + ML    A     + S     + +A + +
Sbjct: 1073 VMLDLEENKSLQSFSHSPTP--DTKRENIQSSMLETHLA-----SPSPNERKISIAENNL 1125

Query: 1201 SMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLV 1260
            SM+VD+   ++  G+P+L D EL+ +D ++L  +I QLQ +I+N +++IEIL+EYAKRL 
Sbjct: 1126 SMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLA 1185

Query: 1261 EFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAEL 1320
            E+++R+IDLN ++ +R++     E LKK+R +EFMEGF IIS+TLKEMYQMITMGGNAEL
Sbjct: 1186 EYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAEL 1245

Query: 1321 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1380
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1246 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1305

Query: 1381 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE 1440
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA++LVGIYK+ NMT++ T++NR+
Sbjct: 1306 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRD 1365

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1207 bits (3124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1394 (47%), Positives = 919/1394 (65%), Gaps = 47/1394 (3%)

Query: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXX 123
            ++ TPRKL++G  + ++A SQP +S+SS+  VP LQ    PL  +    R ++Y      
Sbjct: 33   RSRTPRKLVLGSPDKRFAFSQPVSSSSSN--VPHLQ----PLKNELSSSRGRVYSQSPPR 86

Query: 124  XXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183
                        KLELIQLSP+K SRLE QK  ++  A +G + RL I +LVLHNFKSYA
Sbjct: 87   SPNRSPTR----KLELIQLSPMKKSRLESQKFQESR-AMMGSIQRLCIDRLVLHNFKSYA 141

Query: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243
            G Q +GPF  SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE   +L+
Sbjct: 142  GTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLD 201

Query: 244  FCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301
             C V++ F+YV+DE     DG T  ++ + ++VI RKAF+NN+SKY++NGKES++T +T+
Sbjct: 202  SCHVDIFFQYVQDE----PDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQ 257

Query: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361
            LL+++GIDLDHKRFLILQGEVE+IAQMK KAEK+++DGLLEYLEDIIGT  YKPLIE   
Sbjct: 258  LLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTL 317

Query: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNN 421
             EI  +N++C EKENRF IV+ EK+SLE+ K+ A                  QYHL+ N 
Sbjct: 318  SEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNE 377

Query: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481
             K+ +T  +I   +     EK + ++  +E+  ++  +   K  L  L   EK L   KR
Sbjct: 378  QKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKR 437

Query: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSK 541
              +   VSLEE  KNL QK  K+  +++S  S IS                   + +L+ 
Sbjct: 438  ACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNG 497

Query: 542  QREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601
              + E+                 S++I  IEKELEP N ++QEKK+Q+KL E  I + ++
Sbjct: 498  TMKEEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKE 557

Query: 602  SKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661
            S  K+  +I                    V  L K + ++ ++   G  EC +A  K+ E
Sbjct: 558  SHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKE 617

Query: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721
            MK IL +HRQ++++ARS++ST +NKNKVL +L+R+Q+SGRI+GFHGRLGDLG I D+YDV
Sbjct: 618  MKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDV 677

Query: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781
            AISTACPRLDD+VVE+VECGQ CIE+LRKNKLGYARF++LDKL+ F++SPI+TPENVPRL
Sbjct: 678  AISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRL 737

Query: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841
            +DLV+P   +F  A YSVLRDTLVAKDLK+AN+VAYGK+R+RVVTLDG+LID+SGTMSGG
Sbjct: 738  YDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGG 797

Query: 842  GSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCD 901
            G+   +G+M    +   ++  F+ E++++++ EL+ RE  F +A++T H ME+ L+KL D
Sbjct: 798  GNFKARGMMKSEQQ---SNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKD 854

Query: 902  REPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQE 961
            REP++EL+ISK+ +DID+L+ +++ +  +L     +  +              L++L  E
Sbjct: 855  REPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSE 914

Query: 962  LKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXX 1021
             + L+++ ++  + +  L+++IM++GG++LQ+Q+S V S+NQRI I+ A           
Sbjct: 915  YRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKT------ 968

Query: 1022 XNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQE 1081
              T+LKKA+  +             +        + +N+L   +K ++ + +    L+ E
Sbjct: 969  -KTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDE 1027

Query: 1082 LENFSDKLHESNENVNE-------FKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134
            LE   +++ ++ E+++E       F+ ++++   ++++   + + L KE  + L  LN+ 
Sbjct: 1028 LELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSL 1087

Query: 1135 RLRDVTHTLDLLREEEGTE-----ANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSL 1189
            ++RDVT TL  L E    E     A + P     E +S++ + M    D   EN   S+ 
Sbjct: 1088 KIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPM----DVD-ENQGESTS 1142

Query: 1190 SNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINI 1249
            +   ++ + E   +  +  + +  G+P+L + EL   + + +  EI+QLQ ++ N   +I
Sbjct: 1143 TTEAQLQAGE--AERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADI 1200

Query: 1250 EILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMY 1309
            EILEEYA+RL+E+K RK+DLN++V ER+++    E LKKKR +EFMEGF+ I M LKEMY
Sbjct: 1201 EILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMY 1260

Query: 1310 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1369
            QMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY
Sbjct: 1261 QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1320

Query: 1370 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG+YK++N
Sbjct: 1321 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKN 1380

Query: 1430 MTKNATIRNREDLI 1443
            MTK+  ++N  DLI
Sbjct: 1381 MTKSVALQNT-DLI 1393

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1207 bits (3123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1395 (47%), Positives = 887/1395 (63%), Gaps = 32/1395 (2%)

Query: 50   LPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDS 109
            +  L++S  P   K   TP KL+ G    K+  SQ +++++++L+ P+LQ      SQ S
Sbjct: 1    MADLRTSKKP---KHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPP--TYSQLS 55

Query: 110  RGRRIKMYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRL 169
            RGR +                     ++ELIQLSPIKNSRLELQK+YD    K     RL
Sbjct: 56   RGRSV------YSQSPPRSPNRSPARRIELIQLSPIKNSRLELQKIYDG---KQTTTKRL 106

Query: 170  YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRL 229
             I  L+L+NFKSYAG Q +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L
Sbjct: 107  SIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL 166

Query: 230  SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKY 287
            S+LIHKSE   NL+FCSVE+ F+YV D+     DG+T  +     L + RK FKNN+SKY
Sbjct: 167  SNLIHKSENHENLSFCSVEITFQYVMDD----ADGNTKVLPDVQELSVMRKVFKNNTSKY 222

Query: 288  FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            +INGKES++TEVT+ L+ +GIDLDHKRFLILQGEVE+IAQMK KA+ + +DGLLEYLEDI
Sbjct: 223  YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282

Query: 348  IGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXX 407
            IGT  YK  I    VE++ +N++C+EKE RF +V+ EK SLE  K+ A            
Sbjct: 283  IGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTL 342

Query: 408  XXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLT 467
                  Q+ +     K+  TL +I +     E E+ ++ +  KE+  L+   D  +  +T
Sbjct: 343  LKSKQLQWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQIT 402

Query: 468  SLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXX 527
             +  E+  L++ K ++  + VS EE  K+L+QK  KA+ T++ ++  I            
Sbjct: 403  KINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNE 462

Query: 528  XXXXXXXXVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKS 587
                    + +L++    E              T + S+E+AS+EKELEP  T+++ K S
Sbjct: 463  AQTEFENSLLELNESLHSERSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNS 522

Query: 588  QIKLVEMEIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQE 647
            QIKL E EI +I++SK K+  EI                    +  L K    +      
Sbjct: 523  QIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFIST 582

Query: 648  GDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHG 707
               EC  A  KL +MK +L +HRQ+  +AR  +S  +NKNKVL +L R+Q+SGRI+GFHG
Sbjct: 583  AQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHG 642

Query: 708  RLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRF 767
            RLGDLG I D+YD+AIS ACPRLDD+VVE+VEC Q CIE LRKNKLGYARF++LDKLK+F
Sbjct: 643  RLGDLGTIDDKYDIAISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKF 702

Query: 768  DMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTL 827
            +M+ + TPENVPRLFDL  PK + FAPA+YSVLRDTLVAKDL QANRVAYG RRFRVVTL
Sbjct: 703  NMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTL 762

Query: 828  DGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASE 887
            DG+LIDISGTMSGGG RV KGLM    +   ++++++ E+++++E EL  RE  F +A++
Sbjct: 763  DGKLIDISGTMSGGGDRVVKGLMKSKQR---SNDMYTSEEVQRMEAELTDRETNFKIATD 819

Query: 888  TFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXX 947
            TF  ME  L+K  DR+P +++EISK  IDID L+ ++Q  +  L E  +  E + +    
Sbjct: 820  TFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGP 879

Query: 948  XXXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDI 1007
                   L ALN EL  L+D+SK  +E++S L+ +IM+IGG +LQ QNSKV SL Q++ I
Sbjct: 880  LEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQI 939

Query: 1008 LQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKS 1067
            + A              E+ +A K  +            ++      E  +  L +    
Sbjct: 940  IVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHL 999

Query: 1068 LESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQL 1127
            +E I+D+K  L QE E     L +    V +FK+ ++E+   +E+  ++  ++K E  + 
Sbjct: 1000 IEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRT 1059

Query: 1128 LEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDE--TTSN--VDNEMLGAADAGVEN 1183
             EELN  +LRDV   L  L E      N    + TD   T SN  +    +   DA + +
Sbjct: 1060 DEELNTLKLRDVEQLLQKLDEH-----NLPLESLTDRAVTPSNQCIPEMTVEDHDADMND 1114

Query: 1184 MNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFIN 1243
                 +S      +D+ SMDVD     +  G+P+L++ EL  ID + L  EI QL+ +++
Sbjct: 1115 GEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMD 1174

Query: 1244 NVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISM 1303
                +I+ILEEYA RL E+K+RK+DLN SV +R ++ +  E LKK R  EFM+GF IISM
Sbjct: 1175 TAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISM 1234

Query: 1304 TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALV 1363
            T+KE+YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALV
Sbjct: 1235 TVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1294

Query: 1364 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423
            FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+G
Sbjct: 1295 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1354

Query: 1424 IYKHENMTKNATIRN 1438
            IYK  NMTK+ T++N
Sbjct: 1355 IYKSSNMTKSTTLQN 1369

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1390 (47%), Positives = 898/1390 (64%), Gaps = 36/1390 (2%)

Query: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXX 123
            ++ TPRKL++G  + ++A SQP TS+SS+  VP LQ    PL  +    R ++Y      
Sbjct: 33   RSRTPRKLVLGSPDKRFAFSQPVTSSSSN--VPYLQ----PLKSELSSSRGRVYSQSPPR 86

Query: 124  XXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183
                        KLELIQLSP K +RLE QK           + RL I++L LHNFKSYA
Sbjct: 87   SPTRSPTR----KLELIQLSPTKKTRLESQKTEQVRGL-AQPIERLCINRLSLHNFKSYA 141

Query: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243
            G Q +GPF +SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE   NL+
Sbjct: 142  GTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLD 201

Query: 244  FCSVEVHFRYVKDEYTAPTDGDTMEAEN--TLVITRKAFKNNSSKYFINGKESNFTEVTK 301
             C VEV F+YV+DE     DG T   ++   LV+TRKAFKNN+SKY++NGKES++T+VT+
Sbjct: 202  SCHVEVFFQYVQDEL----DGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTE 257

Query: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361
            LL+++GIDLDHKRFLILQGEVE+IAQMK KAEK+ +DGLLEYLEDIIGT  YKPLIEQ  
Sbjct: 258  LLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTL 317

Query: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNN 421
            V+I+ +N++C EKENR+ IV+ EK+SLE  KD A                  Q+ L+ N+
Sbjct: 318  VQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNS 377

Query: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481
             K   T  +I +L      E+ ++++  +E++ L++        +  +   E SL   KR
Sbjct: 378  FKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKR 437

Query: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSK 541
              +   VSLEE  KN+ QK  KA+ T  ++ + I+                   +++L+K
Sbjct: 438  TCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNK 497

Query: 542  QREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601
               VE+             T   S +I  IE+ELEP N ++QEK+SQIKL E +I ++++
Sbjct: 498  SLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKE 557

Query: 602  SKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661
            S  K+  EI                    +  L K   ++ ++   G  EC +A  K+ E
Sbjct: 558  SLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKE 617

Query: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721
            MKA+L +HRQ++++A+S++ST +NKNKVL++L R+Q+SGRI+GFHGRLGDLG I D+YDV
Sbjct: 618  MKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDV 677

Query: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781
            AISTACPRLDD+VVE+VECGQ CIE LRKNKLGYARF++LDKL+ F+M+ IQTP NV RL
Sbjct: 678  AISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRL 737

Query: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841
            FDLV P + +F  A YSVLRDTLVAKDLK+ANRVAYGK+RFRVVTLDG+LID+SGTMSGG
Sbjct: 738  FDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGG 797

Query: 842  GSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCD 901
            G+    G+M      +G S  F+ E++++++ EL  RE+ F +A++T H ME  L+ L D
Sbjct: 798  GNHRASGMMKSERLNTGAS--FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKD 855

Query: 902  REPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQE 961
            REP++E +ISK+ ++ID+L  +I+L   +      + + +             L++L  E
Sbjct: 856  REPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAE 915

Query: 962  LKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXX 1021
             K L+ + K+   ++  L+++IM+IGG++LQLQ S V S+ QRI I              
Sbjct: 916  CKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKK 975

Query: 1022 XNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQE 1081
               +LK+  K               +   K     + N +L++  S++ +Q E   +E++
Sbjct: 976  AENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEK 1035

Query: 1082 LENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTH 1141
            +      + E +    +F   ++++ N++E+ N +L+++ K+   LL++L + ++RDVT 
Sbjct: 1036 VREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTA 1095

Query: 1142 TLDLLRE------EEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKV 1195
            TL  L +        G E + Q +    +  SN D   +   +  + N  T+S       
Sbjct: 1096 TLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTAS------- 1148

Query: 1196 ASDEISMDVDDCGDLVSQ--GIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILE 1253
               E  MDVD+  ++ +    +P+L++ +L  ++ + +  EI QL  F+ N   +IE+LE
Sbjct: 1149 -QPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLE 1207

Query: 1254 EYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT 1313
            EY KRLV+F+ RK++LN +V +R+ +    + L+KKR +EFM GF+ ISMTLKEMYQMIT
Sbjct: 1208 EYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMIT 1267

Query: 1314 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1373
            MGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1268 MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1327

Query: 1374 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKN 1433
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ NMTK+
Sbjct: 1328 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKS 1387

Query: 1434 ATIRNREDLI 1443
              + N+ DLI
Sbjct: 1388 VALENK-DLI 1396

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1173 bits (3034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1412 (47%), Positives = 900/1412 (63%), Gaps = 45/1412 (3%)

Query: 42   TKSSLHDSLPKLQSSV--SPL----DFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQV 95
            + S L++ +PK+  S   SPL    D  K+ TP K+II  + +      P+   SSS Q 
Sbjct: 17   SNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVIISNNHSNSISPLPSQLMSSSTQP 76

Query: 96   PALQQKLVPLSQDSRGRRIKMYXXXXXXXXXXXXXXXXXXKLELIQLSPIKNSRLELQKL 155
            P+LQ      S  SRGR +K Y                  KLELIQLSPIKNSR ELQK+
Sbjct: 77   PSLQHP----SSSSRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRSELQKI 132

Query: 156  YDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLF 215
            Y +   +  K+ R+ ++KLVLHNFKSYAG QTIGPF +SFSAVVGPNGSGKSNVIDSMLF
Sbjct: 133  YSSKQEE--KIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLF 190

Query: 216  VFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTME-AENTLV 274
            VFGFRANKMRQ +L+DLIHKSE + +L  C+V+VHF Y+ D    P D   +  ++  L+
Sbjct: 191  VFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLID---YPDDTTKINPSKQPLI 247

Query: 275  ITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEK 334
            ITR+AFKN++SKY++NGKESN+  +T LLKE+GIDLDH RFLILQGEVENIAQMK KAEK
Sbjct: 248  ITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEK 307

Query: 335  DNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDA 394
            + +DGLLEYLEDIIGT  YK LI++K +EIEA+N++CIE+ENRF I+D EK SLE +K++
Sbjct: 308  EGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKESLESEKES 367

Query: 395  AXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVET 454
            A                  QY ++ NN K+  TL +I  L  ++ QEK ++++   +++ 
Sbjct: 368  ALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDE 427

Query: 455  LQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSL 514
            L+    ++++ L +L  +EK L+  KR +++ +VS  E  KN+++KLKK    +E     
Sbjct: 428  LRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKT 487

Query: 515  ISKNXXXXXXXXXXXXXXXXXVNDLSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKE 574
            IS +                 + +L      E              TV  S+EI   EK+
Sbjct: 488  ISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKD 547

Query: 575  LEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDL 634
            LEP N ++ E KS+I++ E E  L  +SK K+ A I                    V +L
Sbjct: 548  LEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNL 607

Query: 635  NKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLM 694
                 N+ KE   G  E K A  KL EM+ IL   RQK  +AR+++S  +N++KVL +L+
Sbjct: 608  MTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALL 667

Query: 695  RMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLG 754
            ++Q+SGRINGFHGRLG+LG+I ++YDVAISTACPRL+D+VV+SVECGQ CIE+LRKN LG
Sbjct: 668  KLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLG 727

Query: 755  YARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANR 814
            +ARF++LDKL +F M  I TP NVPRLFDL+K  +++F PA YSVLR+TLVA DLK+AN 
Sbjct: 728  HARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANA 787

Query: 815  VAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEME 874
            VAYGK R+RVVTL G LIDISGTMSGGG++  KG M L+   S     +S E++ ++E E
Sbjct: 788  VAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSKEKSTYSSEEVMEIEKE 847

Query: 875  LAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEK 934
            L+ REK +  A  T   ME ELR L + EP++ELEISK   +ID+L  +  L R QL E 
Sbjct: 848  LSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEP 907

Query: 935  SNDYEKSIKXXXXXXXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQ 994
            +  +                L  LN++ K ++ Q K+  +R+  L+D+IM+IGG +LQ+Q
Sbjct: 908  NASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQ 967

Query: 995  NSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARA 1054
            NSKV SL ++  IL               ++++K  K L                 +   
Sbjct: 968  NSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIALENEL 1027

Query: 1055 EVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERAN 1114
            +  +  L     ++  IQD+K  L ++ E   ++L E    ++EFKT+++E + K E+  
Sbjct: 1028 KNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLA 1087

Query: 1115 SILSYLKKENGQLLEELNNFRLRDVTHTLDLL--REEEGTEANQQPTTGTDETTSNVDNE 1172
            S+L+ +KK    L E+ ++  +R+V + LDLL  +E+E  +   +     ++  SN    
Sbjct: 1088 SLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQSN---- 1143

Query: 1173 MLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLN 1232
                                  V +DE  M ++D  + +++GIP   + +    D  +L 
Sbjct: 1144 ---------------------DVINDE--MIIEDNNNEIAKGIPSYMESDFKQFDISSLE 1180

Query: 1233 EEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYN 1292
             E+ QLQ +     ++++ILEEY +R++E+++RK DLN SV +R+++   +E+LKK R+N
Sbjct: 1181 AELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFN 1240

Query: 1293 EFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1352
            EFME F+IISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSG
Sbjct: 1241 EFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1300

Query: 1353 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1412
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1301 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1360

Query: 1413 NMFELAKQLVGIYKHENMTKNATIRNREDLIQ 1444
            NMFELA+QLVGIYK+ N TK+AT++N + L +
Sbjct: 1361 NMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1172 bits (3031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1383 (46%), Positives = 888/1383 (64%), Gaps = 35/1383 (2%)

Query: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXXX 123
            ++ TPRKLI+  +++++ +SQP   ++ S Q P+LQ   V     S GR  K Y      
Sbjct: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADS-QTPSLQHPSV-----STGREHKFYSQSPPR 120

Query: 124  XXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183
                         LELIQLSPIKN+R ELQK+Y+    +  +  RL I +LVL NFKSYA
Sbjct: 121  SPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNFKSYA 179

Query: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243
            G Q +GPF  +FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE++  L+
Sbjct: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239

Query: 244  FCSVEVHFRYVKDEYTAPTDGDTM--EAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301
             CSVE+HF+YV D+   P  G +   E++  LV+ RKAFKNNSSKY+IN KES+FT+VT 
Sbjct: 240  SCSVEIHFQYVIDD---PNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTT 296

Query: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361
            LLK +GIDLDHKRFLILQGEVENIAQMK K+EK+ +DGLLEYLEDIIGT HYK  IE   
Sbjct: 297  LLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNL 356

Query: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNN 421
             ++EA+NE+CIEKENRF IV+ EK+SL   K+ A                  Q+ LY++N
Sbjct: 357  SKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDN 416

Query: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481
             K+ +TL +I   + ++++E +++S   KE++ LQ+        L      E+ L+  +R
Sbjct: 417  KKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQR 476

Query: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLSK 541
            + N++ +S +E  KN+++K   A+  V +++  I++                  + +L++
Sbjct: 477  KNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNE 536

Query: 542  QREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601
            + ++E+             T  FS+EI   EKELEP   ++QEK SQI+L++ EI L+ +
Sbjct: 537  KLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNE 596

Query: 602  SKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661
            +K  +  EI                    +T   +      KE + GD E      K+ E
Sbjct: 597  NKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQE 656

Query: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721
            M+  L+SHRQK  ++R+++S  QNKN VLT+L ++Q+SGRI+GF+GRLGDLG+I ++YDV
Sbjct: 657  MRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDV 716

Query: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781
            AISTACPRL+D+VV+SV+CGQ CI++LRKN+LGYARF++LDKL++F+++ I+TP+N PRL
Sbjct: 717  AISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRL 776

Query: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841
            FDL++ +E +F PA YSVLRDTLVA +L  AN+VAYGKRRFRVVTLDG+LIDISGTMSGG
Sbjct: 777  FDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGG 836

Query: 842  GSRVFKGLMNLTTKVSGTS-EIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900
            G+ V +GLM L   +     E  S E+++KLE EL   EK F VA  +   M QE+  + 
Sbjct: 837  GNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMK 896

Query: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQ 960
            ++ P  EL ISK  I+I+    +I+   SQL EK   +++              L+AL +
Sbjct: 897  EQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKK 956

Query: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXX 1020
            E   L DQ+K + + +  L+ +IM  GG EL++QNSKV+SL  ++ I+ +          
Sbjct: 957  EYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIK 1016

Query: 1021 XXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ 1080
              N  LKK +  L             + ++K +  +    L  +   +   Q+ K  +  
Sbjct: 1017 KNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILL 1076

Query: 1081 ELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVT 1140
             ++   +K  E  E+   FK+ +LE++NK+++   +  +L+K+ G+L  ELN   +R+++
Sbjct: 1077 NIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREIS 1136

Query: 1141 HTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVK-VASDE 1199
              L+                  DE     D    GA +   +  +TSS  NSV  + +D 
Sbjct: 1137 QNLE----------------SFDERLEKYDISKNGATE---DTQHTSSALNSVSNINTD- 1176

Query: 1200 ISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRL 1259
             +MD+D   + ++ GI RLS+ E++ +D ++L+ EI  L+  + + + NIEILEEY +RL
Sbjct: 1177 -TMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRL 1235

Query: 1260 VEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAE 1319
             E+KKRK DL+ S+ E+       E LKKKR  EF  GF IIS+TLKEMYQMITMGGNAE
Sbjct: 1236 SEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAE 1295

Query: 1320 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1379
            LELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1296 LELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1355

Query: 1380 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNR 1439
            IDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL+KQLVGIYK ENMT++AT+ N 
Sbjct: 1356 IDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNN 1415

Query: 1440 EDL 1442
            + L
Sbjct: 1416 DML 1418

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1393 (47%), Positives = 891/1393 (63%), Gaps = 45/1393 (3%)

Query: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDS-RGRRIKMYXXXXX 122
            + +TPR L+   SEN+  L    T  S +LQ+P+L   L P S  S RGR  K Y     
Sbjct: 35   RAITPRNLL--GSENRNVLP---TGGSQNLQIPSL---LPPESLGSARGRDFKSYSQSPP 86

Query: 123  XXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSY 182
                         +L+LI+LSPIKNSR ELQKLY++    + K  RL+IH+LVL++FKSY
Sbjct: 87   RSPGRSPTR----RLKLIELSPIKNSRAELQKLYESKKLDVKK-ERLFIHQLVLNDFKSY 141

Query: 183  AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNL 242
            AG Q IGPF  SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE F +L
Sbjct: 142  AGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDL 201

Query: 243  NFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKL 302
              CSVEVHF+YV D+    T  D  E +  LV+TRKAFKNN+SKYF+NGKESN+TEVT L
Sbjct: 202  KSCSVEVHFKYVIDKDDGSTTID--ETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTL 259

Query: 303  LKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTV 362
            LK++GIDLDHKRFLILQGEVENIAQMKAKAEK+N+DGLLEYLEDIIGT  YK  IE+ ++
Sbjct: 260  LKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSM 319

Query: 363  EIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVNND 422
            EIE++NE+C+EKENRF IV+ EKNSLE  K+ A                  QY+L  +N 
Sbjct: 320  EIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNK 379

Query: 423  KIKTTLGQIDSLRTDFEQEKQRH-SQFMK---EVETLQNSIDESKNNLTSLTTEEKSLIQ 478
            K+   L +    +T+ +QE+ +   +F K    +  +  S++  K +L  + TEE +L +
Sbjct: 380  KLDDVLNK----KTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSK 435

Query: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVND 538
             KR +  + V  E+   NLD K K+ +   +  +  I+                      
Sbjct: 436  TKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTV 495

Query: 539  LSKQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598
            LS   ++E+             T   + +IA  EKEL P N + Q+ K +IK+ E E+ +
Sbjct: 496  LSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSI 555

Query: 599  IRDSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVK 658
            I ++++ +  +I                    +  L + K  +++E++ G++ECK+A   
Sbjct: 556  IEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQAT 615

Query: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718
            L  ++  + + RQK +E RST S  +N NKVL++L+R+Q+SGR+NGFHGRLGDL +I  +
Sbjct: 616  LANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPK 675

Query: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778
            YDVAISTACPRL+D+VV++VE GQ CIE+LRKNKLGYARF++LDKL  F+ + I TP+  
Sbjct: 676  YDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQS 735

Query: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838
             RLFDL+  KEKRF  A YSVLRDTLV ++++QANRVAYGK+R+RVVTLDG LID+SGTM
Sbjct: 736  QRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTM 795

Query: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898
            +GGG  V KGLM L+   S  S  FS E+++ +E EL  +E Q+  A + +H ME+ELR+
Sbjct: 796  TGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRR 855

Query: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEAL 958
            L DR P+++  +SKK +DI+     I    + L EK    E               L+ L
Sbjct: 856  LRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKEL 915

Query: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQN-------SKVSSLNQRIDILQAX 1011
              +L  +  Q+K++ +++  +KD+I+ +GG EL+ Q+       +K+S  ++R+  +++ 
Sbjct: 916  KSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSN 975

Query: 1012 XXXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESI 1071
                       N EL +A + L               +A   ++  ++ LLDI +S+E++
Sbjct: 976  KLKKESLLKKFNKELTEANEEL-------TNFSKNAENADIESKEIESKLLDIKESIENL 1028

Query: 1072 QDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEEL 1131
            ++ ++ LE E+E   ++L    + V+++K+I LE  NK+E+  +  + LKK   +  + L
Sbjct: 1029 KENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLL 1088

Query: 1132 NNFRLRDVTHTLDLLREEEGTEANQQ-PTTGTDETTSNVDNEMLGAADAGVENMNTSSLS 1190
            +   +RDVT  L+ +  EE    ++  P         N D++ + A        N S   
Sbjct: 1089 SELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSE-----NQSFNH 1143

Query: 1191 NSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIE 1250
            N      D   M++D  G  ++ GIP LS  EL+ +D   +   I  L  FI +   N++
Sbjct: 1144 NDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVD 1203

Query: 1251 ILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQ 1310
            +LEEYA R VEF KRK DLN++V  R+ +   +E +K+KRY+EFMEGF IISMTLKEMYQ
Sbjct: 1204 VLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQ 1263

Query: 1311 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1370
            MIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYK
Sbjct: 1264 MITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1323

Query: 1371 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
            PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL KQLVGIYKHENM
Sbjct: 1324 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENM 1383

Query: 1431 TKNATIRNREDLI 1443
            TK+A + N EDL+
Sbjct: 1384 TKSAALVN-EDLV 1395

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1395 (46%), Positives = 891/1395 (63%), Gaps = 76/1395 (5%)

Query: 65   TVTPRKLIIGPSENKYALS--QPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYXXXXX 122
            T TPRKL++G  E KYA+S  Q TT+AS+++  P+LQ    P +   RGR    Y     
Sbjct: 26   TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQP---PTAHAVRGRE---YSQSPP 79

Query: 123  XXXXXXXXXXXXXKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSY 182
                         KLELI+LSP K++RLELQK+   H A      RL I KLVL+NFKSY
Sbjct: 80   RSPTRSPTRSPTRKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSY 136

Query: 183  AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNL 242
            AG Q IGPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+F +L
Sbjct: 137  AGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSL 196

Query: 243  NFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVT 300
              CSV++HF YV D      +G+T  + +  T+V+ R+AFKNNSSKY++NGKESN+TEVT
Sbjct: 197  ASCSVQIHFHYVHD----TDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVT 252

Query: 301  KLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQK 360
            +LLKE+GIDLDHKRFLILQGEVE+IAQMKAKAEKDN+DGLLEYLEDIIGT  +KP IE+ 
Sbjct: 253  RLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKC 312

Query: 361  TVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAAXXXXXXXXXXXXXXXXXTQYHLYVN 420
              EIE +NE+C+EKENRF +VD EK +LE  K+ A                  Q  +Y +
Sbjct: 313  LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDS 372

Query: 421  NDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRK 480
            N K+ T+  +I +L  +F++EK ++    KE ETL + I+ +K   T+L TE K++  +K
Sbjct: 373  NRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKK 432

Query: 481  REINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNXXXXXXXXXXXXXXXXXVNDLS 540
            R +    ++ +E  K++ +KLK A+     S+S                      +++L+
Sbjct: 433  RSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLN 492

Query: 541  KQREVEEXXXXXXXXXXXXXTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIR 600
                +E+             T   S E+ S+E++LEP   +IQEK+S+IKL E +I +++
Sbjct: 493  HSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLK 552

Query: 601  DSKRKVGAEIXXXXXXXXXXXXXXXXXXXXVTDLNKSKRNLVKEKQEGDKECKDAGVKLN 660
             S   +  E                      T L   K  +        KEC++A  + N
Sbjct: 553  SSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTN 612

Query: 661  EMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYD 720
            EM+ +L   RQ   EA++ ++  QNKN+VL +L ++Q SGRI GFHGRLGDLG I DQYD
Sbjct: 613  EMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYD 672

Query: 721  VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPR 780
            +AISTACPRLDD+VVE+VECGQ CI+ LRKNKLGY RF++LDKL++ ++  I TPENVPR
Sbjct: 673  IAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPR 732

Query: 781  LFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSG 840
            LFDL+ P    F PA YSVLRDTLVA+DL+QANRVAYGKRRFRVVTLDG+LIDISGTMSG
Sbjct: 733  LFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSG 792

Query: 841  GGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900
            GGS    GLM   +K +  S+ +S ++++K+E++L+ +E  +  A    H ME  L+KL 
Sbjct: 793  GGSSPQSGLMR--SKATTASQ-YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849

Query: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQ 960
            DR P+++++ISK  ++  +   +++    +L++ + +   + K           L+ L Q
Sbjct: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQ 909

Query: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXX 1020
             L+   D SK S +++  LKD IM+ GG EL++Q +KV+SL Q I+IL            
Sbjct: 910  HLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSK 969

Query: 1021 XXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEV--AKNSLLDINKSLESIQDEKINL 1078
              + +L +A +                   K   EV      +  +++ LESI+ EK  +
Sbjct: 970  KLDIDLARATRE----------------KNKYSEEVLVCNKDISILSEQLESIRLEKERI 1013

Query: 1079 EQELENFSDKLHESNENV--------------NEFKTIQLELENKIERANSILSYLKKEN 1124
            E+++   +++  E N +V              NEFK  +LE  +++E+ + +  Y+KK+ 
Sbjct: 1014 EEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQL 1073

Query: 1125 GQLLEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENM 1184
                  L + ++RDV+  L  L +            G  E+ ++V  +++       + +
Sbjct: 1074 RSYETSLQSLKIRDVSKLLSQLND------------GIIESCTDVTAKVMNG-----DIV 1116

Query: 1185 NTSSLSNSVKVASDEISMDVDDCGDLVSQ-GIPRLSDKELSTIDTDNLNEEINQLQSFIN 1243
             T S+++   V +++    ++D G+  +  G+P L++ EL  +D + L  E++QLQ +++
Sbjct: 1117 QTQSITD---VGNNDA---MEDSGEAATHSGLPSLTETELENLDLETLELELHQLQDYLD 1170

Query: 1244 NVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISM 1303
            N + +IE+LEEYA+RL E+++RK+DLN +V +R ++ +  E  K +R  +FMEGF IISM
Sbjct: 1171 NFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISM 1230

Query: 1304 TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALV 1363
            TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALV
Sbjct: 1231 TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1290

Query: 1364 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423
            FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+ LVG
Sbjct: 1291 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVG 1350

Query: 1424 IYKHENMTKNATIRN 1438
            IYK+ NMTK+ T++N
Sbjct: 1351 IYKNNNMTKSTTLQN 1365

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  183 bits (464), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 199/765 (26%), Positives = 356/765 (46%), Gaps = 106/765 (13%)

Query: 704  GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
            G  G + DL     ++Y +A+ST   R  D ++VE++   Q CI FL+K + G A F+ L
Sbjct: 533  GVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 592

Query: 762  DKLKRFDMSPIQTPENVPRLFDL-VKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
            D ++  D+  +  P++   +  +     +  +  A+  V  D+++   L  A  + + K 
Sbjct: 593  DTIET-DLPTLSLPDSQDYILSINAIDYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKS 651

Query: 821  -RFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAARE 879
             R ++VT++G LI  +G M+GG S    G  N          + SL+D  KL +      
Sbjct: 652  VRAKLVTIEGALIHKAGLMTGGIS----GDANNRWDKEEYQGLMSLKD--KLLI------ 699

Query: 880  KQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYE 939
             Q D  S +  S     R         E+E S  L++ D  + + Q+T+ + +   N+ E
Sbjct: 700  -QIDELSNSQRSNSIRAR---------EVENSVSLLNSDIASLRTQVTQQKRSLDENNLE 749

Query: 940  KSIKXXXXXXXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEIMR-----IGGSELQLQ 994
                           +  L ++LK L++      +    L+++I +     IG S  + +
Sbjct: 750  IKYHNDLIEKEIQPKITELEEKLKNLENTRNDLEKEKEALQNDIFKKFTDKIGFSIKEYE 809

Query: 995  NSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARA 1054
            N     + Q+                  + EL++ +K ++            +   + R 
Sbjct: 810  NHSGELMRQQ------------------SRELQQLQKQILTVENKLQFEKDRLNTTQRRY 851

Query: 1055 EVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLE-LENKIERA 1113
            E A+N L      ++S+++++   E ++++   KL E+         I LE L+ K    
Sbjct: 852  EKAQNDLKSAQIEMKSLEEQEEAAEMKIKSLESKLEENK--------IHLEGLQRKFTAK 903

Query: 1114 NSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEM 1173
             S L+     N  +LE++N+         L +L+ E           G  E T   D E 
Sbjct: 904  QSDLN----SNEDVLEDMNS--------NLQILKRERD---------GIKEDTEKFDLER 942

Query: 1174 LGA-ADAGVENMNTSSLSNS----VKVAS-DEISMDVDDCGDLVSQGIPRLSDKELSTID 1227
            + A  +  + N+N   LS +    + +AS D  ++ + +  D+  +G+P+   +  +   
Sbjct: 943  VTALKNCKISNINLPILSETTIDDLPIASGDSEAISISNKIDVDYKGLPKKYKESNTDSA 1002

Query: 1228 TDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSV----GERNQLTSIM 1283
               L+E+I +++  +N +  N    E Y     E ++R   +NN       E  ++ S  
Sbjct: 1003 KKGLDEKIREVEEILNELQPNARAEERYD----EAEERFEVINNETEELKAEEKKILSQF 1058

Query: 1284 EELKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVT 1334
             ++K+KR   F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ 
Sbjct: 1059 LKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIK 1118

Query: 1335 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1394
            +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A 
Sbjct: 1119 YHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAA 1178

Query: 1395 YI-KERTKNAQFIVISLRNNMFELAKQLVGIYK--HENMTKNATI 1436
            YI + R  + QFIVISL+N MFE +  LVG+Y+   EN +K  T+
Sbjct: 1179 YIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 111/212 (52%), Gaps = 12/212 (5%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 234 HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDT---MEAENTLV-ITRKAFKNNSSKYFI 289
           ++       +  + +          + P         +  N LV + R   +N  + Y I
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGDTSYKI 126

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           +GK  ++ + +  L+ + I +  K FL+ QG+VE IA     A+   E  L +  E++ G
Sbjct: 127 DGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIA-----AQSPIE--LSKMFEEVSG 179

Query: 350 TKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
           +  YK   ++   +IE + +   E  +NR RI
Sbjct: 180 SIQYKKEYDELKEKIEKLGKSATESIKNRRRI 211

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 203/784 (25%), Positives = 357/784 (45%), Gaps = 144/784 (18%)

Query: 704  GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
            G  G + DL     ++Y +A+ST   R  D ++VE++   Q CI FL+K + G A F+ L
Sbjct: 567  GVKGLVHDLCHPKKEKYGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 626

Query: 762  DKLKRFDMSPIQTPENVPRLFDL-VKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
            D ++  ++  +  P++   +  +     E  +  A+  V  D+++   L  A  + + K 
Sbjct: 627  DTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKG 685

Query: 821  -RFRVVTLDGQLIDISGTMSGGGS---------RVFKGLMNLTTKVSGTSEIFSLEDMKK 870
             R ++VT++G LI  +G M+GG S           ++ LM+L  K+     +  ++++  
Sbjct: 686  VRAKLVTIEGALIHKAGLMTGGISGDTNNRWDKEEYQSLMSLKDKL-----LIQIDELSN 740

Query: 871  LEMELAAREKQFDVASETFHSMEQELRKLCDR------EPQLELEISKKLIDIDALTQQI 924
             +   + R ++ + +    +S    LR    +      E +LE++    LID      +I
Sbjct: 741  SQRSSSIRAREVENSVSLLNSDIASLRTQVTQQKRSLDENKLEIKYHNDLID-----NEI 795

Query: 925  QLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQDQSKTSSERVSFLKDEIM 984
            Q   ++L +K    EK+              EAL  E+       K  +E++ F   E  
Sbjct: 796  QPKITELEKKLEHLEKTKNELEKEK------EALQSEV------FKEFTEKIGFSIKEYE 843

Query: 985  RIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXXX 1044
               G EL  Q SK                           EL++ +K ++          
Sbjct: 844  SHSG-ELMRQQSK---------------------------ELQQLQKQILTVENKLQFET 875

Query: 1045 XXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNE----FK 1100
              +   + R E A+  L ++   ++S+++++   E +++    KL E+  +++E    F 
Sbjct: 876  DRLNTTQRRYEKAQRDLANVQIEMKSLEEQEETTETKIKAIESKLEENKMHLDELQKKFI 935

Query: 1101 TIQLEL---ENKIERANSILSYLKKENGQLLEELNNFRLRDVTH---------TLDLLRE 1148
              Q +L   E+ +E  N+ L  LK+E   + E++  F L  VT           L +L E
Sbjct: 936  ANQSDLNSTEDILEDLNNNLQALKRERDGIKEDIEKFDLERVTALKNCKISNINLPILSE 995

Query: 1149 EEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCG 1208
                      TT  D   S+ D+E +             S+SN++         DVD   
Sbjct: 996  ----------TTIDDLPISSGDSEAI-------------SISNNI---------DVD--- 1020

Query: 1209 DLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKID 1268
                QG+P+   +  +      L ++I +    +N +  N   +E Y     E ++R   
Sbjct: 1021 ---YQGLPKKYKENSNDSARKELEQKITEADEILNELQPNARAVERYD----EAEERFDV 1073

Query: 1269 LNNSV----GERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT---------MG 1315
            +NN       E  ++ +   ++KKKR   F + F  +S  L  +Y+ +T          G
Sbjct: 1074 INNETEELKSEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAG 1133

Query: 1316 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1375
            GNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1134 GNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFF 1193

Query: 1376 VMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAKQLVGIYK--HENMTK 1432
            V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+   EN +K
Sbjct: 1194 VLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSK 1253

Query: 1433 NATI 1436
              T+
Sbjct: 1254 TVTL 1257

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 116/219 (52%), Gaps = 28/219 (12%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 234 HKS----------ERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLV-ITRKAFKN 282
           ++           +   + N  +   +  YVK  Y         +  N LV +TR   +N
Sbjct: 103 YRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFY---------QKGNKLVELTRLISRN 153

Query: 283 NSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLE 342
             + Y I+GK   + + +  L+ + I +  K FL+ QG+VE IA   A++  D    L  
Sbjct: 154 GDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIA---AQSPTD----LSR 206

Query: 343 YLEDIIGTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
             E++ G+  YK   ++   +IE +++   E  +NR RI
Sbjct: 207 MFEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRI 245

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  177 bits (448), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 188/772 (24%), Positives = 348/772 (45%), Gaps = 120/772 (15%)

Query: 704  GFHGRLGDLG-IIADQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
            G  G + DL     ++Y +A+S    +  D ++VE++   + CI FL+K + G A F+ L
Sbjct: 526  GVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPL 585

Query: 762  DKL--KRFDMSPIQTPENVPRL----FDLVKPKEKRFAPAIYSVLRDTL-VAKDLKQANR 814
            D +  ++  +S   + E +  +    +DL   +  ++     S++ DTL +A+DLK    
Sbjct: 586  DTIDSEQPTLSAPPSQEYILTINAIEYDLAYERAMQYVCGD-SIICDTLDIARDLKWNRG 644

Query: 815  VAYGKRRFRVVTLDGQLIDISGTMSGGGSR---------VFKGLMNLTTKVSGTSEIFSL 865
            V     R ++V+LDG LI  +G M+GG S+          ++ LM L  K+     +  +
Sbjct: 645  V-----RSKLVSLDGSLIHKAGLMTGGISKDSKNRWDKEEYQSLMTLKDKL-----LIQI 694

Query: 866  EDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQ 925
            E++  +  + AA+ +                          ELE S  L++ +  + + Q
Sbjct: 695  EEVSTVGRDAAAKAR--------------------------ELESSLSLLNAELSSLRTQ 728

Query: 926  LTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQDQ-SKTSSERVSFLKDEIM 984
            L + + + + N  E +             LE+L +E++ +++  S  ++E+VS       
Sbjct: 729  LVQVKRSVEENANEINYHNKLLTEQYTPKLESLQEEIQAIENSISSITAEKVS------- 781

Query: 985  RIGGSELQLQNSKVSSLNQRIDI-LQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXX 1043
                    LQ +    L  ++   +Q             + EL++ +K ++         
Sbjct: 782  --------LQETIFKELTDKVGFSIQDYERYSGDLMREQSKELQQLQKQILNIKNKLQFE 833

Query: 1044 XXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTI- 1102
               +   + +   +  SL     +L+S+++E+   +Q+ +     + E    +N  + + 
Sbjct: 834  SERLKTTEGKYHASLESLESAKSNLQSLEEEENECQQKRKQIEQHISEDEAELNRLQRVY 893

Query: 1103 ---QLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQQPT 1159
               QL+  N                  +L E NN  L+ + H  + +RE+   E      
Sbjct: 894  DARQLDFNNL---------------DDVLAEYNN-ELQSLKHNRNQIRED--MEKIDLER 935

Query: 1160 TGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLS 1219
             G  +     + E+   +D  + N+    +       S+EI +D +D        +P   
Sbjct: 936  VGVLKNCKITNMEIPILSDINLSNLPIDKIDEDTIAISNEIDVDYND--------LPAKY 987

Query: 1220 DKELSTIDTDNLNEEINQLQSFINNVSINIEILEEY---AKRLVEFKKRKIDLNNSVGER 1276
             +  +T   + L   I  ++  +N +  N   +E +    +R    +K   DL     E+
Sbjct: 988  KESSATTIREELENHIRSIEDTLNVLQPNARAVERFDDAQERFEVVEKETEDL--KAREK 1045

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITM---------GGNAELELVDSLD 1327
              LT  ++ +KK+R   F   F  ++  L  +Y+ +T          GGNA L L D  +
Sbjct: 1046 KALTQFLK-IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDE 1104

Query: 1328 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1387
            PF+ G+ +  MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  
Sbjct: 1105 PFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDIT 1164

Query: 1388 NVSIVANYIKER-TKNAQFIVISLRNNMFELAKQLVGIYK--HENMTKNATI 1436
            NV  +A YI+     + QFIVISL+N MFE +  LVG+Y+   EN +K  T+
Sbjct: 1165 NVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 109/213 (51%), Gaps = 21/213 (9%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   IG  D++F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 234 HKS--ERFTNLNFCSVEVHF---RYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
           ++     F+  +    E       YVK  Y    DG  +E   T+ I      N  + Y 
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHPTSAYVKAFY--EMDGKVVELMRTINI------NGDTTYK 118

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           I+ K  ++ +    L+++ I +  K FL+ QG+VE IA   A         L +  E+I 
Sbjct: 119 IDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLSKLFEEIS 171

Query: 349 GTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
           G+  YK   +    E+E + +   E   NR RI
Sbjct: 172 GSIQYKKEYDSLKDELEKLGKSTTESIRNRRRI 204

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  169 bits (429), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 185/744 (24%), Positives = 333/744 (44%), Gaps = 91/744 (12%)

Query: 717  DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKL-KRFDMSPIQT 774
            D+Y +A+ST   +  D ++V+S+   Q CI FL+K + G   F+ LD +       P+  
Sbjct: 540  DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPE 599

Query: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLID 833
             E      + V+ K+     A+Y V  DT++  +L  A  + + K    ++VTLDG LI+
Sbjct: 600  SETYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALIN 658

Query: 834  ISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMK-KLEMELAAREKQFDVASETFHSM 892
             +G M+GG       + + +       E  SL D+K KL +++       + A+++  S 
Sbjct: 659  KTGLMTGG-------ITSDSANRWDKDEYQSLLDLKDKLIVDVE------EAANKSRQST 705

Query: 893  EQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKXXXXXXXXX 952
                  L  RE    LEIS     + +LT +I   R+Q+T+     +++++         
Sbjct: 706  ------LIARE----LEIS-----LSSLTSEISYIRTQITQT----KRAVEETETEINHH 746

Query: 953  GNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAXX 1012
             NL  +++E      Q K    ++S L+DEI         LQ    + L +++       
Sbjct: 747  NNL--IDREF---IPQVKDLENKISGLEDEIRDWNTKREALQEKCFARLTEKVGFTMKDY 801

Query: 1013 XXXXXXXXXXNTELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQ 1072
                         ++K  K L             +     R    K+ L ++ ++  S+Q
Sbjct: 802  ESHTGEM------IRKQTKELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQ 855

Query: 1073 -------DEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENG 1125
                   D++ +++  +E    +L   NE   E K+I+   ++K + A++    + + N 
Sbjct: 856  HELNELVDQEKSIKLSIETLEGELDGKNE---ELKSIKAAFDSKQKDASATEDIISEYNN 912

Query: 1126 QLLE-ELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENM 1184
            +L   E +   ++D    LDL  E+     N Q +       S V          G+E +
Sbjct: 913  RLASIESDRNEIKDDITRLDL--EKMSILKNCQVSGIIVPVVSEV----------GLEEL 960

Query: 1185 NTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINN 1244
              S + +     + +I +D           +PR   +  S     +LN +I  +   +  
Sbjct: 961  PASKVDDEAIEIAKKIEIDF--------SKLPRKYKEATSAAVKQDLNNQIRDIDDVLEE 1012

Query: 1245 VSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMT 1304
            +  N   +E +      F +   +      E  ++     ++K+KR   F   F  I+  
Sbjct: 1013 LQPNARAVERFDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEH 1072

Query: 1305 LKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1355
            L  +Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEK
Sbjct: 1073 LDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEK 1132

Query: 1356 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNM 1414
            T+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N M
Sbjct: 1133 TVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTM 1192

Query: 1415 FELAKQLVGIYK--HENMTKNATI 1436
            FE +  LVG+++   EN +K  T+
Sbjct: 1193 FEKSDALVGVFRQQQENSSKIVTL 1216

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 168/355 (47%), Gaps = 57/355 (16%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G   +   D++F++++GPNGSGKSN++D++ FV G R++ +R
Sbjct: 1   MGRLV--GLELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLR 58

Query: 226 QDRLSDLIHK---SERFTNLNFCSVEVHFR--YVKDEYTAPTDGDTMEAENTLVITRKAF 280
              L DLI++   S   T     + E   R  YVK  Y    DG  +E      + R   
Sbjct: 59  SSALKDLIYRDIISRENTPTGADNDENGNRTAYVKAFY--EYDGKVVE------LMRLIS 110

Query: 281 KNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGL 340
           +   + Y ++G    + E ++ L+ Q I +  K FL+ QG+VE IA            GL
Sbjct: 111 RLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GL 163

Query: 341 LEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDE----KNSLEKDKDAAX 396
            + +E++ G+  YK   E+   + + + +   E   + R +  E    K  + +D+    
Sbjct: 164 TKLIEEVSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDE---- 219

Query: 397 XXXXXXXXXXXXXXXXTQYHLYVNNDK-IKTTLGQIDSLRTDFEQEKQRHSQFMKEVETL 455
                            +Y  YV   K ++T L    SL   +  E +R+ Q ++++E  
Sbjct: 220 -----------------EYRKYVQKKKRVQTNL----SLWQLYHMEDERY-QCLQKLEES 257

Query: 456 QNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVES 510
           QN +D  +  L +   EEK+L   K+ ++ ++V L +  KN  + + K K   ES
Sbjct: 258 QNDVDVIREKLEA---EEKNLEVFKKALSKEAVLLTK-KKNHIRSISKEKEKAES 308

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  169 bits (428), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 190/772 (24%), Positives = 355/772 (45%), Gaps = 120/772 (15%)

Query: 704  GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
            G  G + DL     ++Y +A+ST   +  D ++VE++   Q CI FL+K + G A F+ L
Sbjct: 531  GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 590

Query: 762  DKLKRFDMSPIQTPENVPRLFDL-VKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
            D ++  ++  +  P++   +  +     E  +  A+  V  D+++   LK A  + + K 
Sbjct: 591  DTIET-ELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKG 649

Query: 821  -RFRVVTLDGQLIDISGTM----SGGGS-----RVFKGLMNLTTKVSGTSEIFSLEDMKK 870
             R ++VT++G LI  +G M    SG  +       ++ LM+L  K+     +  ++++  
Sbjct: 650  VRAKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKL-----LVQIDELSN 704

Query: 871  LEMELAAREKQFDVASETFHSMEQELRKLCDR------EPQLELEISKKLIDIDALTQQI 924
             +   + R ++ + +    +S    LR    +      E  LE++        D L ++I
Sbjct: 705  SQRSNSIRAREVENSVSLLNSDIASLRTQVTQQKRSLDENNLEIKYHN-----DLLEKEI 759

Query: 925  QLTRSQLTEKSNDYEKSIKXXXXXXXXXGNLEALNQELKYLQ-DQSKTSSERVSFLKDEI 983
            Q   ++L +K +D E +                L +E + LQ D  K  + ++ F   E 
Sbjct: 760  QPKITELEKKLDDLENTKN-------------GLEKEKEILQNDIFKEFTSKIGFSIKEY 806

Query: 984  MRIGGSELQLQNSKVSSLNQRIDILQAXXXXXXXXXXXXNTELKKARKSLIAXXXXXXXX 1043
                G  ++ Q+ ++  L ++I  ++                 +KARK L          
Sbjct: 807  ENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLNTTQRRYEKARKDL---------- 856

Query: 1044 XXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHESNENVNEFK--- 1100
                   KA+ E++            S+++++  +E ++E+   KL E+  ++ E +   
Sbjct: 857  ------EKAQVEMS------------SLEEQEHAIEMKIESIGSKLEENKNHLVELEKKL 898

Query: 1101 -TIQLEL---ENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGTEANQ 1156
             T Q +L   E+ +E  NS L  LK+E   + E++    L  VT   +            
Sbjct: 899  VTKQSDLNSSEDILEDMNSNLQVLKRERDGIKEDVEKNDLEKVTALKNC----------- 947

Query: 1157 QPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCGDLVSQGIP 1216
                      SN++  +L  +   +++   SS  +     S+ I +D         +G+P
Sbjct: 948  --------KISNINLPIL--SQTTLDDFPISSRDSDAITISNSIVVDY--------KGLP 989

Query: 1217 RLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGER 1276
            +   +  S      L ++I +++  +N +  N   +E Y +    F+    +      E 
Sbjct: 990  KKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAEGRFEVINNETEQLKTEE 1049

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLD 1327
             ++ +   ++K+KR   F + F  +S  L  +Y+ +T          GGNA L + D  +
Sbjct: 1050 KKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDE 1109

Query: 1328 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1387
            PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  
Sbjct: 1110 PFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDIT 1169

Query: 1388 NVSIVANYI-KERTKNAQFIVISLRNNMFELAKQLVGIYK--HENMTKNATI 1436
            NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+   EN +K  T+
Sbjct: 1170 NVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1221

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 26/218 (11%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 234 HKS----------ERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNN 283
           ++              ++ +  S      YVK  Y     G+ M  E   +I+R    N 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQK---GNKM-VELMRIISR----NG 118

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
            + Y I+ K  ++ + +  L+ + I +  K FL+ QG+VE IA     A+   E  L   
Sbjct: 119 DTSYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA-----AQSPIE--LSRM 171

Query: 344 LEDIIGTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
            E++ G+  YK   ++   +IE +++   E  +NR RI
Sbjct: 172 FEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRI 209

 Score = 33.1 bits (74), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 13/100 (13%)

Query: 417 LYVNNDKIKTTLGQIDSLRTDFEQ--------EKQRHSQFMKEVETLQNSIDESKNNLTS 468
           L    D++ TT  + +  R D E+        E+Q H+  MK +E++ + ++E+KN+L  
Sbjct: 835 LQFETDRLNTTQRRYEKARKDLEKAQVEMSSLEEQEHAIEMK-IESIGSKLEENKNHLVE 893

Query: 469 LTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATV 508
           L   EK L+ ++ ++N+    LE+   NL Q LK+ +  +
Sbjct: 894 L---EKKLVTKQSDLNSSEDILEDMNSNL-QVLKRERDGI 929

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  155 bits (391), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 125/434 (28%), Positives = 219/434 (50%), Gaps = 54/434 (12%)

Query: 1025 ELKKARKSLIAXXXXXXXXXXXIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELEN 1084
            EL++ +K ++            ++  + R E A+  L +    ++S+++++  +E ++ +
Sbjct: 817  ELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGS 876

Query: 1085 FSDKLHESNENVNE----FKTIQLEL---ENKIERANSILSYLKKENGQLLEELNNFRLR 1137
               KL E   +++E    F T Q EL   E+ +E  NS L  LK+E   + E++  F L 
Sbjct: 877  IESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLE 936

Query: 1138 DVTHTLDLLREEEGTEAN---QQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVK 1194
             VT     L+  + +  N      TT  D   S+ DNE +             ++SNS+ 
Sbjct: 937  RVT----ALKNCKISNINIPISSETTIDDLPISSTDNEAI-------------TISNSI- 978

Query: 1195 VASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEE 1254
                          D+  +G+P+   +  +      L ++I++++  +N +  N   LE 
Sbjct: 979  --------------DINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALER 1024

Query: 1255 YAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT- 1313
            Y +    F+    +      E  ++ +   ++KKKR   F + F  +S  L  +Y+ +T 
Sbjct: 1025 YDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTK 1084

Query: 1314 --------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1365
                     GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA
Sbjct: 1085 NPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFA 1144

Query: 1366 LHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAKQLVGI 1424
            ++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+
Sbjct: 1145 INSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGV 1204

Query: 1425 YK--HENMTKNATI 1436
            Y+   EN +K  T+
Sbjct: 1205 YRQQQENSSKIITL 1218

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 90/161 (55%), Gaps = 17/161 (10%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 234 HK-------SERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLV-ITRKAFKNNSS 285
           ++       S+ + N    S      YVK  Y         +  N LV + R   +N  +
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYVKAFY---------QKGNKLVELMRIISRNGDT 117

Query: 286 KYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIA 326
            Y I+GK  ++ + +  L+ + I +  K FL+ QG+VE IA
Sbjct: 118 SYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA 158

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  143 bits (360), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 121/424 (28%), Positives = 213/424 (50%), Gaps = 72/424 (16%)

Query: 1065 NKSLESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKEN 1124
            NK L+ ++ + +N+E +L+ F  + +ES E     K  Q++LEN     NS +  L++  
Sbjct: 809  NKELQQLEKQVLNIESKLQ-FEVERYESTEK--RHKKAQIDLENN----NSTIESLQENE 861

Query: 1125 GQLLEELNNFR---------LRDVTHTLD------LLREEEGTEANQQPTTGTDETTS-- 1167
             +++ ++ +           L D +  +D       + E+  +E ++  TT T+E  S  
Sbjct: 862  AEVVAKIKDIENGMLEIKKVLEDFSKEIDRKKKKLAIAEDSLSEKSELLTTSTNEKISIK 921

Query: 1168 ----NVDNEMLG--------------AADAGVENMNTSSLSNSVKVASDEISMDVDDCGD 1209
                  D E LG              A+   + N+    + N   + S+EIS+D      
Sbjct: 922  EEIEKKDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKIDNDAILISNEISLDY----- 976

Query: 1210 LVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDL 1269
               + +P    +  S+     L  EI  ++  + ++  N   ++    R  E K+R    
Sbjct: 977  ---KTLPAKYKESSSSKIRSALEHEIEVVEDLLQDLQPNARAVD----RFDEAKERFDSA 1029

Query: 1270 NNSV-----GERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITM---------G 1315
            ++        ER  LT  +  +KKKR   F + F  +S  ++ +Y+ +T          G
Sbjct: 1030 SDETETLKKQERKLLTQFLA-IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSG 1088

Query: 1316 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1375
            GNA L L D  +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1089 GNASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFF 1148

Query: 1376 VMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFELAKQLVGIYK--HENMTK 1432
            ++DE+DAALD  N+  +ANYI++ +  + QFIVISL+N+MFE +  LVGI++   EN ++
Sbjct: 1149 ILDEVDAALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSR 1208

Query: 1433 NATI 1436
              T+
Sbjct: 1209 VVTL 1212

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 86/162 (53%), Gaps = 11/162 (6%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV GF+++ +R
Sbjct: 1   MGRLV--GLELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLR 58

Query: 226 QDRLSDLIHKSERFTNLN-FCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNS 284
              L DL+++     + N F        YVK  Y    DG  +E    +   R       
Sbjct: 59  SSTLKDLVYRDIASADENEFGEDGERSAYVKAFY--EKDGTVVELMRAITAGR------D 110

Query: 285 SKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIA 326
           S Y I+ K + +   +  L  + I +  + FL+ QG+VE IA
Sbjct: 111 SVYKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIA 152

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 92/187 (49%), Gaps = 29/187 (15%)

Query: 704 GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     ++Y +A+ST   +  D +VV+++   Q CI +L+K + G   F+ L
Sbjct: 522 GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPL 581

Query: 762 DKLKRFDMS-PIQTPENVPRLFDLVKPKEKRFAPAIY----SVLRDTL-VAKDLKQANRV 815
           D +  F  + P    + +  + + +   ++      Y    S++ DTL +AK LK  + V
Sbjct: 582 DTIDAFVPTLPTTNIQGITLVLNAIDYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNV 641

Query: 816 AYGKRRFRVVTLDGQLIDISGTMSGG-----GSRV----FKGLMNLTTK-------VSGT 859
                  ++VTL+G LI  +G M+GG     G+R     ++GL+ L  K       +S  
Sbjct: 642 TS-----KLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQGLVTLKDKLLIQIEQLSNN 696

Query: 860 SEIFSLE 866
           S+ F++E
Sbjct: 697 SKTFAIE 703

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 108/167 (64%), Gaps = 11/167 (6%)

Query: 1286 LKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1336
            +K+ R   F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1056 IKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYH 1115

Query: 1337 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI
Sbjct: 1116 ATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYI 1175

Query: 1397 KERT-KNAQFIVISLRNNMFELAKQLVGIYK-HENMTKNATIRNRED 1441
            + +   + QFIVISL+N MFE ++ LVG+++  +N T  A   N E+
Sbjct: 1176 RRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTLNLEN 1222

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 125/224 (55%), Gaps = 24/224 (10%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G+ +IG  D++F++++GPNGSGKSN++D++ FV G ++  +R
Sbjct: 1   MGRLI--GLELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLR 58

Query: 226 QDRLSDLIHKS----ERFTNLNFCSVEVH--FRYVKDEYTAPTDGDTMEAENTLVITRKA 279
              L+DLI++     E  ++ +F S E H    YVK  Y+   + D     + + ++R  
Sbjct: 59  SHLLADLIYRGTLSEEEASSADFES-ENHPNSAYVKAFYSPSNNED-----DVVELSRTV 112

Query: 280 FKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDG 339
            ++  S Y I+GK   + + ++ L+ + I +  + FL+ QG+VE +A     A+K  E  
Sbjct: 113 TRSQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVA-----AQKPQE-- 165

Query: 340 LLEYLEDIIGTKHYKPLIEQKTVEIE-AMNEL--CIEKENRFRI 380
           L +  E + G+  YK   ++   E+E A +E   CI+   R  I
Sbjct: 166 LTDLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1286 LKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1336
            +++ R + F   F  +S  + ++Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1059 IRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYH 1118

Query: 1337 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYI 1178

Query: 1397 KERT-KNAQFIVISLRNNMFELAKQLVGIYKHE 1428
            ++R   N QFIVISL+N MFE ++ LVG+++ +
Sbjct: 1179 RQRALSNLQFIVISLKNTMFEKSQALVGVFRQQ 1211

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 100/191 (52%), Gaps = 28/191 (14%)

Query: 176 LHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 235
           L+NFKSY G+ +IG  +++F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 236 ------------SERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNN 283
                       SE   N N  S      YVK  Y+ P+  +   AE T  IT     + 
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSA----YVKAFYS-PSGQENDVAELTRTITL----SQ 119

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
            S Y +NG+  +  +    L+ + I +  + FL+ QG+VE +A  K +        L   
Sbjct: 120 ESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTL 172

Query: 344 LEDIIGTKHYK 354
            E + G+  YK
Sbjct: 173 FEQVSGSIQYK 183

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 100/155 (64%), Gaps = 10/155 (6%)

Query: 1286 LKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1336
            +K+KR + F E F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1337 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1397 KER-TKNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
            +     + QFIVISL+N MFE +  LVG+Y+ + +
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQEL 1207

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L LHNFKSY G   +G  D++F++++GPNGSGKSN++D++ FV G R+  +R
Sbjct: 1   MGRLL--GLELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLR 58

Query: 226 QDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSS 285
            + L DLI++            +V    V +  TA       + ++T+ ++R   K   +
Sbjct: 59  SNVLKDLIYRGVASEEEGDGESDV----VNNPTTAYVKAFYSKGDSTIELSRSISKGGDT 114

Query: 286 KYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLE 345
            Y +NGK  ++      L+++ I +  K FL+ QG+V  IA   A         L ++ E
Sbjct: 115 TYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFE 167

Query: 346 DIIGTKHYK 354
           +  G+  YK
Sbjct: 168 EFSGSIQYK 176

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 86/169 (50%), Gaps = 20/169 (11%)

Query: 704 GFHGRLGDLG-IIADQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     ++Y +A+ST   R  D ++V+++   Q CI +L+K + G A F+ L
Sbjct: 525 GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 762 DKLKRFDMSPIQTPENVPRLFDL----VKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAY 817
           D ++  + S +   E+   +  +      P+ +R   A+  V  D+++   L+ A  + +
Sbjct: 585 DTIE-VETSTLPASESSGCILAINAIEYDPEYER---AMRYVCSDSIICNTLEIARDMKW 640

Query: 818 GKR-RFRVVTLDGQLIDISGTMSGGGSR---------VFKGLMNLTTKV 856
            +  R ++VTL+G LI  +G M+GG S+          ++ LM L  K+
Sbjct: 641 KRNVRSKLVTLEGTLIHRAGLMTGGISKDSSNRWDKEEYQSLMTLKDKI 689

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  130 bits (328), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 99/154 (64%), Gaps = 10/154 (6%)

Query: 1285 ELKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1335
            E+K KR   F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ +
Sbjct: 1072 EVKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKY 1131

Query: 1336 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1395
               PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+Y
Sbjct: 1132 FATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHY 1191

Query: 1396 IKERTK-NAQFIVISLRNNMFELAKQLVGIYKHE 1428
            IK     NAQFIVISL+N MFE ++ LVGI++ +
Sbjct: 1192 IKRNANPNAQFIVISLKNAMFEKSQSLVGIFREQ 1225

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 96/200 (48%), Gaps = 28/200 (14%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L LHNFKSY     +G  ++ F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 234 HKSERFTNL---NFCSVEVHFRYVKDEYTAPTDGDTMEAE----------------NTLV 274
           ++  R  N    N  +  +H R   D    P +    E E                    
Sbjct: 67  YRG-RIENGDPDNGNAKRMH-RSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTK 124

Query: 275 ITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEK 334
            TR    +  S Y IN +  ++ +  + L+ + I +  K FL+ QG+VE IA        
Sbjct: 125 FTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQ------ 178

Query: 335 DNEDGLLEYLEDIIGTKHYK 354
              + L   LE + G+ +YK
Sbjct: 179 -GPESLTLLLEQVSGSINYK 197

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 101/156 (64%), Gaps = 12/156 (7%)

Query: 1286 LKKKRYNEFMEGFSIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1336
            +K+KR N F+  F+ +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1337 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1397 KER-TKNAQFIVISLRNNMFELAKQLVGIYK--HEN 1429
            +   +   QFIVISL++N+F  ++ + G+++  HEN
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHEN 1206

 Score = 89.0 bits (219), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 83/166 (50%), Gaps = 15/166 (9%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L + NFKSY G   +G    +F ++VGPNGSGKSN++D++ FV G R++ +R
Sbjct: 1   MGRLI--GLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLR 58

Query: 226 QDRLSDLIHKSE-----RFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAF 280
              L DLI++            N  S  V   YVK         D   AE  +  TR   
Sbjct: 59  SSALVDLIYRGRMEEGGSAHENNPKSAYVTAFYVKQ--------DASGAERRMEFTRVIH 110

Query: 281 KNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIA 326
               S Y ++GK   + E   +L+ + I +  + FL+ QG+VE IA
Sbjct: 111 NTGDSTYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIA 156

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 8/130 (6%)

Query: 717 DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTP 775
           ++Y V +ST   +  D ++V+S+   Q CI +L+K++ G A F+ LD +   D S    P
Sbjct: 538 EKYAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTI---DTSSPTLP 594

Query: 776 --ENVPRLFDL-VKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQL 831
             +N   +  L     E     A+  V  D+++   L  A  + + +  + ++VTL+G L
Sbjct: 595 AGDNTGCILTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGAL 654

Query: 832 IDISGTMSGG 841
           I  +G M+GG
Sbjct: 655 IHRAGLMTGG 664

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 121/223 (54%), Gaps = 19/223 (8%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G   +G  D++F++++GPNGSGKSN++D++ FV G R++ +R
Sbjct: 1   MGRL--SGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLR 58

Query: 226 QDRLSDLIHKSERFTNLNFCSVE---VHFRYVKDEYTAPT----DGDTMEAENTLVITRK 278
            + + DLI++     N N  + E   V   YVK  Y   T    D D  + E  + + R 
Sbjct: 59  SNIVKDLIYRG--VINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERPVELMRA 116

Query: 279 AFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNED 338
              N  + Y INGK   + E ++ L+ + I +  K FL+ QG+VE IA   +++  D   
Sbjct: 117 ISTNGDTTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIA---SQSPMD--- 170

Query: 339 GLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
            L +  E++ G+  YK   ++   +IE +N+   E   NR RI
Sbjct: 171 -LSKLFEEVSGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRI 212

 Score = 62.4 bits (150), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 76/152 (50%), Gaps = 19/152 (12%)

Query: 704 GFHGRLGDLG-IIADQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     D+Y +A+ST   +  D ++V+++   Q CI F +K + G A F+ L
Sbjct: 534 GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 762 DKLKRFDMSPIQTPENVPRLFDLV--------KPKEKRFAPAIYSVLRDTLVAKDLKQAN 813
           D +     S  Q   N+P   D +         P+ +R   A+  V  D+++   L  A 
Sbjct: 594 DTI-----SSEQPTLNLPSSQDYILTINAIEYDPEYER---AMQYVCSDSIICNSLDIAR 645

Query: 814 RVAYGKR-RFRVVTLDGQLIDISGTMSGGGSR 844
            + + K  R ++VT++G LI  +G M+GG S+
Sbjct: 646 DLKWNKGVRSKLVTIEGALIHKAGLMTGGISK 677

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 117/216 (54%), Gaps = 19/216 (8%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G   +G  D++F +++GPNGSGKSN++D++ FV G +++ +R
Sbjct: 1   MGRLV--GLELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLR 58

Query: 226 QDRLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSS 285
              L DLI++       +    E    YVK  Y        +++++T+ ++R   +N  +
Sbjct: 59  SQILKDLIYRGVE-GEEDEEDGEGRTAYVKAFY--------LKSDSTVELSRSISRNGDT 109

Query: 286 KYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLE 345
           +Y +NGK   + +  + L+E+ I +  + FL+ QG+V  IA   A         L +  E
Sbjct: 110 QYKMNGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSAT-------DLTKLFE 162

Query: 346 DIIGTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
           +I G+  YK   +    +++++N+   E  +NR RI
Sbjct: 163 EISGSIQYKKEYDSLKGKVDSLNQSAAESIKNRRRI 198

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (50%), Gaps = 11/148 (7%)

Query: 704 GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     D+Y +AIST   +  D ++V++V   Q CI +L+K + G A F+ L
Sbjct: 520 GVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIASFIPL 579

Query: 762 D----KLKRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAY 817
           D    ++    +S  Q         D     E+ +  A+  V  D+++  D+  A  + +
Sbjct: 580 DTIDVEIPTLTLSDSQGCTLAINAIDY----EQEYERALQYVCSDSIICDDMNIAKDLKW 635

Query: 818 GKR-RFRVVTLDGQLIDISGTMSGGGSR 844
            K  R ++VTL+G LI  +G M+GG S+
Sbjct: 636 NKGVRSKLVTLEGALIHKAGLMTGGISK 663

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 98.6 bits (244), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 100/186 (53%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + I +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  A   +R  
Sbjct: 1   MKIEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV V F    D+  +P  G T  A+  + +TR+     SSKY
Sbjct: 61  SLQDLIYKRGQ-AGVTKASVTVVFDN-SDKSNSPI-GFTNSAK--ISVTRQVMLGGSSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V +L +   +++++  FLI+QG++  +  MK K        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1330 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1389
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1390 SIVANYIKERTKNAQFIVISLRNNMF 1415
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 22/154 (14%)

Query: 702 INGFHGRLGDLGIIADQYDVAIS---TACPRLDDMVVESVECGQTCIEFLRKNKLGYARF 758
           + G   +L  L    D YD A +    A  RL ++VV++    +T  + L K +L   + 
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDN---ERTASQLLEKGRL--RKR 575

Query: 759 VVLDKLKRFDMSPIQT----------PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKD 808
           V +  L R     + +          P  V    +LV  +E+  + A+  +  ++L+ KD
Sbjct: 576 VTIIPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEE-VSRAMEFIFGNSLICKD 634

Query: 809 LKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGG 841
            + A ++ +  + R R +TL G + D  GT+SGG
Sbjct: 635 AETAKKITFHPQIRTRSITLQGDVYDPEGTLSGG 668

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 95/181 (52%), Gaps = 15/181 (8%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L NFKSY G   IG  D++F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 234 HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKE 293
           H+S R +     + +    YVK  Y      +  E      + R    +  + Y INGK 
Sbjct: 67  HRSVRDS--QSSNDDPTSAYVKAFYKVTDASEITE------LMRIVNLSGETIYKINGKT 118

Query: 294 SNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHY 353
           ++F   +  L ++ I +  K FL+ QG+VE IA   +         L +  E + G+  Y
Sbjct: 119 TSFKNYSDWLAKENILIKAKNFLVFQGDVETIASQSSLE-------LTKLFEQVSGSIQY 171

Query: 354 K 354
           K
Sbjct: 172 K 172

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 99/212 (46%), Gaps = 23/212 (10%)

Query: 704 GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     D+Y +AI T   +  + ++V+S+   Q CI +L+K + G   F+ L
Sbjct: 522 GVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPL 581

Query: 762 DKLKRFDMSPIQTPENVPRLFD-----------LVKPKEKRFAPAIY--SVLRDTL-VAK 807
           D ++    S     +N P+  +             +P+ +R    I   S++ D L +AK
Sbjct: 582 DTIEAQIPSLPTIIQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDIAK 641

Query: 808 DLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLED 867
           DLK    V    +  + VTLDG +I  S  M+GG S+      N   K    S + +L+D
Sbjct: 642 DLKWNQNV----KNVKFVTLDGSIIHKSNLMTGGASKNSMQSNNRWDK-DEYSSLMTLKD 696

Query: 868 MKKLEMELAAREKQFDVASETFHSMEQELRKL 899
              LE+E  ++E +  +AS     +E E+  L
Sbjct: 697 NLILEIETISKENK--LASINSRELETEISLL 726

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
           YFL008W
          Length = 1226

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 101/193 (52%), Gaps = 19/193 (9%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R++ +R
Sbjct: 1   MGRLL--GLELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLR 58

Query: 226 QDRLSDLIHKS----ERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFK 281
              ++DLI++     E          + H  YV   Y+      T+E + T+       K
Sbjct: 59  SSAVADLIYRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVELKRTIS------K 112

Query: 282 NNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLL 341
           N  S Y I+ ++  + + ++ L+ Q I +  K FL+ QG+VE +A             L 
Sbjct: 113 NGDSTYQIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LT 165

Query: 342 EYLEDIIGTKHYK 354
           +  E++ G+  YK
Sbjct: 166 KLFEEVSGSAQYK 178

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 18/168 (10%)

Query: 704 GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     D+Y V+++T   +  D ++V+S+   Q CI +L+K + G   F+ L
Sbjct: 528 GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 762 DKLKRFDMSPIQTPENVPRLFDLVK---PKEKRFAPAIYSVLRDTLVAKDLKQANRVAYG 818
           D +   D +    P    + + L K     E ++  AI  V  D ++   L  A ++ + 
Sbjct: 588 DTV---DSAVATLPSVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKWD 644

Query: 819 KR-RFRVVTLDGQLIDISGTMSGGGSR---------VFKGLMNLTTKV 856
              + +++ LDG LI  +G M+GG S+          ++ LM L  K+
Sbjct: 645 HGFKNKLIALDGSLIHRAGLMTGGISKDGNNRWDKEEYQSLMTLKDKI 692

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 117/218 (53%), Gaps = 31/218 (14%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L+NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 234 HK---------SERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAEN-TLVITRKAFKNN 283
           ++         S+   ++N  S      YVK  Y         E EN T+ + R   +N 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTA----YVKAFY---------EKENKTIELMRTISRNG 113

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
            + Y I GK  ++ + +  L+ + I +  K FL+ QG+VE IA   +++  D    L   
Sbjct: 114 DTNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIA---SQSPMD----LSRL 166

Query: 344 LEDIIGTKHYKPLIEQKTVEIEAMNELCIEK-ENRFRI 380
            E++ G+  YK   +Q   ++E +++   E  +NR RI
Sbjct: 167 FEEVSGSIQYKKEYDQLKEKMEQLSKAATESIKNRRRI 204

 Score = 62.4 bits (150), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 76/153 (49%), Gaps = 15/153 (9%)

Query: 717 DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTP 775
           D+Y +A+ST   R  D ++V++    Q CI +L+K + G A F+ L+ +      P  + 
Sbjct: 540 DKYSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETID--SEIPTLSV 597

Query: 776 ENVPRLFDLVKPKE--KRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLI 832
            N       +   E   R+  A+  V  DT++   L  A R+ + +  + ++VTL+G LI
Sbjct: 598 SNSQGCILAINAIEYDPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALI 657

Query: 833 DISGTMSGGGSR---------VFKGLMNLTTKV 856
             +G M+GG S+          ++ LMNL  K+
Sbjct: 658 HKAGLMTGGVSKDSNNRWDKEEYQSLMNLKDKL 690

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 96/184 (52%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  AP      E+  T+ +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-SDKSNAPIG---FESSPTISVTRQVALGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 18/165 (10%)

Query: 698 QSGRINGFHGRLGDLGIIADQYDVAIS---TACPRLDDMVVESVECGQTCIEFLRKNKL- 753
           Q   + G   RL  L    + Y  A +    A  RL ++VV++    +T  + L++ +L 
Sbjct: 519 QEQSVKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDN---EKTASQLLQRGRLR 573

Query: 754 GYARFVVLDKL-------KRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVA 806
                + L+K+       K  +++   +P NV    +L+  +E   A A+  +   +L+ 
Sbjct: 574 KRVTIIPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLIC 632

Query: 807 KDLKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGGGSRVFKGLM 850
           KD + A +V +  + R R +TL G + D  GT+SGG   +   L+
Sbjct: 633 KDAETAKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           I +L++  FKSYA    I  +D  F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F  + D   +P      E    L +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL-DPKCSPIG---FENSPKLSVTRQIILGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 96/184 (52%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  AP      E   T+ +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDN-SDKSKAPIG---FETSLTISVTRQIVLGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 1342 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1400
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1401 KNAQFIVISLRNNMF 1415
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 789 EKRFAPAIYSVLRDTLVAKDLKQANRVAYG-KRRFRVVTLDGQLIDISGTMSGG 841
           E   A A+  +   +L+  D + A ++ +  K R R +TLDG + D  GT+SGG
Sbjct: 615 EDEVAKALQFIFGSSLICNDAETAKKITFNPKIRTRSITLDGDVYDPEGTLSGG 668

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 97/186 (52%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D  ++P   +T      + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQAGVIK-ASVTIVFDN-SDPSSSPFGFETYP---KISVTRQIILGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V  L +   +++++  FLI+QG++  +  MK        D +L  +E+ 
Sbjct: 116 LINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEA 168

Query: 348 IGTKHY 353
            GT+ +
Sbjct: 169 AGTRMF 174

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 789 EKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGG 841
           E   A A+  +   +L+ +D   A +V +  + R R +TLDG + D  GT+SGG
Sbjct: 615 EAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEGTLSGG 668

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 99/186 (53%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+  +P  G    A+  + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGITKASVTIVFDNT-DKTNSPI-GFNNSAK--ISVTRQVVLGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V +L +   +++++  FLI+QG++  +  MK K        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1138 SQFIVVSLKEGMF 1150

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 97/186 (52%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+  +P      E+   + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTIVFAN-SDKNNSPIG---FESYPKISVTRQIVLGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 774 TPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYG-KRRFRVVTLDGQLI 832
            P++V    +L+   E   A A+  +   +L+ +D + A +V +  K R R +TL G + 
Sbjct: 601 APDSVELALNLI-GYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIY 659

Query: 833 DISGTMSGG 841
           D  GT+SGG
Sbjct: 660 DPEGTLSGG 668

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 97/186 (52%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+ ++P      E+   + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTIVFDNT-DKSSSPIG---FESYPKISVTRQIILGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GT+ +
Sbjct: 169 AGTRMF 174

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 81/155 (52%), Gaps = 15/155 (9%)

Query: 775 PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLID 833
           P NV    +L+   E   + A+  +   +L+ KD + A RV +  + R R +TLDG + D
Sbjct: 602 PGNVELALNLI-GYEDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYD 660

Query: 834 ISGTMSGGGSRVFKG--LMNLTTKVSGTSEIFSLE-DMKKLEMELAAREKQFDVASETFH 890
             GT+S GGSR  K   L+++ T  + +  +  +E ++K++  ++A    +++  S+   
Sbjct: 661 PEGTLS-GGSRNTKNSLLIDIQTFNAASKRLNEMELELKQINSKIA----EYEQTSQKTK 715

Query: 891 SMEQELRKLCDREPQLELEISKKLIDIDALTQQIQ 925
           S++ EL     +     L ++KK +  ++ TQ I+
Sbjct: 716 SLQNELNLATHK-----LSLAKKSLAANSATQIIR 745

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 96/186 (51%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+  +P      E+   + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTIVFTN-DDKANSPIG---FESYPKISVTRQIVLGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 774 TPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLI 832
            P NV    +L+  +E+  + A+  +   +L+ +D + A +V +  R R R +TL G + 
Sbjct: 601 APGNVELALNLIGYEEE-VSKAMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIY 659

Query: 833 DISGTM 838
           D  GT+
Sbjct: 660 DPEGTL 665

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 97/184 (52%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  +P   +T      + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPIGFNTSPR---ISVTRQIVIGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V +L +   +++++  FLI+QG++  +  MK+         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1403 AQFIVISLRNNMF 1415
            AQFIV+SL+  MF
Sbjct: 1141 AQFIVVSLKEGMF 1153

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 792 FAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGGG 842
            + A+  +   +L+ KD + A +V + +  R R +TL+G + D  GT+SGG 
Sbjct: 622 LSRAMEFIFGTSLICKDSETAKKVTFHQNIRQRSITLEGDVYDPEGTLSGGS 673

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 84/154 (54%), Gaps = 5/154 (3%)

Query: 174 LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233
           L L+NFKSY G   +G  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 234 HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNS-SKYFINGK 292
           ++       +         YVK  Y    +G+    + T +   +  +N   S Y I+GK
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFYLKDDNGE----QGTKIEFMRIIQNTGDSVYRIDGK 122

Query: 293 ESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIA 326
             +F    + L+ + I +  + FL+ QG+VE IA
Sbjct: 123 TVSFKRYVEYLEGESILVKARNFLVFQGDVEQIA 156

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 77/156 (49%), Gaps = 17/156 (10%)

Query: 717 DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDM-SPIQT 774
           D+Y +A+S+   +  D +VV+SV   Q CI +L+K++ G A F+ LD +   D+ +P   
Sbjct: 538 DKYALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI---DINTPTLP 594

Query: 775 PENVPRLFDLVKPKE--KRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQL 831
             N+      V   E       A+  V  D+++   L  A  + + +  + ++VT+ G L
Sbjct: 595 VRNLKGCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGAL 654

Query: 832 IDISGTMSGGGSR---------VFKGLMNLTTKVSG 858
           I  +G M+GG  R          ++ L+ L  KVSG
Sbjct: 655 IHRAGLMTGGVGRNNTNRWDKAEYQSLLLLKEKVSG 690

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.0 bits (227), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 98/186 (52%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + I +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKIEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV V F    D   +P  G T   +  + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTVVFDN-SDRDNSPI-GFTNSPK--ISVTRQVVLGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 33.5 bits (75), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 793 APAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGGGSRVFKGLM 850
           + A+  +  + LV KD   A +V +    R R +T  G + D  GT+SGG     + L+
Sbjct: 619 SKAMEFIFGNGLVCKDADTAKKVTFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 98/184 (53%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  +P  G T   +  + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNT-DKLNSPI-GFTNSPQ--ISVTRQVVLGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 74/159 (46%), Gaps = 14/159 (8%)

Query: 702 INGFHGRLGDLGIIADQYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKL-GYARFV 759
           ++G  G+L  L     +Y  A+ T A  RL ++VV+     QT  + L + +L      +
Sbjct: 523 VHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQD---SQTATQLLERGRLRKRVTII 579

Query: 760 VLDKLKRFDMSP-------IQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQA 812
            LDK+    ++P          P  V    +L+K  +K    A+  +  ++L+ +D + A
Sbjct: 580 PLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DKTVTKAMEFIFGNSLICEDPETA 638

Query: 813 NRVAYG-KRRFRVVTLDGQLIDISGTMSGGGSRVFKGLM 850
            ++ +  K R R +TL G + D  GT+SGG       L+
Sbjct: 639 KKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLL 677

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 99/186 (53%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +  + R  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+  +P   +     + + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTIVFDN-SDKTNSPIGFNN---SSKISVTRQIILGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V +L +   +++++  FLI+QG++  +  MK      NE  +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-----NE--ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 14/136 (10%)

Query: 717 DQYDVAIS---TACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKL-------KR 766
           D +D A +    A  RL ++VV++ +     +E  R  K      + L+K+       + 
Sbjct: 536 DHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNART 593

Query: 767 FDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVV 825
             M+    P  V    +L+   ++  + A+  +   +LV +D   A +V +  + R R +
Sbjct: 594 LQMAKDIAPGKVELALNLIGYDDE-VSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSI 652

Query: 826 TLDGQLIDISGTMSGG 841
           TLDG + D  GT+SGG
Sbjct: 653 TLDGDVYDPEGTLSGG 668

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 101/187 (54%), Gaps = 15/187 (8%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +DA F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTD-GDTMEAENTLVITRKAFKNNSSK 286
            + DLI+K  +   +   SV + F    D+  +P    D+++    + +TR+     +SK
Sbjct: 61  NMQDLIYKRGQ-AGVTKASVTIVFDN-SDKSNSPIGFNDSLK----ISVTRQIVLGGTSK 114

Query: 287 YFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLED 346
           Y ING  +    V +L +   +++++  FLI+QG++  +  M+          +L  +E+
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEE 167

Query: 347 IIGTKHY 353
             GTK +
Sbjct: 168 AAGTKMF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 13/126 (10%)

Query: 725 TACPRLDDMVVESVECGQTCIEFLRKNKL-GYARFVVLDKLKR-------FDMSPIQTPE 776
            A  RL ++VV++     T  + L + +L   A  + L+K+          +M+    P 
Sbjct: 547 CAGGRLFNVVVDN---ENTAAQLLERGRLRKRATIIPLNKIAARTLNDNIVNMAKSVAPG 603

Query: 777 NVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYG-KRRFRVVTLDGQLIDIS 835
            V    +L+  +E+    A+  +   +LV KD + A  V +  K R R +TLDG + D  
Sbjct: 604 RVELALNLIGYEEE-VRRAMEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPE 662

Query: 836 GTMSGG 841
           GT+SGG
Sbjct: 663 GTLSGG 668

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 98/184 (53%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  +P  G T   +  + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPI-GFTNSPQ--ISVTRQVVLGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 75/158 (47%), Gaps = 17/158 (10%)

Query: 706 HGRLGDLGIIAD---QYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKL-GYARFVV 760
           HG +G L  I +   +Y  A+ T A  RL ++VV+     QT  + L + +L      + 
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQD---SQTATQLLERGRLRKRVTIIP 580

Query: 761 LDKL-------KRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQAN 813
           LDK+       +  D++    P  V    +L++  E     A+  +  ++L+ +D + A 
Sbjct: 581 LDKIYTRPISSQVLDLAKKIAPGKVELAINLIRFDES-ITKAMEFIFGNSLICEDPETAK 639

Query: 814 RVAYG-KRRFRVVTLDGQLIDISGTMSGGGSRVFKGLM 850
           ++ +  K R R +TL G + D  GT+SGG     + L+
Sbjct: 640 KITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLL 677

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 95/184 (51%), Gaps = 13/184 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 229
           + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFI 289
            DLI+K  +   +   SV + F    D+  +P           + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPIG---FANSPQISVTRQVVLGGTSKYLI 117

Query: 290 NGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIG 349
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 350 TKHY 353
           TK +
Sbjct: 171 TKMF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D+   P           + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQ-AGVTKASVTIVFDNT-DKSNTPIG---FSEYPKISVTRQIVLGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V +L +   +++++  FLI+QG++  I  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GTK +
Sbjct: 169 AGTKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 68/151 (45%), Gaps = 15/151 (9%)

Query: 703 NGFHGRLGDLGIIADQ---YDVAIS-TACPRLDDMVVESVECGQTCIEFLRKNKLGYARF 758
           N   G   +L  I +Q   Y + +   A  RL +++V++ + G   ++  R  K      
Sbjct: 521 NSVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTI 578

Query: 759 VVLDKL-------KRFDMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQ 811
           + LDK+        +  ++    P  V    +L+   ++    A+  +  ++L+  D + 
Sbjct: 579 IPLDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDE-VVKAMEFIFGNSLICDDAET 637

Query: 812 ANRVAYGKR-RFRVVTLDGQLIDISGTMSGG 841
           A ++ +    R R +TL+G + D  GT+SGG
Sbjct: 638 AKKITFNPGIRTRSITLEGDIYDPEGTLSGG 668

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 95/186 (51%), Gaps = 13/186 (6%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           + + +L++  FKSYA    I  +D  F+A+ G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MRVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
            L DLI+K  +   +   SV + F    D  ++P      E    + +TR+     +SKY
Sbjct: 61  NLQDLIYKRGQAGVIK-ASVTIVFDN-SDIKSSPIG---FERYPKISVTRQIALGGTSKY 115

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 348 IGTKHY 353
            GT+ +
Sbjct: 169 AGTRMF 174

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 789 EKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-RFRVVTLDGQLIDISGTMSGGGS 843
           E+  + A+  +   +L+  D + A ++ +  + R R +TLDG + D  GT+SGG S
Sbjct: 615 EEDVSKAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSS 670

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 40/276 (14%)

Query: 1198 DEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVS-INIEILEEYA 1256
            DE+ + + + G L  + + R  +     ++T+ +  ++N +   I+ +S IN   +E + 
Sbjct: 969  DEVQLRISEIGLLSEESLERHQN-----LETERILRKLNTVNDKISKMSNINRRAIENFK 1023

Query: 1257 KRLVEFKKRKIDLNNSVGERNQ----LTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMI 1312
            K    F  ++ DL +   E  Q    +  ++E LKK++       FS ++     +++ +
Sbjct: 1024 K----FNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKL 1079

Query: 1313 TMGGNAELEL------------------------VDSLDPFSEGVTFSVMPPKKSWRN-- 1346
               G   L +                         D+LD    GV+ SV    K+     
Sbjct: 1080 VPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLY 1139

Query: 1347 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1406
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +AQFI
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFI 1199

Query: 1407 VISLRNNMFELAKQLVGIYKHENMTKNATIRNREDL 1442
              + R +M ++A     +     +++ AT+  +E +
Sbjct: 1200 CTTFRTDMLQVADSFYRVKFENKISEIATVSKQEAI 1235

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 112/235 (47%), Gaps = 30/235 (12%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI  +++  FK+Y     +  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEA-----ENTLVITRKAFKNN 283
              LIH+          +  +   YV+  +  P+D   M +     E  +V  R+     
Sbjct: 85  RQGLIHQG---------TGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLK 135

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
             +Y +NGK  + ++++++ +  G    +   ++ QG +  +A   A   KD E  LL  
Sbjct: 136 KDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRI--VAVTNA---KDKERLLL-- 188

Query: 344 LEDIIGTKHYKPLIEQKTVEIEAMN--------ELCIEKENRFRIVDDEKNSLEK 390
           LED++G + ++  + + + ++EA N        EL  E + R   +D+E+  LEK
Sbjct: 189 LEDVVGARSFEIKLRESSKKMEATNRDRAKITSELS-ELKARLEELDEERQELEK 242

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 704 GFHGRLGDLGIIADQYD-VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLD 762
             HG LG+L  + ++Y   A +     L  +VV++ E     +  L   K G   F+ L+
Sbjct: 558 AVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLN 617

Query: 763 KLKRFDMSPIQTPENV-----PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAY 817
           ++   D + +  PEN      P L+ +    +K F  A+  V   T+V +DL   +++A 
Sbjct: 618 RIS--DRNAVTFPENAQAECTPLLWKI--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLAR 673

Query: 818 GKRRFRVVTLDGQLIDISGTMSGG 841
                  VTLDG   D  G ++GG
Sbjct: 674 SYN-LDAVTLDGDRADNRGVITGG 696

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
           complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score = 88.6 bits (218), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 92/164 (56%), Gaps = 13/164 (7%)

Query: 166 MNRLYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMR 225
           M RL    L L+NFKSY G   +G  +++F++++GPNGSGKSN++D++ FV G +++ +R
Sbjct: 1   MGRLL--GLELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLR 58

Query: 226 QDRLSDLIHK---SERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKN 282
            + L DLI++   S    + N   V  +  YVK  Y         + + T  + R    +
Sbjct: 59  SNVLKDLIYRGFLSGDDEDNNNEDVNPNSAYVKAFY--------QKEDVTHELMRSISNS 110

Query: 283 NSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIA 326
             S Y IN K  ++ + T  L+++ I +  K FL+ QG+VE IA
Sbjct: 111 GDSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 134/261 (51%), Gaps = 41/261 (15%)

Query: 1198 DEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINN-VSINIEILEEYA 1256
            DE+   + + G L    +      + +++ +++L E++N+  S I+  V++N    E + 
Sbjct: 953  DELQQKIREIGLLAEDAL-----NDFNSLSSEDLLEKLNEANSEISKLVNVNKRAFENFR 1007

Query: 1257 K------RLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQ 1310
            +       LVE + R+++L+     +  +  ++E+LK+++ N   + F  +S    ++++
Sbjct: 1008 RFGEKQTELVE-RSRELELS-----KISIQELIEKLKEQKINAVDKTFRKVSENFVKVFE 1061

Query: 1311 MITMGGNAELEL----------------VDSLD----PFSEGVTFSVMPPKKS--WRNIT 1348
             +   G  +L +                 + +D    P   GV+ SV    K+    ++ 
Sbjct: 1062 TLVPRGTGKLVIHRTNQENSATPDLEDETNDMDIDAQPMYTGVSISVSFNSKNDEQLHVE 1121

Query: 1349 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1408
             LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN +KE +KNAQFI  
Sbjct: 1122 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANTLKELSKNAQFICT 1181

Query: 1409 SLRNNMFELAKQLVGIYKHEN 1429
            + R +M ++A +   + K+EN
Sbjct: 1182 TFRTDMLQVADKFFRV-KYEN 1201

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 93/186 (50%), Gaps = 8/186 (4%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++++  FK+Y  E  I  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHK-SERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKY 287
              LIH+ +   +++  CSVE+ F    +     ++   +   N  V  R+        Y
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNEVFIRRTVGLKKDDY 120

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            IN +    +++ ++L+  G  + +   ++ QG++  IA   A   KD E   L+ LED+
Sbjct: 121 QINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKI--IALTNA---KDKER--LQLLEDV 173

Query: 348 IGTKHY 353
           +G K +
Sbjct: 174 VGAKSF 179

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 707 GRLGDLGIIADQYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G +G+L   +++Y   +      +L  ++V++ E     ++ L + K G   F+ L+K+ 
Sbjct: 543 GTVGELIKASEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI- 601

Query: 766 RFDMSPIQTP--ENVPRLFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRR 821
            ++   I  P  +       L+K    E +F  A+  +   T+V KDL    ++A  K +
Sbjct: 602 -YNDPNITYPPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFK 659

Query: 822 FRVVTLDGQLIDISGTMSGG 841
              +TLDG   D  G ++GG
Sbjct: 660 LNAITLDGDRADKRGVLTGG 679

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 124/231 (53%), Gaps = 37/231 (16%)

Query: 1229 DNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKK 1288
            +++NE+I+ L S +N  +   E  +++ ++  E ++R  +L+ S   ++ + +++  LK+
Sbjct: 978  NSVNEDISGL-SNVNKRAF--ENFKKFGEKRTELEERAEELDES---KSSIQNLITRLKR 1031

Query: 1289 KRYNEFMEGFSIISMTLKEMYQMITMGGNAEL---------------ELVD--------- 1324
            ++ N     F+ +S    ++++ +   G A+L               E V+         
Sbjct: 1032 QKVNAVDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDENDE 1091

Query: 1325 ----SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1378
                S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ D
Sbjct: 1092 SRSKSVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFD 1151

Query: 1379 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429
            EIDAALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + K+EN
Sbjct: 1152 EIDAALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV-KYEN 1201

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  E  I  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+     ++   SVE+ F         P+       EN  V  R+        Y 
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPSHRIILPS--GIPPRENDEVFVRRTVGLKKDDYQ 116

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +    ++V ++L+  G  + +   ++ QG +  +A   A   KD E   L  LE+++
Sbjct: 117 LNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRI--VALTNA---KDRER--LHLLEEVV 169

Query: 349 GTKHY 353
           G K +
Sbjct: 170 GAKSF 174

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 97/186 (52%), Gaps = 19/186 (10%)

Query: 1262 FKKRKIDLNNSVGE----RNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGN 1317
            F ++KI+LN    E    +  + +++E+LK+++       F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1318 AELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALV 1363
            A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1364 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1424 IYKHEN 1429
            + K+EN
Sbjct: 1181 V-KYEN 1185

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 5/142 (3%)

Query: 703 NGFHGRLGDLGIIADQYD-VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           +   G LG+L  ++++Y   A       L ++VV++ E     +  L   K G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 762 DKLKRFDMSPIQTPENVPRLFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRVAYGK 819
           +++   D +    P        L+K    + R+  A+  +   T+V KDL + +++A  K
Sbjct: 593 NRI-HVDNNITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDLLEGSKIA-KK 650

Query: 820 RRFRVVTLDGQLIDISGTMSGG 841
            +   VTLDG   D  G ++GG
Sbjct: 651 LKLNAVTLDGDRADKMGVLTGG 672

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 125/255 (49%), Gaps = 38/255 (14%)

Query: 1222 ELSTIDTDNLNEEINQLQSFINNV-SINIEILEEYAKRLVEFKKRKIDLNNSVGE----R 1276
            + S I +D L +++N + + I+ + ++N    E + K    F +++ DL+    E    +
Sbjct: 968  DFSDITSDQLLQKLNDMNTEISGLKNVNKRAFENFKK----FDEKRKDLSERASELDESK 1023

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELEL---------VDSLD 1327
            + +  ++ +LK+++ N     F  +S   + +++ +   G A+L +         +DS+D
Sbjct: 1024 DSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGIAKLVIHRRDDTKDQMDSID 1083

Query: 1328 P-----------------FSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHK 1368
                                 GV+ SV    K     ++  LSGG+KT+ ++AL+ A+  
Sbjct: 1084 DDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQM 1143

Query: 1369 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHE 1428
              P   Y+ DEIDAALD +  + VA  IKE +KNAQFI  + R +M ++A +   + K+E
Sbjct: 1144 VDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV-KYE 1202

Query: 1429 NMTKNATIRNREDLI 1443
            N        NRE+ I
Sbjct: 1203 NKISTVIEVNREEAI 1217

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 77/358 (21%), Positives = 164/358 (45%), Gaps = 46/358 (12%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++++  FK+Y  E  I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F         P+ G     ++ + I R+        Y 
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPDHSMILPS-GVLSRGDDEVTI-RRTVGLKKDDYQ 117

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED++
Sbjct: 118 LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVV 170

Query: 349 GTKHYKPLI----------EQKTVEI-EAMNELCIEKENRFRIVDDEKNSLEKDKDAAXX 397
           G K ++  +          EQK  +I + M+EL     ++   ++ E+  LEK  +    
Sbjct: 171 GAKSFEVKLKASLKKMEETEQKKFQINKEMDEL----NSKLTEMEQERKELEKYNELERK 226

Query: 398 XXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQN 457
                           QY LY  + ++   + Q++ L  D+        Q+++E++  ++
Sbjct: 227 RKIY------------QYTLY--DRELNDVINQMERLDGDYNNTVYSSEQYIQELDKRED 272

Query: 458 SIDESKNNLTSLTTEEKSL-IQRKREINTQSVSLEETTKNL---DQKLKKAKATVESS 511
            I++    L+++   E SL I+   ++    +   ET++NL   + K+K+ +  +ES+
Sbjct: 273 MIEQVSKKLSNI---EASLKIKNTTDLQQAKLRESETSQNLTDVNVKIKEVELQIESN 327

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 19/146 (13%)

Query: 707 GRLGDLGIIADQYDVAISTACPR------LDDMVVESVECGQTCIEFLRKNKLGYARFVV 760
           G LG+L  + D+Y      AC        L  +VV++ E     +  L + K G   F+ 
Sbjct: 538 GTLGELIKVNDKY-----KACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIP 592

Query: 761 LDKLKRFDMSPIQTPENVP---RLFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRV 815
           L++L   D S ++ P N     +   L+K    + RF  A+  V   T+V KDL Q  ++
Sbjct: 593 LNRLS-LD-SDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGRTIVVKDLGQGLKL 650

Query: 816 AYGKRRFRVVTLDGQLIDISGTMSGG 841
           A  K +   +TLDG   D  G ++GG
Sbjct: 651 A-KKHKLNAITLDGDRADKRGVLTGG 675

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1344 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1402
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1403 AQFIVISLRNNMF 1415
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 21/165 (12%)

Query: 701 RINGFHGRLGDLGIIAD---QYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKLGYA 756
           + N  +G +G L  + D   +Y  A+ T A  RL ++VV+     QT  + L + +L   
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQD---SQTATQLLERGRL--R 573

Query: 757 RFVVLDKLKRFDMSPIQ----------TPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVA 806
           + V +  L +    PI            P  V    +L+K  +K    A+  +  ++L+ 
Sbjct: 574 KRVTIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLIC 632

Query: 807 KDLKQANRVAYG-KRRFRVVTLDGQLIDISGTMSGGGSRVFKGLM 850
           +D + A ++ +  K R R +TL G + D  GT+SGG       L+
Sbjct: 633 EDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL 677

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 126/256 (49%), Gaps = 39/256 (15%)

Query: 1222 ELSTIDTDNLNEEINQLQSFINNV-SINIEILEEYAKRLVEFKKRKIDLNNSVGE----R 1276
            + S I +D L +++N + + I+++ ++N    E + K    F +++ DL+    E    +
Sbjct: 968  DFSDITSDQLLQKLNDMNTEISSLKNVNKRAFENFKK----FNEKRKDLSGRASELDESK 1023

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELV----DSLDPFSE- 1331
            + +  ++ +LK+++ +     F  +S   K +++ +   G A+L +     DS+D  ++ 
Sbjct: 1024 DSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDV 1083

Query: 1332 ----------------------GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALH 1367
                                  GV+ SV    K     ++  LSGG+KT+ ++AL+ A+ 
Sbjct: 1084 DVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQ 1143

Query: 1368 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKH 1427
               P   Y+ DEIDAALD +  + VA  IKE + NAQFI  + R +M ++A +   + K+
Sbjct: 1144 MVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV-KY 1202

Query: 1428 ENMTKNATIRNREDLI 1443
            EN        NRE+ I
Sbjct: 1203 ENKISTVIEVNREEAI 1218

 Score = 65.9 bits (159), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 88/185 (47%), Gaps = 10/185 (5%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  E  I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F         P+ G     ++ + I R+        Y 
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPDHSMILPS-GVLSRGDDEVTI-RRTVGLKKDDYQ 117

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED++
Sbjct: 118 LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVV 170

Query: 349 GTKHY 353
           G K +
Sbjct: 171 GAKSF 175

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 707 GRLGDLGIIADQYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G LG+L  + D+Y           L  +VV++ E     +  L + K G   F+ L+KL 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLS 597

Query: 766 RFDMSPIQTPENVP---RLFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
             D + ++ P N     +   L+K    + RF  A+  V   T+V KDL Q  ++A  K 
Sbjct: 598 -LD-ADVKFPSNSTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 821 RFRVVTLDGQLIDISGTMSGG 841
           +   +TLDG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 123/256 (48%), Gaps = 39/256 (15%)

Query: 1222 ELSTIDTDNLNEEINQLQSFINNV-SINIEILEEYAKRLVEFKKRKIDLNNSVGE----R 1276
            + S I +D L + +N + + I+ + ++N    E + K    F +R+ DL     E    +
Sbjct: 968  DFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKK----FNERRKDLAERASELDESK 1023

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAEL-------------ELV 1323
            + +  ++ +LK+++ N     F  +S   + +++ +   G A+L             E +
Sbjct: 1024 DSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESI 1083

Query: 1324 D-SLDPFSE-------------GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALH 1367
            D  +D  S              GV+ SV    K     ++  LSGG+KT+ ++AL+ A+ 
Sbjct: 1084 DVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQ 1143

Query: 1368 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKH 1427
               P   Y+ DEIDAALD +  + VA  +KE +KNAQFI  + R +M ++A +   + K+
Sbjct: 1144 MVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV-KY 1202

Query: 1428 ENMTKNATIRNREDLI 1443
            EN        NRE+ I
Sbjct: 1203 ENKISTVIEVNREEAI 1218

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 164/382 (42%), Gaps = 61/382 (15%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++++  FK+Y  E  I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F         P+ G     ++ + I R+        Y 
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPDHSMILPS-GVLSRGDDEVTI-RRTVGLKKDDYQ 117

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED++
Sbjct: 118 LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVV 170

Query: 349 GTKHYKPLI----------EQKTVEI-EAMNELCIEKENRFRIVDDEKNSLEKDKDAAXX 397
           G K ++  +          EQK ++I + M EL     ++   ++ E+  LEK  +    
Sbjct: 171 GAKSFEVKLKASLKKMEETEQKKIQINKEMGEL----NSKLSEMEQERKELEKYNELERN 226

Query: 398 XXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQN 457
                           Q+ LY  + ++   + Q++ L  D+        Q+++E++  ++
Sbjct: 227 RKIY------------QFTLY--DRELNEVINQMERLDGDYNNTVYSSEQYIQELDKRED 272

Query: 458 SIDESKNNLTSLTT---------------EEKSLIQRKREINT------QSVSLEETTKN 496
            ID+    L+S+                  E  + Q+   +N       Q +   E  +N
Sbjct: 273 MIDQVSKKLSSIEASLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRN 332

Query: 497 LDQK-LKKAKATVESSKSLISK 517
           LD   LK+ K+ +E  K  +SK
Sbjct: 333 LDSATLKEIKSIIEQRKQKLSK 354

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 120/253 (47%), Gaps = 41/253 (16%)

Query: 1198 DEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVS-INIEILEEYA 1256
            DE+   + + G L  + + R  +     +D++ +   +N++   I+  S +N   +E + 
Sbjct: 945  DEVQQKISEIGLLSEESLDRHQN-----LDSEEVLRRLNEVNDKISKTSNVNRRAIENFR 999

Query: 1257 KRLVEFKKRKIDLNNSVGE----RNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMI 1312
            K    F +++ +L N   E    +  +  +++ LKK++       FS ++     +++ +
Sbjct: 1000 K----FNEKREELENRAEELARSKESIEELVDSLKKQKIEAVEATFSKVANNFTHIFEKL 1055

Query: 1313 TMGGNAELELV-------------------------DSLDPFSEGVTFSVMPPKKSWRN- 1346
               G  +L +                          DS++    GV+ SV    K+    
Sbjct: 1056 VPAGVGKLVIHRNESTRNASGGRGPQQGSGASGNEDDSIETMYSGVSISVSFNSKNNEQL 1115

Query: 1347 -ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1405
             +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +AQF
Sbjct: 1116 YVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANVIKELSVHAQF 1175

Query: 1406 IVISLRNNMFELA 1418
            I  + R++M ++A
Sbjct: 1176 ICTTFRSDMLQVA 1188

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/355 (22%), Positives = 162/355 (45%), Gaps = 39/355 (10%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI  +V+  FK+Y    ++      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+     ++    VE+ F     +    T G  M  E+ +V  R+       +Y 
Sbjct: 61  RQGLIHQGT--GSVMSAYVEIIFHDPSGQMMI-TSGIPMTEEH-IVRVRRTIGLKKDEYS 116

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +NGK  + ++++++ +  G    +   ++ QG +  +A   A   KD E   L  LE+++
Sbjct: 117 VNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRI--VAVTNA---KDRER--LALLEEVV 169

Query: 349 GTKHYKPLIEQKTVEIEAMN--------ELCIEKENRFRIVDDEKNSLEKDKDAAXXXXX 400
           G K ++  + +   ++EA N        EL  E   R   +++E+  LEK          
Sbjct: 170 GAKSFEIKLRESAKKMEATNRDRTRIDSELA-ELRTRLDELNEERQELEK---------- 218

Query: 401 XXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSID 460
                        Q+ LY  + ++     QI+SL  ++    Q   +F++E+   +  I+
Sbjct: 219 --YQKLERDRRIFQFVLY--DRELNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIE 274

Query: 461 ESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTK---NLDQKLKKAKATVESSK 512
               N++++ TE +  ++   ++  +   L+E +K   +L+  L++AK   E+ K
Sbjct: 275 NVTKNISNIETELR--VKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHK 327

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 15/147 (10%)

Query: 703 NGFHGRLGDLGIIADQYDV-AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           +  HG LG+L  + ++Y   A +     L  +VV++ E     +E L   K G   F+ L
Sbjct: 533 DSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPL 592

Query: 762 DKLKRFDMSPIQTPEN-----VPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVA 816
           +++   D +P+  P+N      P ++ +    EKRF  A+  V   T+V +D+   +++A
Sbjct: 593 NRIA--DSNPVTFPDNSQAECTPLIWKM--KYEKRFEKAVRHVFGRTIVVRDIGTGSKLA 648

Query: 817 YGKRRFRV--VTLDGQLIDISGTMSGG 841
              + F +  VTLDG   D  G ++GG
Sbjct: 649 ---KSFNLDAVTLDGDRTDKRGLITGG 672

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 114/239 (47%), Gaps = 36/239 (15%)

Query: 1238 LQSFINNVSINIEILEEYAKRLVE----FKKRKIDLNNSVGE----RNQLTSIMEELKKK 1289
            L S +N V+ NI  L    KR  E    F +++ +L+    E    +  +  ++E LK++
Sbjct: 974  LLSKLNEVNKNIAGLSNVNKRAFENFKRFNEKQRELSQRAAELEESKVSIQDLIERLKQQ 1033

Query: 1290 RYNEFMEGFSIISMTLKEMYQMITMGGNAEL---------------ELVD---------- 1324
            + +     F  +S     +++ +   G A L               E VD          
Sbjct: 1034 KISAVDNTFKKVSDNFVTVFEQLVPKGTARLIIHKNTDKGDLAVRDEDVDEDVNMDGESQ 1093

Query: 1325 SLDPFSEGVTFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1382
             L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1094 DLESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1153

Query: 1383 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRED 1441
            ALD +  + VAN IK+ +KNAQFI  + R +M  +A +   + K+EN        N++D
Sbjct: 1154 ALDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRV-KYENKISTIIEINKQD 1211

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 88/185 (47%), Gaps = 11/185 (5%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  E  I  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+     ++   SVE+ F +  D     + G  +   N  V  R+        Y 
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF-HDPDHRIILSSG-VIPRPNDEVFVRRTVGLKKDDYQ 116

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           IN +    +++ ++L+  G  +     ++ QG +  IA   A   KD E  LL  LED+I
Sbjct: 117 INDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRI--IALTNA---KDKERLLL--LEDVI 169

Query: 349 GTKHY 353
           G K +
Sbjct: 170 GAKSF 174

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 65/148 (43%), Gaps = 16/148 (10%)

Query: 703 NGFHGRLGDLGIIADQYD-VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           +   G LG+L  ++++Y   A       L  +VV++ +     +  L K K G   F+ L
Sbjct: 533 DAVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPL 592

Query: 762 DKLKR-----F---DMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQAN 813
           ++L       F   D S   TP     L   +K  + +F  A+  V   T+V +DL    
Sbjct: 593 NRLHEDSGVTFPPQDQSAACTP-----LLKKIKY-DAKFEKAVKHVFGKTIVVRDLTTGV 646

Query: 814 RVAYGKRRFRVVTLDGQLIDISGTMSGG 841
           ++A    +   +TLDG   D  G ++GG
Sbjct: 647 KMAKS-YQLNAITLDGDRADNRGVLTGG 673

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 73/125 (58%), Gaps = 3/125 (2%)

Query: 1321 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1378
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1379 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K+EN        +
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTVIEVD 1210

Query: 1439 REDLI 1443
            ++D I
Sbjct: 1211 KQDAI 1215

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 152/353 (43%), Gaps = 46/353 (13%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  +  I  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F   + +   P+ G      N  +  R+        Y 
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPEHKMILPS-GVVPRENNDEICIRRTVGLKKDDYQ 118

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     +V ++L+  G  + +   ++ QG++ ++   K K         L+ LED++
Sbjct: 119 LNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDVV 171

Query: 349 GTKHYKPLI----------EQKTVEI-EAMNELCIEKENRFRIVDDEKNSLEKDKDAAXX 397
           G K ++  +          EQK   I + M+EL     ++ + ++ E+  LEK       
Sbjct: 172 GAKSFEVKLKASLKKMEETEQKRARIAKEMDEL----NSKLKEMEQERKELEK------- 220

Query: 398 XXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQN 457
                           Q+ LY  + ++   + Q++ L  D+        Q++KE++  + 
Sbjct: 221 -----YNALEKNRKVFQFTLY--DRELNDIINQVERLDDDYNVTANSSEQYIKELDKREE 273

Query: 458 SIDESKNNLTSL--------TTEEKSLIQRKREINTQSVSLEETTKNLDQKLK 502
            I     NL+ +        TT+      R  E+  Q  +L+   K+L  ++K
Sbjct: 274 IISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIK 326

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 703 NGFHGRLGDLGIIADQYDV-AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           +   G LG+L  + ++Y + A       L  +VV++ E     ++ L K K G   F+ L
Sbjct: 535 DSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPL 594

Query: 762 DKLKRFDMSPIQTPENVPRLFDLVKPK---EKRFAPAIYSVLRDTLVAKDLKQANRVAYG 818
           +++  +  + IQ P N    F  +  K   ++RF  A+  +   T+V KDL    R++  
Sbjct: 595 NRI--YLDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS-K 651

Query: 819 KRRFRVVTLDGQLIDISGTMSGG 841
           K +   +TLDG   D  G ++GG
Sbjct: 652 KFKLNSITLDGDRADKRGVLTGG 674

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 117/243 (48%), Gaps = 41/243 (16%)

Query: 1231 LNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGE----RNQLTSIMEEL 1286
            +NE+I+ L++      +N +  E + K    F ++K++L +   E    +  + +++ +L
Sbjct: 980  VNEDISGLKN------VNKKAFENFKK----FHEKKLELEDRSKELDESKTSIQNLIVKL 1029

Query: 1287 KKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSE--------------- 1331
            K+++       F  +S    E+++ +   G A+L +  S D   +               
Sbjct: 1030 KQQKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDD 1089

Query: 1332 ---------GVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1380
                     GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1090 GTQTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEI 1149

Query: 1381 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE 1440
            DAALD +  + VA  IK  + NAQFI  + R +M ++A +   + K+EN        +R+
Sbjct: 1150 DAALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENKISTVVEVDRQ 1208

Query: 1441 DLI 1443
            + I
Sbjct: 1209 EAI 1211

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 89/190 (46%), Gaps = 21/190 (11%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++++  FK+Y  E  I  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHF-----RYVKDEYTAPTDGDTMEAENTLVITRKAFKNN 283
              LIH+     ++   SVE+ F     R +     AP   D        V+ R+     
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILPSGVAPRSNDE-------VLVRRTVGLK 111

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
              Y +N +     +V ++L+  G  +++   ++ QG +  IA   A   KD E   L+ 
Sbjct: 112 KDDYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRI--IALTNA---KDKER--LQL 164

Query: 344 LEDIIGTKHY 353
           LED++G K +
Sbjct: 165 LEDVVGAKSF 174

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 76/156 (48%), Gaps = 11/156 (7%)

Query: 690 LTSLMRMQQSGRINGFHGRLGDLGIIADQYDV-AISTACPRLDDMVVESVECGQTCIEFL 748
           +T  +R+ + GR+    G LG+L  + ++Y + A       L  +VV++ E     I+ L
Sbjct: 524 ITEKLRLPE-GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQEL 579

Query: 749 RKNKLGYARFVVLDKLKRFDMSPIQTPENV-PRLFDLVKPK--EKRFAPAIYSVLRDTLV 805
            + + G   F+ L+++  ++   I  P N       L+K    + +F   + +V   T+V
Sbjct: 580 YRMRGGRVTFMPLNRI--YNDPNITYPPNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIV 637

Query: 806 AKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841
            +DL   +++A    +   +TLDG   D SG ++GG
Sbjct: 638 VRDLAAGSKIA-KHYKLDAITLDGDRADKSGLLTGG 672

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 128/269 (47%), Gaps = 32/269 (11%)

Query: 1198 DEISMDVDDCGDLVSQGIPRL----SDKELSTIDTDNLNEEINQLQSFINNVSINIEILE 1253
            DEI   + + G L  + + +     SD+ L+ ++  N+ +E++ L +       N +   
Sbjct: 945  DEIQQKIRELGLLPEESLSKYQESSSDELLNELN--NITKELSTLHNVNKRAFENFKKFS 1002

Query: 1254 EYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT 1313
            E    LVE  K   D  NS+ E      ++ +LK+++       F  +S    ++++ + 
Sbjct: 1003 EKQNELVERAKELDDSKNSIQE------LITQLKEQKITAVDTTFKKVSENFTKVFEKLV 1056

Query: 1314 MGGNAELEL-------VDSLDPFSE----------GVTFSVM--PPKKSWRNITNLSGGE 1354
              G A L +       + S+D  ++          GV+ SV     +    ++  LSGG+
Sbjct: 1057 PRGTANLIIHRRSDDSLASMDINTDSQNISELVYTGVSISVSFNSKRDEQLHVEQLSGGQ 1116

Query: 1355 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1414
            KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M
Sbjct: 1117 KTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQFICTTFRTDM 1176

Query: 1415 FELAKQLVGIYKHENMTKNATIRNREDLI 1443
             ++A +   + K+EN        NR+  I
Sbjct: 1177 LQVADKFFRV-KYENKISTVVEINRDSAI 1204

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 90/185 (48%), Gaps = 11/185 (5%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI K+++  FK+Y  E  I  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+     ++   SVE+ F    +    P+ G  +  ++T+ I R+        Y 
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFYDPGNSMILPS-GVAVNPDSTVSI-RRTVGLKKDDYQ 116

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           IN +    +++ ++++  G  + +   ++ QG +  +   K K         L+ LED++
Sbjct: 117 INDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILEDVV 169

Query: 349 GTKHY 353
           G K +
Sbjct: 170 GAKSF 174

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 72/140 (51%), Gaps = 9/140 (6%)

Query: 707 GRLGDLGIIADQYD-VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G LG+L  ++++Y   A       L ++VV++ E     ++ L + K G   F+ L+++ 
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRI- 595

Query: 766 RFDMSPIQTPENVPRLFDLVKPK--EKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFR 823
           R D +    P +      L+K    + R+  A+  V   T+V KDL + +++A   +RF+
Sbjct: 596 RMDSNFTYPPNDQASCTPLIKKIKFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRFK 652

Query: 824 V--VTLDGQLIDISGTMSGG 841
           +  +TLDG   D  G ++GG
Sbjct: 653 MNAITLDGDRADKRGELTGG 672

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 1326 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1383
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1384 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K+EN
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYEN 1203

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 145/314 (46%), Gaps = 43/314 (13%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  E  I  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+      ++  SVE+ F     +   P+    +  EN  V  R+        Y 
Sbjct: 61  RQGLIHQGSGGAVMS-ASVEIVFHDPNHKIILPS--GVVPRENDEVYIRRTVGLKKDDYQ 117

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     +V ++L+  G  +++   ++ QG++  IA   A   KD E   L  LED++
Sbjct: 118 LNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKI--IALTNA---KDKE--RLNLLEDVV 170

Query: 349 GTKHYKPLI----------EQKTVEIEA-MNELC--IEKENRFRIVDDEKNSLEKDKDAA 395
           G K ++  +          EQK  +I+  MNEL   +++ N+ R   ++ NSL+K++   
Sbjct: 171 GAKSFELKLKASLKKMDETEQKRNQIDMEMNELNSKLKEMNQERKELEKFNSLDKNRKVF 230

Query: 396 XXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETL 455
                             Q+ LY  + ++   + QI++L  D+        +++KE++  
Sbjct: 231 ------------------QFTLY--DRELNDIITQIENLDGDYNSTVDSSEKYIKELDKR 270

Query: 456 QNSIDESKNNLTSL 469
           +N I E    LT +
Sbjct: 271 ENIISELTKKLTEI 284

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 26/206 (12%)

Query: 1246 SINIEILEEYAK---RLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIIS 1302
            +IN    E Y K   +  E ++R  +L++S   +  +  ++ +LK+++ N   + F  +S
Sbjct: 992  NINKRAFENYKKFNEKQSELRERATELDDS---KQSIQDLIIKLKEQKLNAVDKTFDKVS 1048

Query: 1303 MTLKEMYQMITMGGNAELELV--------DSLDPFS---------EGVTFSVMPPKKS-- 1343
                 +++ I   G A L +         D+ + F+         EGV+ SV    K   
Sbjct: 1049 KNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDE 1108

Query: 1344 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1403
               +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD +    VA  I + + NA
Sbjct: 1109 QLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNA 1168

Query: 1404 QFIVISLRNNMFELAKQLVGIYKHEN 1429
            QFI  + R++M + A +   + K+EN
Sbjct: 1169 QFICTTFRSDMVDAANKFYRV-KYEN 1193

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 161/355 (45%), Gaps = 59/355 (16%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++++  FK+Y  E  IG F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F   +    APT G      +  V  R+        Y 
Sbjct: 61  RQGLIHQGAGASVMS-ASVEIVFHDPEHSIIAPT-GINSNGSSDEVRIRRTVGLKKDDYQ 118

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     ++ ++L+  G  + +   ++ QG + ++   K K         L+ LE+++
Sbjct: 119 VNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVV 171

Query: 349 GTKHYKPLI----------EQKTVEIEA-MNELCIEKENRFRIVDDEK------NSLEKD 391
           G K ++  +          EQK  +I A M EL    E++   ++ E+      NSLE+D
Sbjct: 172 GAKSFEVKLKASMKQMDETEQKRAQISAEMEEL----ESKLNEMEKERKELEKYNSLERD 227

Query: 392 KDAAXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKE 451
           +                     +Y L+  + +++  + QI+SL  D+        +++ E
Sbjct: 228 RKVL------------------RYTLH--DRELQDIISQIESLDGDYNDTLGSSKKYILE 267

Query: 452 VETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKA 506
           +E  +N I E    + +L   +KSL  +       +V LE+    L++ L++++A
Sbjct: 268 LEKRENMIKEVNEEIKNL---QKSLKLK------ATVDLEQAKAILEESLERSEA 313

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 8/140 (5%)

Query: 707 GRLGDLGIIADQYDVAIST-ACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G +G+L  + ++Y V         L  +VV++ E     +  L + K G   F+ L+KLK
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 766 RFDMSPIQTPE--NVPRLFDLVKPK-EKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR-R 821
             + + I  P   N+P    + K K + +F   +  V    LV KDL   N ++  K+ +
Sbjct: 599 NGNQN-IDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYK 655

Query: 822 FRVVTLDGQLIDISGTMSGG 841
              +TLDG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 121/256 (47%), Gaps = 39/256 (15%)

Query: 1222 ELSTIDTDNLNEEINQLQSFINNV-SINIEILEEYAKRLVEFKKRKIDLNNSVGE----R 1276
            + S I +D L +++N + + I+ + ++N    E + K    F +++ DL+    E    +
Sbjct: 968  DFSDITSDQLLQKLNDMNTEISGLKNVNKRAFENFKK----FNEKRKDLSERASELDESK 1023

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELEL----------VDSL 1326
            N +  ++  LK+++ +     F  +S   + +++ +   G A+L +           DS 
Sbjct: 1024 NSIQDLIVRLKQQKVSAVDSTFQKVSENFETVFERLVPRGTAKLVIHRRNENVGDQTDSA 1083

Query: 1327 D-----------------PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALH 1367
            D                     GV+ SV    K     ++  LSGG+KT+ ++AL+ A+ 
Sbjct: 1084 DVEMDADASKVTSSRDGETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQ 1143

Query: 1368 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKH 1427
               P   Y+ DEIDAALD +  + VA  IKE + +AQFI  + R +M ++A +   + K+
Sbjct: 1144 MVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV-KY 1202

Query: 1428 ENMTKNATIRNREDLI 1443
            EN        N+E+ I
Sbjct: 1203 ENKISTVIEVNKEEAI 1218

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 87/185 (47%), Gaps = 10/185 (5%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++V+  FK+Y  E  I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LIH+    + ++  SVE+ F         P+ G     ++ + I R+        Y 
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPDHSMILPS-GVLSRGDDEVTI-RRTVGLKKDDYQ 117

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           +N +     ++ ++L+  G  + +   ++ QG++  +   K K         L+ LED++
Sbjct: 118 LNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLEDVV 170

Query: 349 GTKHY 353
           G K +
Sbjct: 171 GAKSF 175

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 67/141 (47%), Gaps = 9/141 (6%)

Query: 707 GRLGDLGIIADQYDV-AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G LG+L  + D+Y   A       L  +VV++ E     +  L + K G   F+ L++L 
Sbjct: 538 GTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596

Query: 766 RFDMSPIQTPENVP---RLFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
            F  S ++ P N     +   L+K    + RF  A+  V   T+V K+L Q  ++A  K 
Sbjct: 597 -FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KKH 654

Query: 821 RFRVVTLDGQLIDISGTMSGG 841
           +   +TLDG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGLLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 80/148 (54%), Gaps = 4/148 (2%)

Query: 1283 MEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1342
            ++ LK+++ N     F+ +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1343 S--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1400
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1401 KNA-QFIVISLRNNMFELAKQLVGIYKH 1427
            +N  QFI+ + R++M E+A  +  +  H
Sbjct: 1071 QNGTQFILTTFRSDMIEIADMIYMVKYH 1098

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 3/108 (2%)

Query: 1324 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1381
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1382 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + K+EN
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYEN 1199

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 14/185 (7%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI K+++  FK+Y  +  I  F A  + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
              LI++        +  +  H    +     P         N  +  R+       +Y 
Sbjct: 61  RRSLIYQGTSSVMSGYVEIVFHDAENRTLLGIPDS-------NGAIRIRRTVGLKKDEYM 113

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           IN K S+ ++V +LL+  G    +   ++ QG + ++   K +         L+ LE+++
Sbjct: 114 INNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDRER-------LQLLEEVV 166

Query: 349 GTKHY 353
           G K +
Sbjct: 167 GAKSF 171

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 15/143 (10%)

Query: 707 GRLGDLGIIADQYD-VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G LG+L  ++++Y   A       L  +VV++       ++ L  +K G   F+ L+   
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLN--- 590

Query: 766 RFDMSP-IQTPEN----VPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
           R  + P IQ P N       L   +K  + +F  A+  V   T+V KDL Q +++A   +
Sbjct: 591 RIYVDPNIQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---K 646

Query: 821 RFRV--VTLDGQLIDISGTMSGG 841
           +F +  VTLDG   D  G ++GG
Sbjct: 647 QFNLNSVTLDGDKADNKGVLTGG 669

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 1325 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1382
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1383 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGI 1424
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +   +
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 17/186 (9%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI K+++  FK+Y  +  I  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVI-TRKAFKNNSSKY 287
              LI++          +  V   YV+  +    +   + A++  VI  R+       +Y
Sbjct: 61  RRSLIYQG---------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEY 111

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347
            IN K ++ ++V +LL+  G    +   ++ QG + ++   + +         L+ LE++
Sbjct: 112 MINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEV 164

Query: 348 IGTKHY 353
           IG K +
Sbjct: 165 IGAKSF 170

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1347 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1406
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1407 VISLRNNMFELAKQLVGIYKHENMTKNATIRNREDLI 1443
              + R +M  +A     + K EN     T  +R+D +
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVTEVSRQDAV 1212

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 104/230 (45%), Gaps = 23/230 (10%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           ++I  +++  FK+Y     +  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
               I++        F  VE+ F   ++   AP   DT E     V  R+       +Y 
Sbjct: 62  RKGFIYQGAGQVMSAF--VEIIFDDPENLMLAPLRNDTGE-----VRIRRTVGLKKDEYM 114

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDII 348
           IN K S   +V ++L+  G    +   ++ QG + ++        KD E   L  LED++
Sbjct: 115 INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNA-----KDLER--LHLLEDVV 167

Query: 349 GTKHYKPLIEQKTVEIEAM--------NELCIEKENRFRIVDDEKNSLEK 390
           G K ++  +++   ++EA         NEL  E + R   + DEK  LEK
Sbjct: 168 GAKSFENKLKESLKKMEAAERDRTKITNELN-ELDKRLSELSDEKEELEK 216

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 99/233 (42%), Gaps = 26/233 (11%)

Query: 707 GRLGDLGIIADQYDV-AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLK 765
           G +G+L  ++D+Y + A       L ++VV++ E     I+ L   K G   F+ L+KL 
Sbjct: 534 GPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL- 592

Query: 766 RFDMSPIQTPENVPR--LFDLVKP--KEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRR 821
             D +    P N+ +     L+K    + +F   I  V   TLV K L     +A  + +
Sbjct: 593 HVD-TNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYK 650

Query: 822 FRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQ 881
              +TLDG   D  G +SGG    +K           ++ + +L D K+ + E    + +
Sbjct: 651 LNAITLDGDRADSKGVLSGGYLDQYK-----------SNRLDTLRDFKQSKREYKKIQVE 699

Query: 882 FDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEK 934
                +   S+EQE+  L +        +     + DA    I+  RSQL  K
Sbjct: 700 LQEIKQALQSIEQEIDGLNNV-------VKDAAAERDAYEAGIEKARSQLKAK 745

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 83/141 (58%), Gaps = 1/141 (0%)

Query: 1275 ERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1334
            ++ ++   +E+L + +    ++ +  +S+    ++  +     A+LE  +  D  +EG+ 
Sbjct: 1010 DKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLE 1068

Query: 1335 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1394
              V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1395 YIKERTKNAQFIVISLRNNMF 1415
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 88/179 (49%), Gaps = 15/179 (8%)

Query: 704 GFHGRLGDLGIIA-DQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           G  G + DL     D+Y VA+ST   +  D ++V++    Q CI +L++ + G A F+ L
Sbjct: 532 GVRGLVHDLCHPKKDKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPL 591

Query: 762 DKLKRFDMS-PIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKR 820
           D +     + P+   +      D +   +     A+  V  D+++   L  A  + + + 
Sbjct: 592 DTIDAITANLPVSNTKGCILAIDSI-SYDSELEKAMQYVCSDSIICDSLDLAKDLKWNRG 650

Query: 821 -RFRVVTLDGQLIDISGTMSGGGSR---------VFKGLMNLTTKV-SGTSEIFSLEDM 868
            R ++VTL+G LI  +G M+GG SR          ++GL+ L  ++ S ++E+ S E +
Sbjct: 651 IRSKLVTLEGALIHKAGLMTGGASREGNNRWDKEEYQGLLALKNRLTSESTELISHERL 709

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 92/205 (44%), Gaps = 22/205 (10%)

Query: 169 LYIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 228
           +YI ++ +  FK+Y     I  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTL-----VITRKAFKNN 283
              LIH+     ++    VE+ F          +DG  + A  +      V+ R+     
Sbjct: 61  RQGLIHQGS--GSVMSAYVEIVF--------DNSDGRLLNAAASPSSPDEVVIRRTIGLK 110

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEY 343
             +Y +N K  +  E+  LL+  G    +  +++ QG +  +A   A   KD E   L+ 
Sbjct: 111 KDEYSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRI--VALTNA---KDYE--RLQL 163

Query: 344 LEDIIGTKHYKPLIEQKTVEIEAMN 368
           L+++ G   ++  +     +++A N
Sbjct: 164 LKEVTGANSFEKKLRDSLNKMDATN 188

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 104/238 (43%), Gaps = 23/238 (9%)

Query: 703 NGFHGRLGDLGIIADQYDVAISTACPR-LDDMVVESVECGQTCIEFLRKNKLGYARFVVL 761
           N  +G LG+L  + ++Y     T     L  +VV++ +     ++ L   K G   F+ L
Sbjct: 532 NAVYGPLGELIKVNEKYKTCAETVGGNSLFHVVVDTEDTAGLLMQELYNVKGGRVTFMPL 591

Query: 762 DKLKRFD--MSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGK 819
           ++L   +    P     N   L   +K  EK F  A+  V   T+V +DL    ++A  +
Sbjct: 592 NRLHADNNVTYPSNEQSNCTALIKKIKYDEK-FERAVKHVFGKTIVVRDLTLGTKLAR-Q 649

Query: 820 RRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAARE 879
            +   +TLDG   D  G ++GG     K            + + SL+D+K  + E +   
Sbjct: 650 YKLNAITLDGDRADKRGVLTGGYHDHHK-----------KTRLDSLKDLKHAKTEYSTVS 698

Query: 880 KQFDVASETFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSND 937
           ++ +   +  H ++ E+ +L ++  Q   +    ++DI+ L       RS+L  + N+
Sbjct: 699 QKLNSLKKQLHVVDDEVDQLNNKIKQATTKKESIMVDIEGL-------RSRLNNRKNE 749

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 22/163 (13%)

Query: 174 LVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSD 231
           L L NF +YA  E  + P   S + ++GPNGSGKS  + ++      +   + R  ++ D
Sbjct: 50  LRLENFVTYALTEFHMSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKIED 106

Query: 232 LIHKSERFTNLNFCSVEVHFRY---VKDEYTAPTDGDTMEAENTLVITRKAFKNN-SSKY 287
            I   E     +   +EV  +     +D Y A +DG T        +TR   +N  +S+Y
Sbjct: 107 YIKNGE-----DRSVIEVTLKRDPEAEDRYVA-SDGTTK-------VTRVLHRNRKASEY 153

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           F+NG+    + V +L+ E  I LD+    + Q  VE  A++K+
Sbjct: 154 FLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKS 196

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            ++         K L  ++ HE +
Sbjct: 1049 VT--------PKLLTQLHYHEKV 1063

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 79/163 (48%), Gaps = 14/163 (8%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L NF +YA  E  + P   S + ++GPNGSGKS  + ++      R   + R  R
Sbjct: 48  IIKIRLKNFVTYALTEFHLSP---SLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSKR 104

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNS-SKY 287
           + D I   E     + C +E+    +K+        + + +++ + ITR   ++   S Y
Sbjct: 105 VEDFIKNGE-----DECEIEI---TLKNNSKIQGIANVLSSDDVIKITRVLIRHRKKSDY 156

Query: 288 FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           FIN + ++   V  ++ +  I LD+    + Q  VE  A++K+
Sbjct: 157 FINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLKS 199

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L G+Y HE M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1108

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 100/231 (43%), Gaps = 56/231 (24%)

Query: 1226 IDTDNLNEEINQLQS---FINNVSINIEILEEYAKRLVEFKKR------KIDLNNSVGER 1276
             +T+ + E++ +L+S    IN+   +I IL+E  ++L + K R      K+D   +    
Sbjct: 877  FNTEYIGEQVERLESEIRMINHDESSIAILQEVERKLADVKARLPAMVRKLDAATASMST 936

Query: 1277 NQ------LTSIMEELKKKRYNEF--MEGFSIISMTLKEMYQ------MITMGGNAELEL 1322
             Q      L +I+E++ ++  N F  +     I ++   +YQ      M+    NA L+ 
Sbjct: 937  MQAELEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKR 996

Query: 1323 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1382
            +DS                         SGGE+ +S++  + AL ++   P  V+DEI+ 
Sbjct: 997  LDS----------------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQ 1034

Query: 1383 ALDFRNVSIVANYIKERT---KNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
             +D RN  IV   + +       +Q+ +I+         K L  +Y HE M
Sbjct: 1035 GMDQRNERIVHKAMVQSACADNTSQYFLIT--------PKLLTDLYYHEKM 1077

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 77/160 (48%), Gaps = 22/160 (13%)

Query: 173 KLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 232
           +L LHNF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + +      
Sbjct: 59  RLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGR------ 110

Query: 233 IHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNN--SSKYFIN 290
           + +S+ F      S  +      D + A  D  T     TL ++R   +N+  +S Y+++
Sbjct: 111 MKRSDSFIKNGADSARI------DVWLAGEDPGT-----TLKVSRVLTRNHKKASLYYVD 159

Query: 291 GKESNFTEVTKLLKEQ-GIDLDHKRFLILQGEVENIAQMK 329
           G E++   V +L+  Q  I LD+    + Q  V+  A+++
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLR 199

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFD--ASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           I K+ L NF +Y    T+  FD   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 36  IVKMRLENFVTY----TLTEFDLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 228 RLSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNS-SK 286
           R+ D I   E     +  S+E+  +        P  G   EA+ T+ ITR+  K+ S S+
Sbjct: 92  RVEDFIKNGE-----DRGSIEITLKNSPKVEGMP--GVDSEAD-TIKITRELIKSKSKSR 143

Query: 287 YFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMK-----AKAEKDNEDGLL 341
           Y IN +  +  +V  L+ +  I LD+    + Q  VE  A++K     A+  +  +  LL
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLL 203

Query: 342 EYLEDIIGTKHYKPLIEQKTVEI--EAMNELCIEKE 375
           + LE ++     K +  Q+ +++  +  +EL ++KE
Sbjct: 204 DVLE-LLKDLQAKEISSQRELDLNKQKYDELLVQKE 238

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1405
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1406 IVISLRNNMFELAKQLVGIYKHENM 1430
             +I+         K L  +Y HE M
Sbjct: 1039 FLIT--------PKLLTDLYYHEKM 1055

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L G+Y HE M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L +F +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 229 LSDLIHKSERFTNLNFC---SVEVHFRYVKDEYTAPTDGDTMEAEN-TLVITRKAFKNN- 283
           + D I   +  + +      S +VH            D + + A + T+ ITR   ++  
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVH------------DIENINAHDETIKITRIITRSKR 146

Query: 284 SSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
            S Y IN  + +   V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 147 RSDYLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLKS 193

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1405
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1406 IVISLRNNMFELAKQLVGIYKHENM 1430
             +I+         K L G+Y HE M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 173 KLVLHNFKSYAGEQTIGPFD--ASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 229
           KL + NF +Y     +  FD   S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 230 SDLIHKSE 237
            D I   E
Sbjct: 104 EDFIKNGE 111

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 72/157 (45%), Gaps = 12/157 (7%)

Query: 176 LHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 233
           L NF +Y+  E  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 51  LTNFVTYSLAEFHMSP---SLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFI 107

Query: 234 HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKE 293
                 +     ++E+  R  ++    P      EA N   +  KA +  +  Y+ING+ 
Sbjct: 108 KNGTAES-----TIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRKCA--YYINGEP 160

Query: 294 SNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
            +  ++  L+    I LD+    + Q  VE  A++KA
Sbjct: 161 VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKA 197

 Score = 40.0 bits (92), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E       +Q+ +
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  ++ HE M
Sbjct: 1052 IT--------PKLLTNLHYHERM 1066

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L G++ HE M
Sbjct: 1072 IT--------PKLLTGLFYHEKM 1086

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (43%), Gaps = 12/162 (7%)

Query: 171 IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR-L 229
           I K+ LHNF +Y  E T      S + ++GPNGSGKS  + ++      +   + + R +
Sbjct: 66  IIKIKLHNFVTY--EFTEFDLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNV 123

Query: 230 SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKN-NSSKYF 288
            D I   E          E+       E     +G  +E  +T+ ITR   ++   S+Y 
Sbjct: 124 DDYIKNDEEHG-------EIEITLKNSEAIHDVEG-VLEGSDTITITRILTRSKKKSEYK 175

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           IN        V +L+    I LD+    + Q  VE  A++K+
Sbjct: 176 INDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLKS 217

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 90/387 (23%), Positives = 169/387 (43%), Gaps = 71/387 (18%)

Query: 171 IHKLVLHNFKSY-AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L NF +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 38  IVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKR 94

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDT-------MEAENTLVITRKAFK 281
           + D I   E     +   +E+  +     Y  PT+  +       +  ++ L +TR   +
Sbjct: 95  VDDFIKNGE-----DTSRIEIFLK----NYEDPTELQSSLNLKFNLAGKDLLKVTRLIQR 145

Query: 282 NNS---SKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA-----KAE 333
           + +   S YFIN K      +  L+K   I LD+    + Q  VE  A++K+     +  
Sbjct: 146 DGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETV 205

Query: 334 KDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKD 393
           +  +  LL+ L+D+  +++     ++ T+E    NE+ I K+ RF  ++ ++N LE    
Sbjct: 206 RSIDAQLLQILDDLKSSQN-----DETTLE----NEVDI-KQKRFNELETDRNKLE---- 251

Query: 394 AAXXXXXXXXXXXXXXXXXTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKE-- 451
           A+                  +   YV   K+K     +  L+ D+E  KQ     +K+  
Sbjct: 252 ASVRSLKEFETMKEDIEIHKKLLPYV---KVKDHKENLQRLKGDYELAKQNLRALLKDKK 308

Query: 452 --VET---LQNSIDESKNNLTSLTTEEKSLIQRKREIN----------------TQSVSL 490
             V+T   ++  +DE   N  S   EE+  + R + +N                TQ+   
Sbjct: 309 PFVDTKLDMETKVDEFAENKRS--KEEELKLTRNKLMNVFNDLKVVRENIIKKQTQTAYY 366

Query: 491 EETTKNLDQKLKKAKATVESSKSLISK 517
           +  TK L +++ K K T+E++++ +++
Sbjct: 367 KTRTKKLHEEMAKTKETLEANQTKLTQ 393

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  ++ HE M
Sbjct: 1050 IT--------PKLLTDLHYHEKM 1064

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 25/174 (14%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L NF +Y+  E T+ P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
           L D I   E     +   VEV  + V +   +  + DT+  + T+   +K       +Y 
Sbjct: 101 LEDYIKNGE-----DQSVVEVTLKNVPE---SDFNTDTILIKTTINRGKK-----KPEYA 147

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLE 342
           ING     T +   +K+  I LD+    + Q  VE  A++K+       D LLE
Sbjct: 148 INGSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLKS-------DKLLE 194

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  ++ HE M
Sbjct: 1044 IT--------PKLLTNLHYHEKM 1058

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 104/229 (45%), Gaps = 22/229 (9%)

Query: 1210 LVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVS---INIEILEEYAKRLVEFKKRK 1266
            ++ + I +  DK+  T+D   ++ EI++L+S + N +    +  +LE   K L   +   
Sbjct: 855  IIEKYIEKCKDKDNLTVDF--IDREISRLESTLKNTNEEKTSALLLENNNKELKVIEDGM 912

Query: 1267 IDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSL 1326
             DL   +       +++ +  + + +  ++G   IS    +++  +   G  +LE  ++ 
Sbjct: 913  PDLEGKLKSTKSQIAVLRDNTEPKIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNF 969

Query: 1327 DPFSEGVTFSVMPPKKSWRNITNLS--GGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1384
              +   +        +S R +T+ S  GGEK +S+   + +L  +   P  V+DEI+  +
Sbjct: 970  SNWQVKILVK-FRDNESVRELTSQSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGM 1028

Query: 1385 DFRNVSIVANYIKERT---KNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
            D RN  I+   + E       +Q+I+++         K L  +Y HE M
Sbjct: 1029 DSRNEKIIHRIMVENACEDNTSQYILVT--------PKLLTDLYYHEKM 1069

 Score = 39.3 bits (90), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 20/75 (26%)

Query: 140 IQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA-GEQTIGPFDASFSAV 198
           I+LSPI+         YD + A         I K+ + NF +Y   E  + P   SF+ +
Sbjct: 36  IKLSPIQ---------YDDYQAG-------SIIKIKMKNFMTYGLVEYQLCP---SFNMI 76

Query: 199 VGPNGSGKSNVIDSM 213
           +GPNGSGKS V+ ++
Sbjct: 77  IGPNGSGKSTVVCAL 91

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L G++ HE M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 18/160 (11%)

Query: 176 LHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 233
           L +F +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 234 HKSERFTNLNFCSVEVHFR---YVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFIN 290
              +     +   +E+  +    V D        +T++   T +ITR   +   S Y IN
Sbjct: 104 KNGQ-----DVSRIEITLKNSPKVNDIENVNAHDETIKI--TRIITRSKRR---SDYLIN 153

Query: 291 GKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
             E + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 154 DCEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L G++ HE M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 40.0 bits (92), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (47%), Gaps = 20/166 (12%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L +F +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAP--TDGDTMEAEN-TLVITRKAFKNN-S 284
           + D I   +     +   +E+  +       +P  TD + ++A + T+ ITR   ++   
Sbjct: 99  VEDFIKNGQ-----DVSKIEITLK------NSPNVTDIEYIDARDETIKITRIITRSKRR 147

Query: 285 SKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           S Y IN  + + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 148 SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  +Y HE M
Sbjct: 1047 IT--------PKLLTDLYYHEKM 1061

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 18/165 (10%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L +F +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 229 LSDLIHKSERFTNLNFC---SVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSS 285
           + D I   +  + +      S ++H     D     T  +T++   T +ITR   +   S
Sbjct: 99  VEDFIKNGQDTSRIEITLKNSPKIH-----DIEFINTHDETIKV--TRIITRSKRR---S 148

Query: 286 KYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
            Y IN ++ +   V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 149 DYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 30/166 (18%)

Query: 1276 RNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1335
            R ++ SI  EL+  R +E +E    IS   ++++  + +G   E+ LV   D +SE    
Sbjct: 920  RRKMWSIRSELEP-RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK-- 970

Query: 1336 SVMPPKKSWRNITNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1387
              +  K  +R++  L        SGGE+ +S++  + +L ++   P  V+DEI+  +D R
Sbjct: 971  --IEIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDAR 1028

Query: 1388 NVSIVANYIKER--TKN-AQFIVISLRNNMFELAKQLVGIYKHENM 1430
            N  IV   + E    KN +Q+ +I+         K L  ++ HE M
Sbjct: 1029 NERIVHKAMVENACAKNTSQYFLIT--------PKLLTDLHYHERM 1066

 Score = 39.7 bits (91), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I KL L NF +Y+  E  + P   S + ++GPNGSGKS+ + ++      +   + R  +
Sbjct: 46  IIKLRLVNFVTYSLTEFHLSP---SLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAKK 102

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
           + D I      +      +E+  +  K        G + E  N   +  KA K     Y+
Sbjct: 103 VEDFIKNGTEES-----VIELTVKNSKAVSGYSMIGGSDEVINIKTVIMKAKKK--CIYY 155

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           ING+     +V  L+    I LD+    + Q  VE  A++K+
Sbjct: 156 INGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS 197

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I KL L NF +Y+  E  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 69  IVKLRLENFVTYSLTEFHLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKR 125

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYF 288
           +   I   E     N   +EV  +  +D       G  +  + T  ++R  +    S+Y+
Sbjct: 126 VDSFIKNGE-----NRGLIEVTLK--RD---PGRTGSFVAVDGTTKVSRVLWVGKKSEYY 175

Query: 289 INGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           +N +  +   V  L+ E  I LD+    + Q  VE  A++K+
Sbjct: 176 LNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLKS 217

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 93/220 (42%), Gaps = 55/220 (25%)

Query: 1217 RLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNNSVGER 1276
            R ++KEL T     LN  I Q+Q+ +N+++I IE            K+R +   N  G  
Sbjct: 916  RQTEKELET-----LNRSIPQIQASLNDLTIAIE------------KERSVLEPNVDG-- 956

Query: 1277 NQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1336
                              +EG   IS+    ++Q +  GG+  LE  +    +   +   
Sbjct: 957  -----------------IVEG---ISINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVR 996

Query: 1337 VMPP---KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1393
                   KK    I   SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV 
Sbjct: 997  FRDSALMKKLDSQIQ--SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVH 1054

Query: 1394 NYIKERT---KNAQFIVISLRNNMFELAKQLVGIYKHENM 1430
              + E     K +Q+I+++         K L  ++ HE +
Sbjct: 1055 KAMVENACAEKTSQYILVT--------PKLLTNLHYHEKV 1086

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 13/105 (12%)

Query: 139 LIQLSPIKNSRLE------LQKLYDAHNAKIGKMNRL--YIHKLVLHNFKSYAG-EQTIG 189
           + Q S + NSR++      L +  D  +  IG ++    YI KL LHNF  +   +  +G
Sbjct: 40  MTQYSSMPNSRVDTEADAALGRRVDCAHRDIGLISPPPGYIKKLTLHNFMCHRNFDVELG 99

Query: 190 PFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 233
           P     + +VG NGSGKS ++ ++    G +A++  R   L DLI
Sbjct: 100 P---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSSLKDLI 141

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1337 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1397 KERTK---NAQFIVIS 1409
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  +Y HE M
Sbjct: 1035 IT--------PKLLTDLYYHEKM 1049

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I KL L N  +Y+  E  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 229 LSDLIHKSERFTNLNFCSVEVHFR-YVKDEYTAPTDGDTMEAENTLVITRKAFKNNS-SK 286
           + + I   E     N   ++   R ++ +E               + ITR   +N   S+
Sbjct: 94  IDNFIKNGE-----NTAQIDTFLRGHMPNE--------------VIKITRIMTRNKKKSE 134

Query: 287 YFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA-----KAEKDNEDGLL 341
           Y+I+   S  T V KL  E  I LD+    + Q  VE+ A++K+     +  +     LL
Sbjct: 135 YYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLL 194

Query: 342 EYLEDI 347
           E LED+
Sbjct: 195 ETLEDL 200

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1335 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1394
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1395 YIKERTKN---AQFIVIS 1409
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 227
           YI K+VL NF  +   E  +GP     + +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 228 RLSDLI 233
            L DLI
Sbjct: 131 SLKDLI 136

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 26/141 (18%)

Query: 1301 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SG 1352
            IS     ++  +   G  EL+  DS + +        +  K  +R+ + L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1353 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1409
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV   + E       +Q+ +I+
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1410 LRNNMFELAKQLVGIYKHENM 1430
                     K L  ++ HE M
Sbjct: 1076 --------PKLLTNLFYHERM 1088

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 102/236 (43%), Gaps = 39/236 (16%)

Query: 173 KLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 230
           KL L NF +YA  E  + P   S + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 62  KLKLTNFVTYALTEFHLSP---SLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVE 118

Query: 231 DLIHKS--ERFTNLNF--CSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSK 286
           + I     E    +     S  +H     D     TD D +  +  L + +K      SK
Sbjct: 119 EYIKNGTDEGVIEITLKNSSALLH----SDFNMINTDDDVVHVKRVLSMEKK-----KSK 169

Query: 287 YFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA-----KAEKDNEDGLL 341
           Y+IN K      V  +++   I LD+    + Q  VE  A++K      +  +  E GLL
Sbjct: 170 YYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGLL 229

Query: 342 EYLEDIIGTKHYKPLIEQKTVEIEAMNELCIE---KENRFRIVDDEKNSLEKDKDA 394
           E L ++            K+++ E  NEL I+   KEN+ + +   + +LE    A
Sbjct: 230 EKLSEL------------KSLQAEG-NELQIDLGAKENKLKELTSSRAALESQAHA 272

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1407
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1408 ISLRNNMFELAKQLVGIYKHENM 1430
            I+         K L  ++ HE M
Sbjct: 1074 IT--------PKLLTDLHYHEKM 1088

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 73/180 (40%), Gaps = 31/180 (17%)

Query: 171 IHKLVLHNFKSYA-GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L NF +Y   E  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 229 LSDLIHKSERFTNLNFCSVEVHFRYVKD---------------EYTAPTD---GDTMEAE 270
           + D I   E     +   +E+  + V+                   A  D   G     +
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIK 163

Query: 271 NTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
            T +I R   K   S Y+IN K  +   V  L+K   I LD+    + Q  VE  A++K+
Sbjct: 164 FTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKS 220

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K+ L NF  +   E  +GP     + +VG NGSGKS ++ ++    G +A+   R +
Sbjct: 63  YIKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGN 119

Query: 228 RLSDLI 233
            L +LI
Sbjct: 120 SLKELI 125

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1351 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1405
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1406 IVISLRNNMFELAKQLVGIYKHENM 1430
             +I+         K L G+  HE M
Sbjct: 1058 FLIT--------PKLLTGLNYHEKM 1074

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 18/174 (10%)

Query: 171 IHKLVLHNFKSY-AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           I K+ L NF +Y   E  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 229 LSDLIHKSERFTNLNFC-----SVEVHFRYVKDEYTAPTDGD-------TMEAENTLVIT 276
           + D I   +  + +        ++++ F      +    +G+       T   E    I 
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEF-LGSSFHRIRNNGNYKGLLTITRNLEKRTKIG 153

Query: 277 RKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKA 330
           R   K  + +Y ING  +  + V  L+ +  I LD+    + Q  VE  A+++ 
Sbjct: 154 RNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 170 YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           YI K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 229 LSDLIH 234
           L DLI 
Sbjct: 145 LKDLIR 150

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
           YLR383W
          Length = 1098

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K+ L NF  +   E T+GP     + +VG NGSGKS ++ ++    G +AN   R +
Sbjct: 70  YIKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGN 126

Query: 228 RLSDLI 233
            L DLI
Sbjct: 127 SLKDLI 132

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 64/142 (45%), Gaps = 20/142 (14%)

Query: 1288 KKRYNEFMEGFSIISMTLKEM-----YQMITMGGNAELELVDSLD--PFSEGVTFS---- 1336
            K++Y E     SI++ ++K       YQ  +   +A+ +  +SL    F   + F     
Sbjct: 924  KEKYIEMDNALSILNHSIKSRTVNFGYQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKE 983

Query: 1337 ----VMPPK--KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1390
                   P+  K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  
Sbjct: 984  TLNVYTGPQTDKEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRK 1043

Query: 1391 IVANYIKERTKN---AQFIVIS 1409
                 I ++ K+    Q I+I+
Sbjct: 1044 TSTQLIVQKLKDDSRTQTIIIT 1065

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 36.6 bits (83), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 170 YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           YI K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 229 LSDLI 233
           L DLI
Sbjct: 140 LKDLI 144

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 170 YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           YI K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 229 LSDLI 233
           L DLI
Sbjct: 139 LKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.6 bits (83), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 170 YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           YI K++L NF  +  E       +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCH--EHFELELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 229 LSDLI 233
           L DLI
Sbjct: 139 LKDLI 143

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K++L NF  +   E  +GP     + +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 75  YIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGN 131

Query: 228 RLSDLI 233
            + DLI
Sbjct: 132 AMKDLI 137

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K+VL NF  +   E  +GP     + +VG NGSGKS ++ ++    G +A +  R +
Sbjct: 81  YIKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGN 137

Query: 228 RLSDLI 233
            L DLI
Sbjct: 138 SLKDLI 143

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRAN 222
           YI ++ L NF  +   E   GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1391
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTI 1047

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1348 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1407
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1408 ISL 1410
            IS+
Sbjct: 655  ISI 657

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 97/240 (40%), Gaps = 54/240 (22%)

Query: 1204 VDDCGDLVSQGIPRL---------SDKELSTIDTDNLNEEINQLQSFINNVSINIEILEE 1254
            +DD   ++S+G  R+         S+K++         E + ++  F + +   I   E 
Sbjct: 811  LDDLKHIISKGSSRIEKLQDDIGFSEKKVEKYQQKR-TELLQKINEFSDGIGTQISNAET 869

Query: 1255 YAKRLVEFK----------KRKID--------LNNSVG-ERNQLTSIMEELKKKRYNEFM 1295
            Y  R V F           K +ID          N VG  ++Q+ S+ E  K K Y +  
Sbjct: 870  YCTRAVAFAGDMPETREDTKAEIDRITHRIQLAENRVGLSQDQIMSLFESAKLK-YKDAE 928

Query: 1296 EGFSIISM-------TLKEMYQMITMGGN-----AELELVDSLD--PFSEGVTFSV---- 1337
            + F+ +         +LK  +Q +T         A+ +  +SL    FS G+ F+     
Sbjct: 929  QKFANVDKAVFQLNESLKRRWQSLTYAKTDTCVTADTDFKESLRFRNFSGGLNFNFSKET 988

Query: 1338 ------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1391
                   P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I
Sbjct: 989  LNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQI 1048

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 27/119 (22%)

Query: 170 YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           YI K++L NF  +  E        + + +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCH--ENFSVELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 229 LSDLIHKSERFTNLNFCSVEVH--------------FRYVKDEYTAPTDGDTMEAENTL 273
           L +LI K       N   V +H              F Y  D+Y     GD +  E T+
Sbjct: 130 LKELIRKG-----CNSSKVTLHLDNNKGDLDINGKDFAYKHDQY-----GDIIIIERTI 178

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1391
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1399
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1400 TKNAQFIVISLRN--NMFELAKQLVGIYKHEN 1429
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K++L NF  +   E  +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 74  YIKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 130

Query: 228 RLSDLIHKSERFT 240
            L DLI K  R++
Sbjct: 131 SLKDLI-KEGRYS 142

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1391
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
           Anc_4.237 YLR383W
          Length = 1119

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           YI K+ L NF  +   E   GP     + +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 84  YIKKIKLRNFMCHENFEMEFGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGN 140

Query: 228 RLSDLI 233
            L DLI
Sbjct: 141 SLKDLI 146

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRAN 222
           Y+ ++ L NF  +   E   GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1396
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
           YNL250W
          Length = 1306

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 171 IHKLVLHNFKSY-AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFV 216
           IHKL +   +S+ + ++    F A  + +VG NGSGK+ VI+ + + 
Sbjct: 4   IHKLSIQGIRSFDSNDRETIEFGAPLTLIVGMNGSGKTTVIECLKYA 50

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1329 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1388
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1389 VSIVANYIKERT 1400
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1329 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1386
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1387 RNVSI----VANYIKERTKNAQFIV 1407
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 170 YIHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 227
           +I K+ L NF  +   E  +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 69  FIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 125

Query: 228 RLSDLI 233
            L DLI
Sbjct: 126 SLKDLI 131

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 171 IHKLVLHNFKSYAG-EQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 228
           + K++L NF  +   E  +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 229 LSDLIHKS 236
           L DLI + 
Sbjct: 129 LKDLIREG 136

 Score = 35.8 bits (81), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1345 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1402
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1403 -AQFIVIS 1409
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1373 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1424 IYKHENMTKNA 1434
              K  +  K+ 
Sbjct: 999  FIKKVDSCKSC 1009

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 1373 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1424 IYKHENMTKNA 1434
              K  +  KN 
Sbjct: 995  FVKKVDSCKNC 1005

>TPHA0F01190 Chr6 complement(270259..272235) [1977 bp, 658 aa] {ON}
           Anc_2.263 YIL108W
          Length = 658

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 14  GEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSPLDFKKTVTPRKLII 73
           G++ V+P   L        NDE   N  +    H  LP L   ++   F+ TV     I+
Sbjct: 13  GDELVSPALIL---HGKVNNDE---NGKSIKVFHPQLPSLSYPINENHFRATV-----IL 61

Query: 74  GPSENKYALSQPTTSASSSLQV---PALQQKLVPLS 106
            P ENK+ LS  T +++S ++V   P L  + + L 
Sbjct: 62  TPGENKFTLSTDTGNSTSIIKVNYTPMLNDQPIHLC 97

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1329 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1388
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1389 VSIVANYIKERTKNAQFIVISL 1410
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1890

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 49/87 (56%), Gaps = 7/87 (8%)

Query: 1047 IAHAKARAEVAKNSLLDINKSLESIQDEK----INLEQELENFSD---KLHESNENVNEF 1099
            I  +++R E+ K  ++ + K+LESI+ +K      ++Q+ + F +    LHE+   +NE+
Sbjct: 1406 IRQSQSREELHKEQIVRLKKNLESIEYQKGLLLTTIDQQKKRFDECVQDLHENETQLNEY 1465

Query: 1100 KTIQLELENKIERANSILSYLKKENGQ 1126
            K    + E+ +   +SI+  LK +N Q
Sbjct: 1466 KLALKQAESDVNSMSSIIEKLKSQNKQ 1492

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
            (REAL)
          Length = 692

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 8/95 (8%)

Query: 1350 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVI 1408
            LSGG+K   +LA  F L       L ++DE  +ALD ++  IVA  +++R  +    I I
Sbjct: 575  LSGGQKQRIALARAFLLDP----ALLILDEATSALDSQSEEIVAKNLQKRVERGLTTISI 630

Query: 1409 SLRNNMFELAKQLVGIYKHENMTKNATIRNREDLI 1443
            + R +  + + +++ + KH ++ +  + R   DLI
Sbjct: 631  AHRLSTIKHSTRIIVLGKHGSVVETGSFR---DLI 662

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 1350 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1403
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +  
Sbjct: 590  LSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG 639

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,365,039
Number of extensions: 6132279
Number of successful extensions: 36503
Number of sequences better than 10.0: 986
Number of HSP's gapped: 36130
Number of HSP's successfully gapped: 1942
Length of query: 1444
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1322
Effective length of database: 39,492,147
Effective search space: 52208618334
Effective search space used: 52208618334
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)