Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020108.258ON42442422270.0
KAFR0B027008.258ON42042915310.0
TDEL0F038508.258ON41942215250.0
Smik_12.1448.258ON43843815030.0
NDAI0B019608.258ON43944014960.0
NCAS0B049908.258ON42042414920.0
Kpol_543.368.258ON42742814890.0
YLR085C (ARP6)8.258ON43843714760.0
Suva_10.1698.258ON43843714700.0
ZYRO0C01738g8.258ON41442514590.0
TBLA0H014608.258ON44244514600.0
Skud_12.1538.258ON43843714450.0
SAKL0H17138g8.258ON41942314140.0
KLTH0G13772g8.258ON42042314000.0
CAGL0L12166g8.258ON42142213930.0
AGR091W8.258ON41042313770.0
Kwal_56.238328.258ON41942213710.0
Ecym_43128.258ON41142313570.0
KLLA0F19063g8.258ON41542213350.0
TPHA0A018308.258ON42142513210.0
TBLA0C004408.23ON3754212524e-23
NCAS0C037008.23ON3754212524e-23
NDAI0G030408.23ON3754212525e-23
TDEL0C004708.23ON3754212515e-23
CAGL0K12694g8.23ON3754212515e-23
Suva_6.188.23ON3754212515e-23
Smik_6.398.23ON3754212515e-23
YFL039C (ACT1)8.23ON3754212515e-23
SAKL0B00968g8.23ON3754212515e-23
ABR222W8.23ON3764212516e-23
TPHA0D002508.23ON3754212516e-23
KNAG0L002508.23ON3754212516e-23
KAFR0D009408.23ON3754212516e-23
ZYRO0F02772g8.23ON3754212516e-23
Ecym_15208.23ON3764212507e-23
KLLA0D05357g8.23ON3754212509e-23
KLTH0G18832g8.23ON3754212491e-22
Kpol_1058.158.23ON3754212472e-22
Skud_6.318.23ON3603772435e-22
Kwal_14.11098.23ON3603772429e-22
Ecym_63852.117ON3774312216e-19
NDAI0G029003.161ON3913832182e-18
SAKL0E11814g2.117ON3794322162e-18
AFR051W2.117ON4054192074e-17
ZYRO0B04928g3.161ON3913842041e-16
NCAS0C035503.161ON3923832022e-16
KLTH0F06490g3.161ON3913832012e-16
YDL029W (ARP2)3.161ON3913831986e-16
Smik_4.2063.161ON3913831978e-16
KLLA0E22925g2.117ON3804261978e-16
TBLA0F008703.161ON3913851952e-15
Suva_4.2203.161ON3913831952e-15
ADR316W3.161ON3913831942e-15
SAKL0C07370g3.161ON3913841942e-15
Kwal_33.141773.161ON3373201904e-15
Skud_4.2223.161ON3913831915e-15
NDAI0B044602.117ON3814241905e-15
TDEL0D046103.161ON3913831915e-15
CAGL0K01595g3.161ON3913831905e-15
NCAS0B071302.117ON3814311889e-15
KLLA0C03850g3.161ON3913831881e-14
Ecym_52373.161ON3913841881e-14
TPHA0I013002.117ON3794151862e-14
Kwal_23.48482.248ON7451361882e-14
KNAG0K01130na 1ON3933851853e-14
Kpol_479.253.161ON3913841853e-14
ZYRO0G05676g2.117ON3814231826e-14
KAFR0C01040na 1ON3373281808e-14
Kpol_1023.188.23ON3193381781e-13
TDEL0C041402.248ON7491411802e-13
KNAG0I018602.248ON7531381775e-13
Skud_8.1902.117ON3844251747e-13
KAFR0F005902.117ON3864281738e-13
NDAI0D010602.248ON7531381758e-13
ZYRO0G01936g1.514ON4613891731e-12
SAKL0E08602g2.248ON7471371741e-12
TDEL0B048102.117ON3734231702e-12
TPHA0A009203.161ON3913831712e-12
TPHA0C031602.248ON7551331722e-12
YNL059C (ARP5)2.248ON7551331722e-12
KNAG0B001701.514ON4533891712e-12
TPHA0O010401.514ON4582541703e-12
YHR129C (ARP1)2.117ON3844221693e-12
Smik_8.2102.117ON3844251693e-12
KLLA0B13904g1.514ON4563921694e-12
Kpol_1003.162.248ON7491351695e-12
ADL253C2.248ON7511351686e-12
KLTH0G09482g2.248ON7451341679e-12
KLTH0B05940g2.117ON3834341659e-12
Suva_12.1541.514ON4493891669e-12
KLLA0F03421g2.248ON7471461661e-11
Skud_10.2891.514ON4494281641e-11
Suva_15.3262.117ON3844241631e-11
Smik_14.2672.248ON7551331642e-11
NCAS0A122701.514ON4544241622e-11
CAGL0F00517g1.514ON4543891622e-11
YJR065C (ARP3)1.514ON4493891623e-11
Skud_14.2722.248ON7551351633e-11
Smik_10.3551.514ON4493891623e-11
Kpol_1056.161.514ON4603891613e-11
Ecym_63301.287ON4805071613e-11
Suva_14.2812.248ON7551331624e-11
KLTH0C02508g1.514ON4513271604e-11
TBLA0D036801.514ON4583821604e-11
SAKL0D12804g1.514ON4563891604e-11
Ecym_32852.248ON7461341615e-11
TDEL0F004701.514ON4613891596e-11
NDAI0A039701.514ON4623891587e-11
AFR419C1.514ON4553891579e-11
CAGL0J10054g2.248ON7541341599e-11
Ecym_31531.514ON4583901571e-10
ZYRO0A01584g2.248ON7481311562e-10
TBLA0E038602.248ON7591361544e-10
Kwal_27.99581.514ON4453271524e-10
KAFR0D037001.514ON4493891515e-10
TBLA0B010702.117ON3834211481e-09
CAGL0H09042g2.117ON3874181481e-09
Kwal_33.146422.117ON3834331434e-09
KNAG0H036502.117ON3874221426e-09
KAFR0J011602.248ON7511381312e-07
NCAS0G030502.248ON7431201312e-07
Kpol_282.41.287ON5011061284e-07
Suva_6.1541.287ON4892191266e-07
ACR184C7.448ON4012711266e-07
TBLA0D053601.287ON5961871204e-06
Smik_10.1611.287ON4892191195e-06
KLTH0H09702g1.287ON4811051186e-06
YJL081C (ARP4)1.287ON4892191187e-06
NDAI0G055801.287ON5152321178e-06
AFR105C1.287ON4791051151e-05
SAKL0F13772g7.448ON4222961142e-05
Skud_10.1321.287ON4882191142e-05
SAKL0D05874g1.287ON4971451124e-05
TPHA0I010301.287ON5031061124e-05
KLLA0D02288g1.287ON5201051107e-05
KLTH0C05324g7.448ON3992771081e-04
KAFR0A015601.287ON4851051081e-04
CAGL0M03201g1.287ON4932351071e-04
Kwal_27.105527.448ON3512461062e-04
NCAS0B060601.287ON4971461053e-04
Kwal_14.23771.287ON4811121043e-04
TDEL0D015501.287ON480891043e-04
KNAG0B019201.287ON5051051017e-04
ZYRO0G21428g1.287ON483105960.003
CAGL0K05335g7.448ON52986880.030
Kpol_520.117.448ON488194810.18
KNAG0E039404.318ON1478141760.86
YCL047C (POF1)1.27ON25848721.7
Skud_3.171.27ON25848721.8
KLLA0E06315g7.448ON43879712.8
Suva_3.1661.27ON25848694.2
Suva_16.4033.372ON680103696.0
Kwal_27.113078.348ON47955686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02010
         (424 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   862   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   594   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   592   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   583   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   580   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   579   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   578   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   573   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   570   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   566   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   566   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   561   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   549   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   543   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   541   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   535   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   532   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   527   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   518   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   513   0.0  
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   101   4e-23
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   101   4e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   101   5e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   101   5e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   101   5e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   101   5e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   101   5e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   101   5e-23
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   101   5e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   101   6e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   101   6e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   101   6e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   101   6e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   101   6e-23
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   100   7e-23
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   100   9e-23
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   100   1e-22
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   100   2e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    98   5e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    98   9e-22
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    90   6e-19
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    89   2e-18
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    88   2e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    84   4e-17
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    83   1e-16
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    82   2e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    82   2e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    81   6e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    80   8e-16
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    80   8e-16
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    80   2e-15
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    80   2e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    79   2e-15
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    79   2e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    78   4e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    78   5e-15
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    78   5e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    78   5e-15
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    78   5e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    77   9e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    77   1e-14
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   1e-14
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    76   2e-14
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    77   2e-14
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    76   3e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    76   3e-14
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    75   6e-14
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    74   8e-14
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    73   1e-13
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    74   2e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    73   5e-13
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    72   7e-13
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    71   8e-13
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    72   8e-13
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    71   1e-12
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    72   1e-12
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    70   2e-12
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    70   2e-12
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    71   2e-12
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    71   2e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    70   2e-12
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    70   3e-12
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    70   3e-12
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    70   3e-12
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    70   4e-12
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    70   5e-12
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    69   6e-12
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    69   9e-12
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    68   9e-12
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    69   9e-12
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    69   1e-11
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    68   1e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    67   1e-11
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    68   2e-11
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    67   2e-11
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    67   2e-11
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    67   3e-11
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    67   3e-11
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    67   3e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    67   3e-11
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    67   3e-11
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    67   4e-11
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    66   4e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    66   4e-11
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    66   4e-11
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    67   5e-11
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    66   6e-11
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     65   7e-11
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    65   9e-11
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    66   9e-11
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    65   1e-10
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    65   2e-10
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    64   4e-10
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    63   4e-10
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    63   5e-10
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    62   1e-09
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    62   1e-09
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    60   4e-09
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    59   6e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    55   2e-07
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    55   2e-07
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    54   4e-07
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    53   6e-07
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    53   6e-07
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    51   4e-06
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    50   5e-06
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    50   6e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    50   7e-06
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    50   8e-06
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    49   1e-05
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    49   2e-05
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    49   2e-05
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    48   4e-05
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    48   4e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    47   7e-05
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    46   1e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    46   1e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    46   1e-04
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    45   2e-04
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    45   3e-04
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    45   3e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    45   3e-04
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    44   7e-04
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    42   0.003
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    39   0.030
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    36   0.18 
KNAG0E03940 Chr5 (776891..781327) [4437 bp, 1478 aa] {ON} Anc_4....    34   0.86 
YCL047C Chr3 complement(43661..44437) [777 bp, 258 aa] {ON}  POF...    32   1.7  
Skud_3.17 Chr3 complement(31746..32522) [777 bp, 258 aa] {ON} YC...    32   1.8  
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    32   2.8  
Suva_3.166 Chr3 complement(253416..254192) [777 bp, 258 aa] {ON}...    31   4.2  
Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {...    31   6.0  
Kwal_27.11307 s27 (741350..742789) [1440 bp, 479 aa] {ON} YLR142...    31   6.7  

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/424 (96%), Positives = 411/424 (96%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHE 60
           MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHE
Sbjct: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHE 60

Query: 61  LGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFE 120
           LGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFE
Sbjct: 61  LGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFE 120

Query: 121 EYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGF 180
           EYEFATMFKSPASGFMPFANLIGNKNMEHLCGK             KEYRDFQLVIDSGF
Sbjct: 121 EYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGF 180

Query: 181 NCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFV 240
           NCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFV
Sbjct: 181 NCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFV 240

Query: 241 SPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPE 300
           SPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPE
Sbjct: 241 SPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPE 300

Query: 301 TFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQR 360
           TFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQR
Sbjct: 301 TFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQR 360

Query: 361 QLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTY 420
           QLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTY
Sbjct: 361 QLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTY 420

Query: 421 QNWI 424
           QNWI
Sbjct: 421 QNWI 424

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 338/429 (78%), Gaps = 20/429 (4%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P VIDNGSY +KFG A+L  P+ A N IA DKY ASYLSN +K+I+DISS +I+RPH LG
Sbjct: 5   PVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRPHTLG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL SWE++  IWDYCLYNPDEF+GF++GD T+ + LI +ETC TLPEL KN DQV+FEEY
Sbjct: 65  QLTSWEMQTLIWDYCLYNPDEFNGFNIGD-TKSKHLITSETCMTLPELGKNMDQVIFEEY 123

Query: 123 EFATMFKSPASGFMPFAN------LIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVI 176
           EF ++ KSP +G+MPF        +IG ++ E                  +EYRDFQLV+
Sbjct: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFV----------ETPSTEEYRDFQLVV 173

Query: 177 DSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEK 236
           DSGFNCTW++P+IKG+P+YKA+KK+DIGGRFLNGLLKETLSFRHYN+MDETIL+NNIKEK
Sbjct: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEK 233

Query: 237 CLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG-SVQTITLTDER 295
           CLFVSP SYFDSFK K   + EYVLPDFQTSFLGY V  SN +G       Q+ITL DE 
Sbjct: 234 CLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGY-VRPSNEQGKPLPEDSQSITLKDEL 292

Query: 296 FAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLT 355
           FAVPETFFHPE++ ILKPGLVETILE++SM+PE +RP++VSNI+C+GGNF LPH +SR+ 
Sbjct: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352

Query: 356 SELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSK 415
            ELQRQLPTDW CR+T+ S  + EL+ W AM+ F+STD+YK TRVTREEY EHG DWC+K
Sbjct: 353 KELQRQLPTDWKCRITI-SKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTK 411

Query: 416 HRFTYQNWI 424
           HRF YQNW+
Sbjct: 412 HRFGYQNWV 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/422 (63%), Positives = 333/422 (78%), Gaps = 7/422 (1%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P V+DNGSYE+KFG++    PFRA N +A+DK+GA+YLSN +  I+DISS + +RPHE G
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL SWEL+ C+WDYC +NP+EFDGF L D ++ Q LI +ETC TLPELSKN DQVVFEEY
Sbjct: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKD-SKGQHLIASETCMTLPELSKNMDQVVFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFNC 182
           EF ++ K+P SGFMPF+     +N + + GK             K+Y  FQ+VIDSGFNC
Sbjct: 124 EFDSLLKAPISGFMPFSK--HTENTKVISGKGDSESGTSTSET-KDYEPFQMVIDSGFNC 180

Query: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242
           TWVVPIIKGVPFYKA+KK+D+GGRF+NGLLKETLSFRHYN+MDETIL+NNIKEKCLF+SP
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302
           VSYFDSF  K Q AVEYVLPDFQT+FLGY+ D  N    D    QT+TL DE F+VPETF
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKD---AQTVTLRDELFSVPETF 297

Query: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362
           FHPE+A +LKPG++ETILE++S+VPEPLRP++VSNI+C GGNF LPH   RL +ELQRQL
Sbjct: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357

Query: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422
           PTDW+ ++ +P    CELA W +M+ F+STD+YK  RV+R+EY EHG +W +K+RF YQN
Sbjct: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417

Query: 423 WI 424
           WI
Sbjct: 418 WI 419

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/438 (62%), Positives = 327/438 (74%), Gaps = 18/438 (4%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
            P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHEL
Sbjct: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQL  WELE CIWDYC +NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEE
Sbjct: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEE 122

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXX--------------- 166
           YEF ++FKSP + F+PF     +K M+ + GK                            
Sbjct: 123 YEFDSLFKSPVAAFVPFTKSYKSK-MKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFD 181

Query: 167 KEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDE 226
            +Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+D+GGRFL GLLKETLSFRHYNMMDE
Sbjct: 182 SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDE 241

Query: 227 TILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
           TIL+NNIKEKCLFVSPVSYFDSFK K + A+EYVLPDFQTSFLGY+ +            
Sbjct: 242 TILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDA 301

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
           QTITLTDE F +PETFFHPE+A I KPG+VE ILE++SM+PE +RP++V NIVC GGNF 
Sbjct: 302 QTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFN 361

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYL 406
           LP+ + RL +ELQRQLPTDWTC V+VP  SDC L  W  M+QFSST  Y+  RVTREEY 
Sbjct: 362 LPNFAQRLAAELQRQLPTDWTCHVSVP-ESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 407 EHGTDWCSKHRFTYQNWI 424
           EHG+DWC+KHRF YQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/440 (60%), Positives = 340/440 (77%), Gaps = 21/440 (4%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
            P V+DNGSYEIKFG +N   P+RA NG A DKYG++YLSN MK I+++S  T+RRPHEL
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQL SWELE CIWDYCLYNPDEFDGF LG + ++  LI++E C TLPELSKN DQV+FEE
Sbjct: 64  GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKH-LIVSEPCMTLPELSKNMDQVIFEE 122

Query: 122 YEFATMFKSPASGFMPFA-----------NLIGNKNMEHLCGKXXXXXXXX------XXX 164
           YEF ++FK+P +G++PF             + G KN + + G+                 
Sbjct: 123 YEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKK 182

Query: 165 XXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM 224
              +Y+D++LVIDSGFNCTW++P+IKGVP+YKAIKK+DIGGRFL GLLKETLSFRHY++M
Sbjct: 183 FSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLM 242

Query: 225 DETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
           DET+L+NNIKEKCLFVSP SYFDSFK K++ +VEY+LPD  +S+LGY   E+  K +  G
Sbjct: 243 DETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGY-TRENKSKPLPEG 301

Query: 285 SVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGN 344
           S Q + L DE F+VPETFFHPE++ ILKPG+VETILE++SM+PE LRP+LV+NIVC GGN
Sbjct: 302 S-QVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREE 404
           F LPH ++RL +ELQRQLPTDWTCR++VP   +CEL +W +M QF++TD YK TR+++EE
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVP-KKECELFSWKSMCQFANTDSYKKTRISKEE 419

Query: 405 YLEHGTDWCSKHRFTYQNWI 424
           Y EHG DW +KH+F YQNW+
Sbjct: 420 YYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/424 (65%), Positives = 334/424 (78%), Gaps = 10/424 (2%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P  IDNGSYEIKFG  +L +P+RA N  A DKY  +YLSN +K I+DI+S T RRPHELG
Sbjct: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL SWELE  IWDY L+NPDEF GF L D  + + LI +ETC TLPELSKN DQVVFEEY
Sbjct: 65  QLTSWELESSIWDYALFNPDEFPGFDLND-LKGKHLIASETCMTLPELSKNMDQVVFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXX--XXXXXXXXXXKEYRDFQLVIDSGF 180
           EF + +KS  +GF+ FA+   +KN + + GK               KEY D+QLVIDSGF
Sbjct: 124 EFDSYYKSSIAGFIQFAD---DKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180

Query: 181 NCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFV 240
           NCTW++P+IKGVP+YKA+KK+DIGGRFL+GLLKETLSFRHY++MDETIL+NNIKE CLFV
Sbjct: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240

Query: 241 SPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPE 300
           SP SYFDSFK K + AVEYVLP+FQT+FLG++ D++  K +   + QTI L DE F+VPE
Sbjct: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKT--KPLPENT-QTIKLYDELFSVPE 297

Query: 301 TFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQR 360
           TFFHPE+A ILKPGLVETILE++SMVPE LRP+LV N+VC GGNF LPH ++RLTSELQR
Sbjct: 298 TFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQR 357

Query: 361 QLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTY 420
           QLPTDW CR +VP + +CEL  W AMAQF+ST+ Y+ TRVTREEY EHGTDW +K+RF Y
Sbjct: 358 QLPTDWICRTSVP-TKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGY 416

Query: 421 QNWI 424
           QNWI
Sbjct: 417 QNWI 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/428 (63%), Positives = 334/428 (78%), Gaps = 11/428 (2%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P VIDNGSYE+KFG+++   P RA N +AKDKYGA YLSN M  I+DISS TIRRPHELG
Sbjct: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QLVSWELEG +WDYC +NPDEF  F+L + T+   L+++ETC TLPELS N DQV+FEEY
Sbjct: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKE-TKGHHLVVSETCMTLPELSANMDQVMFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKE-----YRDFQLVID 177
           EF ++FKSP +GF+PF NL    NM+ +CGK              +     Y DF LVID
Sbjct: 124 EFESLFKSPVAGFVPFLNL--QDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVID 181

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKC 237
           SGFNCTW++PIIKGVP+YKA+KKM++GGRFLNGL KET+S+RHY++ DETIL+NNIKEKC
Sbjct: 182 SGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKC 241

Query: 238 LFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFA 297
           LF+SP SY DSFK K + +V+YVLPDFQTSF+GY+ D+ +   +   S Q ITLTDE F+
Sbjct: 242 LFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS-QVITLTDELFS 300

Query: 298 VPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSE 357
           VPET FHPEMA +LKPG+VETILE++S+VPE +RP+LV+NIVCVGGNF +P+  SRL +E
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 358 LQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTREEYLEHGTDWCSKH 416
           LQRQLPTDW C + +P   DCEL  W +M+QF+ +TD+YK  R++REEY EHGTDW +K 
Sbjct: 361 LQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKK 419

Query: 417 RFTYQNWI 424
           RF YQNWI
Sbjct: 420 RFGYQNWI 427

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 324/437 (74%), Gaps = 18/437 (4%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL  WELE CIWDYCL+NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGK---------------XXXXXXXXXXXXXK 167
           EF ++FKSP + F+PF      + M  + GK                             
Sbjct: 124 EFDSLFKSPVAVFVPFTKSYKGE-MRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGS 182

Query: 168 EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227
           +Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           IL+NNIKE+CLFVSPVSYFDSFKTK + A+EYVLPDFQTSFLGY+ +            Q
Sbjct: 243 ILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQ 302

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            ITLTDE F +PETFFHPE++ I KPG+VE ILE++SM+PE +RP++V NIVC GGNF L
Sbjct: 303 IITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362

Query: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
           P+ + RL +ELQRQLPTDWTC V+VP   DC L  W  M+QF+ TD Y+  RVTREEY E
Sbjct: 363 PNFAQRLAAELQRQLPTDWTCHVSVP-EGDCALFGWEVMSQFAKTDSYRKARVTREEYYE 421

Query: 408 HGTDWCSKHRFTYQNWI 424
           HG DWC+KHRF YQNWI
Sbjct: 422 HGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/437 (61%), Positives = 324/437 (74%), Gaps = 18/437 (4%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL  WELE CIWDYCL+NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXK--------------- 167
           EF ++FKSP + F+PF      K M  + GK             K               
Sbjct: 124 EFDSLFKSPVAVFVPFTKSYKGK-MRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNN 182

Query: 168 EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227
           +Y DFQLVIDSGF+CTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 183 DYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           IL+NNIKEKCLFVSP SYFDSFK+K +  +EYVLPDFQTSF+GY+   +          Q
Sbjct: 243 ILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQ 302

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
           +ITLTDE F +PETFFHPE++ I+KPG+VE ILE++SM+PE +RP+++ NIVC GGNF L
Sbjct: 303 SITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNL 362

Query: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
           P+ + RL  ELQRQLPTDWTC V+VP   DC L  W  M+QF+ T+ Y+  RVTREEY E
Sbjct: 363 PNFAQRLARELQRQLPTDWTCNVSVP-EGDCTLFGWEVMSQFAKTESYQRARVTREEYYE 421

Query: 408 HGTDWCSKHRFTYQNWI 424
           HG DWC+KHRF YQNWI
Sbjct: 422 HGPDWCTKHRFGYQNWI 438

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/425 (63%), Positives = 329/425 (77%), Gaps = 18/425 (4%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P V+DNGSYEIKFG  +L TP RA N +A+DK+G+ YLSN +KTI+DISS   RRPHE G
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL SWELE  IWDYC +NPDEF+GF L D ++ Q L+++ETC T+PELSKN DQVVFEEY
Sbjct: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKD-SKGQHLVVSETCMTIPELSKNMDQVVFEEY 123

Query: 123 EFATMFKSPASGFMPFAN---LIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSG 179
           EFA+MFKSP +GF PF      I  K  +    K               Y  FQLVID G
Sbjct: 124 EFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEP----------DAYEPFQLVIDVG 173

Query: 180 FNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLF 239
           FNCTWVVP+IKG+P+YKA+KK+DIGGRFLNGLLKETLSFRHYN+MDETIL+NNIKE CLF
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLF 233

Query: 240 VSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVP 299
           VSPVSYF+SFK K+Q AVEYVLPDFQTSFLGY+ D   +K + + S QT+ L DE F+VP
Sbjct: 234 VSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDP--KKPLPQDS-QTVELKDELFSVP 290

Query: 300 ETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQ 359
           ETFFHPE+  +LKPG++ETILE++S++PE LRP+++ NIVC GGNF LP+ ++RL +ELQ
Sbjct: 291 ETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQ 350

Query: 360 RQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFT 419
           RQLPTDWTC V +PS    EL  W++MA F+++ +Y   RVTREEY EHG DWC++HRF 
Sbjct: 351 RQLPTDWTCTVHLPSGPK-ELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFG 409

Query: 420 YQNWI 424
           YQNW+
Sbjct: 410 YQNWM 414

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/445 (60%), Positives = 328/445 (73%), Gaps = 28/445 (6%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
           +P VIDNGSYEIKFG +N   PFRA N IAKDKY   YLSN +K I+DISS   RRP+EL
Sbjct: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQL SWELE  IWDYC YNP+EFDGF L D T ++ L+++ETC +LPE S+N D ++FEE
Sbjct: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLED-TSKKHLVISETCLSLPEFSRNIDHIIFEE 122

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXX----------------------XXX 159
           Y + +++KSP +GF+PFA+L   K++  + GK                            
Sbjct: 123 YNYGSIYKSPVAGFIPFADL--TKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 160 XXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFR 219
                   EY+DFQL+IDSGFNCTW++P+IKG+P+YKAIKKMDIGGRFL GLLKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 220 HYNMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRK 279
           HYN+ DETIL+NNIKEKCLFV+P SY +SFK K + AVEYVLPDF T+F+GY+ D S  K
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 280 GIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIV 339
             D    Q ITL DE F+V ET FHPE++ ILKPG++ETI+E++SM+PE +RP++V+NIV
Sbjct: 301 LPDNA--QLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358

Query: 340 CVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTR 399
           C+GGNF LP+ S RLTSELQRQLPTDWT  V +P   D EL  W AMAQFS TD Y+  R
Sbjct: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIP-KIDAELFGWKAMAQFSDTDSYRKAR 417

Query: 400 VTREEYLEHGTDWCSKHRFTYQNWI 424
           +TREEY+EHG +WC+KHRF YQNWI
Sbjct: 418 ITREEYMEHGVEWCTKHRFGYQNWI 442

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 320/437 (73%), Gaps = 18/437 (4%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P VIDNGSYEIKF  +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QL  WELE CIWDYC +NP EF GF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 65  QLTLWELESCIWDYCFFNPSEFRGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXX---------------XXXXXXK 167
           EF ++FKSP + F+PF      K ++ + GK                             
Sbjct: 124 EFDSLFKSPVAVFVPFTKSYKGK-LKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDS 182

Query: 168 EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227
           +Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           IL+NN+KEKCLFVSPVSYFDSFK K + A+EYVLPDFQTSF+GY+ +            Q
Sbjct: 243 ILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ 302

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
           TI LTDE F +PETFFHPE++ I KPG+VE ILE++SM+PE +RP++V NIVC GGNF L
Sbjct: 303 TIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362

Query: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
           P+ + RL +ELQRQLPTDWTC V+VP   DC L  W  M+QF+ T+ Y+  RVTR+EY E
Sbjct: 363 PNFAQRLAAELQRQLPTDWTCHVSVP-IGDCALFGWEVMSQFAKTESYRRARVTRDEYYE 421

Query: 408 HGTDWCSKHRFTYQNWI 424
           HG DWC+K RF YQNWI
Sbjct: 422 HGPDWCTKQRFGYQNWI 438

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 319/423 (75%), Gaps = 7/423 (1%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
            P +IDNGSYE+KFG A   TPFRA N +A+DKYG  +LSN +  ++DIS+   RRPHEL
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQL SWEL+ CIWDYCLYNPDEF+ + +G NT+ + L+L+E C ++PELSK +DQVVFEE
Sbjct: 64  GQLTSWELQSCIWDYCLYNPDEFN-WEIG-NTKGKHLVLSEMCMSMPELSKGTDQVVFEE 121

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
           YEF + FK P +GF+PF       NM  +  K              EY DFQLVIDSGFN
Sbjct: 122 YEFGSCFKGPVAGFVPFNWQALEHNM--IYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241
           CTWVVPI+KG+P+YKAIKK+DIGGRFLNG LKETLSFRHYN+MDETIL+NNIKEKCLF+S
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301
           PVSYF+SF+ K+    EYVLPDFQTSF GY+  +  +   D    QTI L DE F++PET
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDS---QTIKLYDELFSIPET 296

Query: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           FFHPE+A++LKPG+VETILE+ISM+PE +RP++VSN V  GGNF + + + RL +ELQRQ
Sbjct: 297 FFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQ 356

Query: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421
            PTDW   V+VP++SD  L  W++M QFS T  Y+ TRVTREEY EHG DWC+K RF YQ
Sbjct: 357 CPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQ 416

Query: 422 NWI 424
            W+
Sbjct: 417 KWL 419

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 318/423 (75%), Gaps = 6/423 (1%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
            P VIDNGSYEIKFG A+   PF A N IAKDKYG  +LSN +++I+DISS T  RPH+L
Sbjct: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQLVSWELE  IWDYCL+NPDEFDG+ L D T+ + LI +E+C TLPELSKN DQVVFEE
Sbjct: 64  GQLVSWELESQIWDYCLFNPDEFDGWSL-DTTKNKHLIASESCMTLPELSKNMDQVVFEE 122

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
           YE+ ++FK+P   F+PF N  G+     +  +             K+YRD++LVIDSGFN
Sbjct: 123 YEYDSLFKAPVPVFVPF-NAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFN 181

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241
           CTWVVP+IKGVP+YKA+KK+DIGGRFLNG L+E LSFRHYN+MDETIL+N+IKEKCLF+S
Sbjct: 182 CTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMS 241

Query: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301
           P SYFDSF+++ + A EYVLPDF TSF GYL         D    QTI L DE FAVPET
Sbjct: 242 PNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDS---QTIILQDELFAVPET 298

Query: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           FFHPE+A++L PG++E ILE+ISM+PE LRP+LV N+V  GGNF +P+ +SRL +ELQRQ
Sbjct: 299 FFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQ 358

Query: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421
            PTDW+CRV+VP + D  L  W  M +FS T  Y+ +RV+REEY EHG DWC+  RF YQ
Sbjct: 359 CPTDWSCRVSVP-TGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQ 417

Query: 422 NWI 424
            W+
Sbjct: 418 AWL 420

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 320/422 (75%), Gaps = 10/422 (2%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELGQL 64
           VIDNGSY++KFG A+ V P  A N +AKDKYG ++LSN ++ I+DISS   RRPHELGQL
Sbjct: 8   VIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQL 67

Query: 65  VSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEYEF 124
            SWELE CIWDYCLYNPDEF G     +   + ++L+ETC TLPELSKN+DQV+FEEYE 
Sbjct: 68  TSWELESCIWDYCLYNPDEF-GIDW-QSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 125 ATMFKSPASGFMPFANLIGNKNMEHLCGKXX--XXXXXXXXXXXKEYRDFQLVIDSGFNC 182
            +++K+P + ++PF     N+N++ + GK               KEY DF LVIDSGFNC
Sbjct: 126 DSLYKAPTAAYIPFYTT--NENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNC 183

Query: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242
           TWV+PI+KGVP+YKA+KK+D+GGRFLNGLLKET+SFRHYN+MDE+IL+NNIKE+CL+V P
Sbjct: 184 TWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDP 243

Query: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302
           VSYF++FK K +  +++VLPDFQTSF GY+ D    K     + Q +TLTDERF+VPE F
Sbjct: 244 VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP---KTALPDNAQILTLTDERFSVPEAF 300

Query: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362
           FHPE++  LKPG++ET+LE+I M+PE LRP++ SNIVC+GGNF LP  + RL SELQRQL
Sbjct: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360

Query: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422
           PTDW CR  + SS D  L  W AMA+F+ TD YK  RVT+E+Y EHG DW +K RF YQN
Sbjct: 361 PTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQN 419

Query: 423 WI 424
           W+
Sbjct: 420 WV 421

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/423 (61%), Positives = 318/423 (75%), Gaps = 15/423 (3%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
           VP +++NGSYEIKFG ANL TP+RA N + +D+YG  +LSN M  IRDIS   IRRP EL
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQL+SWELE  IWDYCL+NPDEF G+ L D +++ DLI +ETC T+PE+SKN DQVVFEE
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKD-SKDVDLIASETCMTIPEISKNMDQVVFEE 120

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
           YEF +M K P + F+PF      ++ + + G                Y +FQLV+DSGFN
Sbjct: 121 YEFGSMMKCPVAQFVPFDRA---RDYDIVGGAGEVVEAKSG------YNNFQLVVDSGFN 171

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241
           CTWV+P+IKGVP+YKA KK+DIGGRFLNGLLKET+SFRHYN+MDETIL+NNIKE+C F+ 
Sbjct: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMP 231

Query: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301
           PVSYFDSF+ K++  VEY+LPDFQTS +GY+     ++ I + S Q + L DE F VPET
Sbjct: 232 PVSYFDSFQRKEETRVEYILPDFQTSLIGYV--RQPKQAIPKTS-QILRLEDELFTVPET 288

Query: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           FFHPE++NILKPGLVETILE +SMVPE LRP+LVSNIV VGGNF + + ++RL +ELQRQ
Sbjct: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348

Query: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421
            PTDW  RV  P   D  L  W +M QFS TD YK +RVTR EYLEHG DWC+KHRF Y+
Sbjct: 349 CPTDWKVRVHQP-KLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYE 407

Query: 422 NWI 424
            WI
Sbjct: 408 QWI 410

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/422 (59%), Positives = 312/422 (73%), Gaps = 7/422 (1%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62
           P +IDNGSYEIKFG  +   P RA N IAKDKYG  +LSN +++I+DISS    RPHELG
Sbjct: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64

Query: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122
           QLVSWELE  IWDYCL+NPD+F+G+ + D T+ + LI +E+C T+PELSKN DQVVFEEY
Sbjct: 65  QLVSWELETQIWDYCLFNPDDFNGWSI-DTTKGKHLITSESCMTIPELSKNMDQVVFEEY 123

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFNC 182
           EF TMFK+P   F+PF    G K+   L  K             K Y DFQLVIDSGFNC
Sbjct: 124 EFETMFKAPVPVFVPFNT--GKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNC 181

Query: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242
           +W+VP+IKGVP+YKA+KK+DIGGRFLNG L+E LSFRHYN+MDETIL+N+IKE CLF+SP
Sbjct: 182 SWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMSP 241

Query: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302
            +YF+SF+++ + A EYVLPDF TSF GYL        +     QTI L DE FAVPETF
Sbjct: 242 NAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAESQTIVLQDELFAVPETF 298

Query: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362
           FHPE+A++L  G+VETILE+ISM+PE +RP++V NIV  GGNF +P+ +SRL +ELQRQ 
Sbjct: 299 FHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQC 358

Query: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422
           PTDW+CRV++P   D  L  W  M +FS T+ Y  +RVTR+EY EHG DWC+  RF YQ 
Sbjct: 359 PTDWSCRVSLP-KGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQA 417

Query: 423 WI 424
           W+
Sbjct: 418 WL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 320/423 (75%), Gaps = 14/423 (3%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
           VP +IDNGSYEIKFG ++L +P+RA N +A+DKYG  +LSN MK IR++S+  +RRP EL
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQLVSWELE  IWDYCL+N DEF  + L D +++ DLI++ETC ++PE+SK+ DQVVFEE
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKD-SKDVDLIVSETCMSIPEISKHMDQVVFEE 120

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
           YEF ++ K P + ++PF N+   K                      +Y DFQLV+DSGFN
Sbjct: 121 YEFGSLMKCPVAQYIPFDNMADYK--------VYGSDGLPVVRKKDDYNDFQLVVDSGFN 172

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241
           CTWV+P+IKGVP+YKA+KK+DIGGRFL GLLKET+SFRHYN+MDETIL NNIKE+C F+ 
Sbjct: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMP 232

Query: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301
           PVSYFDSF+ K +  ++YVLPDFQTS +GY+     ++ I   S QT+ L DE F +PET
Sbjct: 233 PVSYFDSFQKKAETRIDYVLPDFQTSLIGYV--RQPKQAIPEDS-QTLNLEDELFTIPET 289

Query: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           FFHPE+ANILKPGL+ET+LE+ISM+PE +RP++VSNI  +GGNF + + +SRL +ELQRQ
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421
            PTDW+ RV +P   D EL  W AM +FS+TD YK  RVTR EYLEHG DWC+K+RF Y+
Sbjct: 350 CPTDWSVRVHLP-KGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYE 408

Query: 422 NWI 424
            WI
Sbjct: 409 QWI 411

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 302/422 (71%), Gaps = 13/422 (3%)

Query: 4   FVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELGQ 63
            VIDNGSYEIKFG +    P RA N + KDKY   +LSN  K +RDIS A IRRPHELGQ
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65

Query: 64  LVSWELEGCIWDYCLYNPDEFDGFHLGDN-TREQDLILTETCFTLPELSKNSDQVVFEEY 122
           LVSWELE  +WDYC YN D+F      DN T++  L+++ET  T+PELSKN DQV+FEEY
Sbjct: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125

Query: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFNC 182
           +F +MFK P + ++PF    G    + +                  Y+DFQLVIDSGFNC
Sbjct: 126 DFKSMFKGPVAQYIPFYQ--GQYQDDAMTA--------AEDKKTSSYKDFQLVIDSGFNC 175

Query: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242
           TW VPIIKGVP+YKAIKK+DIGGRFL GLL+ET+SFRHYN+M+ETIL+NNIKE+C FV P
Sbjct: 176 TWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPP 235

Query: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302
            SYF SF  K    VEYVLPDFQTSFLGY+      K  D    QT+ LTDE F+VPETF
Sbjct: 236 ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTD--DAQTLLLTDEVFSVPETF 293

Query: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362
           FHPE+A ILKPG+VETILE I+M PE +RP+LV+NIVC GGNF +P+   RL +ELQRQ 
Sbjct: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353

Query: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422
           P DW+C+V  P   D  L  W +M  F+++D +++ RVTREEYLEHG DWC+K+RF YQ 
Sbjct: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQ 413

Query: 423 WI 424
           W+
Sbjct: 414 WL 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/425 (56%), Positives = 318/425 (74%), Gaps = 9/425 (2%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61
            P +IDNGSYEIKFG++N  TPF A N +AKDKY   YLSN +  I+DISS +I+RPH+L
Sbjct: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQL 63

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           GQLVSWELE  IWDYC YN D+F GF + +++ E  L+LTET  TLPELS+N+DQVVFEE
Sbjct: 64  GQLVSWELEHEIWDYCFYNGDDFKGFEVNEDS-ENHLVLTETPMTLPELSRNTDQVVFEE 122

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
           Y F +++K+PA+ F+PF     N  +  L GK               Y+DF LVIDSG+N
Sbjct: 123 YGFDSLYKAPAANFIPFIKNDDNSFI-RLSGKSKTYLDGSKE---NNYQDFNLVIDSGYN 178

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241
           C+W++P+IKGVP+YKA+KKMD+GGRFLNGLLKET+S+RHY++ DE++L+NNIKE C+F+S
Sbjct: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238

Query: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301
           PVSY +SFK K    VEYVLPDFQTSF+GY+ D      +   S Q+I L DE F+VPE 
Sbjct: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHS-QSIILEDELFSVPEG 297

Query: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           FFHPEMAN+LKPG++ETILE++ ++PE LR ++V+NIVC GGNF +P+  SR+ +ELQ+Q
Sbjct: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357

Query: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSST--DVYKTTRVTREEYLEHGTDWCSKHRFT 419
           + T+W C V++P  ++ EL  W AM  F+    ++YK TRVT++EY EHG +W +K RF 
Sbjct: 358 VQTEWVCDVSIP-KANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416

Query: 420 YQNWI 424
           YQNW+
Sbjct: 417 YQNWL 421

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP + ++   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMEVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP + ++   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTASQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG+   P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 167/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR +   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q  A+E  Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSAIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 167/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 66

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 67  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 119

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 120 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 151

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR +   L + LS R Y+     E  ++ 
Sbjct: 152 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVR 211

Query: 232 NIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q  A+E  Y LPD Q                       
Sbjct: 212 DIKEKLCYVA-LDFEQEMQTAAQSSAIEKSYELPDGQV---------------------- 248

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 249 ITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 308

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 309 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 366

Query: 409 G 409
           G
Sbjct: 367 G 367

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP + ++   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 165/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 102/421 (24%), Positives = 168/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q  +VE  Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSVEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP + ++   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  100 bits (250), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +        Y+ +  ++ R I   
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRGI--L 66

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 67  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 119

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 120 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 151

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR +   L + LS R Y+     E  ++ 
Sbjct: 152 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVR 211

Query: 232 NIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + Y    +T  Q  A+E  Y LPD Q                       
Sbjct: 212 DIKEKLCYVA-LDYDQEMQTAAQSSAIEKSYELPDGQV---------------------- 248

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 249 ITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 308

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 309 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 366

Query: 409 G 409
           G
Sbjct: 367 G 367

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 168/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKNNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G     AI ++D+ GR +   L + L+ R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKT-KQQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q  AVE  Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTASQSSAVEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP + ++   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 100/421 (23%), Positives = 166/421 (39%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQILFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G      I ++D+ GR +   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q  A+E  Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSAIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 99/421 (23%), Positives = 164/421 (38%), Gaps = 77/421 (18%)

Query: 4   FVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSA 53
            VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           T+R P E G + +W+    IW +  YN        L     E  ++LTE         + 
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNREK 118

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             Q++FE +     + S  +    +++                             R   
Sbjct: 119 MTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GRTTG 150

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETILLN 231
           +V+DSG   T VVPI  G      I ++D+ GR L   L + LS R Y+     E  ++ 
Sbjct: 151 IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVR 210

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +IKEK  +V+ + +    +T  Q +     Y LPD Q                       
Sbjct: 211 DIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV---------------------- 247

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R  L  NIV  GG    P
Sbjct: 248 ITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFP 307

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
            ++ R+  E+    P+    ++  P   + + + W   +  +S   ++   ++++EY E 
Sbjct: 308 GIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASLTTFQQMWISKQEYDES 365

Query: 409 G 409
           G
Sbjct: 366 G 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 89/377 (23%), Positives = 151/377 (40%), Gaps = 67/377 (17%)

Query: 38  SYLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQD 97
           SY+ +  ++ R I   T+R P E G + +W+    IW +  YN        L     E  
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 98  LILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXX 157
           ++LTE         +   Q++FE +     + S  +    +++                 
Sbjct: 88  VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSS----------------- 130

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                       R   +V+DSG   T VVPI  G     AI ++D+ GR L   L + LS
Sbjct: 131 -----------GRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILS 179

Query: 218 FRHYNM--MDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYL 272
            R Y+     E  ++ +IKEK  +V+ + +    +T  Q +     Y LPD Q       
Sbjct: 180 ERGYSFSTTAEREIVRDIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV------ 232

Query: 273 VDESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRP 332
                           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R 
Sbjct: 233 ----------------ITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRK 276

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSST 392
            L  NIV  GG    P ++ R+  E+    P+    ++  P   + + + W   +  +S 
Sbjct: 277 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASL 334

Query: 393 DVYKTTRVTREEYLEHG 409
             ++   ++++EY E G
Sbjct: 335 TTFQQMWISKQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 97.8 bits (242), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 89/377 (23%), Positives = 152/377 (40%), Gaps = 67/377 (17%)

Query: 38  SYLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQD 97
           SY+ +  ++ R I   T+R P E G + +W+    IW +  YN        L     E  
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 98  LILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXX 157
           ++LTE         +   Q++FE +     + S  +    +++                 
Sbjct: 88  VLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSS----------------- 130

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                       R   +V+DSG   T VVPI  G      I ++D+ GR +   L + LS
Sbjct: 131 -----------GRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILS 179

Query: 218 FRHYNM--MDETILLNNIKEKCLFVSPVSYFDSFKTK-QQQAVE--YVLPDFQTSFLGYL 272
            R Y+     E  ++ +IKEK  +V+ + +    +T  Q  A+E  Y LPD Q       
Sbjct: 180 ERGYSFSTTAEREIVRDIKEKLCYVA-LDFEQEMQTAAQSSAIEKSYELPDGQV------ 232

Query: 273 VDESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRP 332
                           IT+ +ERF  PE  FHP +  +   G+ +T   +I      +R 
Sbjct: 233 ----------------ITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRK 276

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSST 392
            L  NIV  GG    P ++ R+  E+    P+    ++  P   + + + W   +  +S 
Sbjct: 277 ELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP--PERKYSVWIGGSILASL 334

Query: 393 DVYKTTRVTREEYLEHG 409
             ++   ++++EY E G
Sbjct: 335 TTFQQMWISKQEYDESG 351

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 96/431 (22%), Positives = 166/431 (38%), Gaps = 78/431 (18%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P V+DNGS  IK G +          +L+   + N  +A    G +++ N  + +R +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P E G + +W     IW Y      +        N  +  +++TE         +
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQ------NVEDHPILITEAPLNPRNNRE 120

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              +++FE +    ++ S  +    +A+                             R  
Sbjct: 121 RMCELLFESFNVPALYVSIQAVLSLYAS----------------------------GRTT 152

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDETI 228
             V+D G  C   VP+  G     +I+++DI GR    FL  LL++T      +  +  +
Sbjct: 153 GCVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV 212

Query: 229 LLNNIKEKCLFVSPVSYFDSFK-TKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +   IKEK  +V+   + +    +      ++ LPD +T                     
Sbjct: 213 V-RIIKEKACYVAKDPHIEEQNFSINPNYTKFKLPDGKT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I L  E+F  PE  F PE+       L +   ++I  V   LR +L SN++  GG   L
Sbjct: 251 -IDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSIL 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
           P    RL SEL+    +D   ++ + +  + + + W   +  S    +K   VTR E+ E
Sbjct: 310 PGFGDRLLSELKSL--SDSQTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTRAEW-E 366

Query: 408 HGTDWCSKHRF 418
              D C   RF
Sbjct: 367 EAAD-CIHSRF 376

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 92/383 (24%), Positives = 152/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   +N    +RDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +N  + +      NT    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQMKLN------NTSGGKILLTEPPMNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WYTRV 328

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/432 (22%), Positives = 173/432 (40%), Gaps = 80/432 (18%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P V+DNGS  IK G +          +L+   + N  +A    G  ++ N  + +R +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P E G + +W     IW++  +   + +      N  E  ++ TE      +  +
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLN------NIEEHPVLATEAPLNPLKNRE 122

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              +++FE +    ++ S  +    +A+                             R  
Sbjct: 123 AMCEMLFETFNVPAVYVSIQAVLSLYAS----------------------------GRTT 154

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDETI 228
             V+D G  C   VP+  G     +I+++D+ GR    FL  LL++T      +  +  I
Sbjct: 155 GCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI 214

Query: 229 LLNNIKEKCLFVS--PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
           +   IKEK  +V+  P++   ++       + + LPD      G ++D            
Sbjct: 215 V-RIIKEKACYVARDPLTEEQTYHLTPTSTI-FKLPD------GKVLD------------ 254

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
               L +E+F  PE  F P++       + E   ++IS V   LRP L+SNIV  GG   
Sbjct: 255 ----LKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTM 310

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYL 406
            P    RL +EL R L    T ++ + +  + + + W   +  S    +K   VT+ E+ 
Sbjct: 311 FPGFGDRLLTEL-RNLSEPQT-KIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKSEWQ 368

Query: 407 EHGTDWCSKHRF 418
           E+    C   RF
Sbjct: 369 ENPD--CVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 159/419 (37%), Gaps = 74/419 (17%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P V+DNGS  IK G +          +L+   + N  +A    G +++ N  + +R +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P + G + +W     +W Y      +        N  +   ++TE      +  +
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQ------NVEDHPNLVTEAPLNPHKNRE 148

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              +++FE +    ++ S  +    +A+                             R  
Sbjct: 149 KMCELLFESFNVPALYVSVQAVLSLYAS----------------------------GRTT 180

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDETI 228
             V+D G  C   VP+  G     +I+++DI GR    FL  LL++T      +  +  I
Sbjct: 181 GCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI 240

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +   IKEK  FV          TK  +  E   P    SF  + + +           +T
Sbjct: 241 V-RTIKEKACFV----------TKDPKLEEQNFP-MNPSFSKFKLPDG----------KT 278

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           I L  ER+  PE  F PE+       L +   ++I  V   LR +L SNI+  GG   LP
Sbjct: 279 IELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLP 338

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
               RL  EL+    +    ++  P     + + W   +  S    +K   VT+ E+ E
Sbjct: 339 GFGDRLLKELKSLSGSRTKIKIFAPPER--KYSTWIGGSILSGLSTFKKLWVTKSEWEE 395

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 154/384 (40%), Gaps = 77/384 (20%)

Query: 3   PFVIDNGSYEIKFGHA-----NLVTPFRANNGIAKDKYGASYLSNHMKTI------RDIS 51
           P V+D G+  +K G A     +   P      I + +   S +S  +K I       D+ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGS-ISTPLKDIMIGEEASDVR 64

Query: 52  S-ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           S   I  P E G + +W+    +WDY  YN  +F       +T    ++LTE      + 
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP------STSGGKILLTEPPMNPLKN 118

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            +   +V+FE+Y+F  ++ +  +    +A  + +                          
Sbjct: 119 RELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228
              +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
            +  IKEK  +VS     D+   ++   +   Y LPD +                     
Sbjct: 211 TVRQIKEKLSYVSYDLNLDTKLARETTVLVENYELPDGRV-------------------- 250

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
             I +  ERF  PE  F P++ ++ +PG+ E +   I      +R  L   IV  GG+  
Sbjct: 251 --IKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSM 308

Query: 347 LPHMSSRLTSELQRQLPTDWTCRV 370
            P + SRL  EL +QL   W  R+
Sbjct: 309 YPGLPSRLEKEL-KQL---WYTRI 328

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 150/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +         T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------TTSNGKILLTEPPMNPTKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E + + +      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 150/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   +N +  ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  Y+  +        +T    ++LTE         
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQMKLP------STSGGKVMLTEPPMNPLRNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 212 VRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRV--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 151/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +        +T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------STSNGKILLTEPPMNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++  A+   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFSRV 328

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 151/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +        +T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------STSNGKILLTEPPMNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++  A+   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFSRV 328

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 93/426 (21%), Positives = 172/426 (40%), Gaps = 68/426 (15%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P V+DNGS  IK G            +LV   + +  +A    G +++ N  + IR +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P E G +  W     +W +         G  L  + ++  +++TE      +  +
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQL-SSLQDHPVLVTEAPLNPKKNRE 123

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              +++FE +    ++ S  +    +A+                             R  
Sbjct: 124 QMCELLFETFSVPAVYVSIQAVLSLYAS----------------------------GRTT 155

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNN 232
             V+DSG  C+  VP+  G     AI+++DI GR ++ LL+  +          ++L ++
Sbjct: 156 GCVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIR----KSTGVSLLSSS 211

Query: 233 IKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLT 292
            +E    +   + + +   K+++   Y +   QT F   L D            + I L 
Sbjct: 212 EREIVRIIKEKACYIALDPKEEEK-NYTMHGKQTMF--RLPDG-----------KQIELD 257

Query: 293 DERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSS 352
           +E+F  PE  F+P++       L E + E+I  V   LR  L SNIV  GG   +P    
Sbjct: 258 NEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGD 317

Query: 353 RLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDW 412
           R+  EL  +L  +   ++ + +  + + + W   +  S    +K   VT++E+ E+    
Sbjct: 318 RVLKEL--KLSCEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKKEWEENPR-- 373

Query: 413 CSKHRF 418
           C   RF
Sbjct: 374 CVHARF 379

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 89/385 (23%), Positives = 145/385 (37%), Gaps = 79/385 (20%)

Query: 3   PFVIDNGSYEIKFGHANLVTP------------FRAN-NGIAKDKYGASYLSNHMKTIRD 49
           P V+D G+  +K G A    P             RA   G          + +    +R 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR- 64

Query: 50  ISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPE 109
            S   I  P E G + +W     +WDY  +N  +         T    ++LTE      +
Sbjct: 65  -SYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLP------TTSGGKVLLTEPPMNPVK 117

Query: 110 LSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEY 169
             +   +V+FE Y+F  ++ +  +    +A  + +                         
Sbjct: 118 NRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG------------------------ 153

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDET 227
               +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADF 209

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGS 285
             +  IKEK  +VS     D+   ++   +  EY LPD +                    
Sbjct: 210 ETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPDGRI------------------- 250

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
              I +  ERF  PE  F P++ ++  PG+ E +   I      +R  L   IV  GG+ 
Sbjct: 251 ---IKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSS 307

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRV 370
             P + SRL  EL +QL   W  R+
Sbjct: 308 MYPGLPSRLEREL-KQL---WFTRI 328

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 150/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +        +T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQ------STSNGKILLTEPPMNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFSRV 328

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 146/383 (38%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G +  W     +WDY  Y   +        +T    ++LTE         
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYEQMKLP------STSGGKVLLTEPPMNPLRNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++    +    +A  + +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +  +Y LPD +                      
Sbjct: 212 VRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPDGRV--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   I      +   L   IV  GG+   
Sbjct: 251 -IKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/384 (23%), Positives = 150/384 (39%), Gaps = 77/384 (20%)

Query: 3   PFVIDNGSYEIKFGHA-----NLVTPFRANNGIAKDKYGASYLSNHMKTI------RDIS 51
           P V+D G+  +K G A     +   P      I + +  AS ++  +K I       D+ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-ITTPLKDIMIGDEASDVR 64

Query: 52  S-ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           S   I  P E G + +W     +WDY  Y   +        +T    ++LTE        
Sbjct: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQMKLP------STSGGKVLLTEPPMNPLRN 118

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            +   +V+FE+Y+F  ++ +  +    +A  + +                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228
              +V+DSG   T +VP+ + V      K++D+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
            +  IKEK  +VS     D+   ++   +   Y LPD +                     
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRV-------------------- 250

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
             I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   +V  GG+  
Sbjct: 251 --IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSM 308

Query: 347 LPHMSSRLTSELQRQLPTDWTCRV 370
            P + SRL  EL +QL   W  RV
Sbjct: 309 YPGLPSRLEKEL-KQL---WFTRV 328

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 127/320 (39%), Gaps = 64/320 (20%)

Query: 55  IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNS 114
           I  P E G + +W     +WDY  Y+  +        +T    ++LTE      +  +  
Sbjct: 15  ISYPMENGVIKNWSDMELLWDYAFYDQMQLP------STSGGKVMLTEPPMNPVKNREQM 68

Query: 115 DQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQL 174
            +V+FE+Y+F  ++ +  +    +A  + +                             +
Sbjct: 69  CEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------------V 100

Query: 175 VIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETILLNN 232
           V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   +  
Sbjct: 101 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 160

Query: 233 IKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQTIT 290
           IKEK  +VS     D+   ++   +   Y LPD +                       I 
Sbjct: 161 IKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRV----------------------IK 198

Query: 291 LTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHM 350
           +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   P +
Sbjct: 199 VGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGL 258

Query: 351 SSRLTSELQRQLPTDWTCRV 370
            SRL  EL +QL   W  RV
Sbjct: 259 PSRLEKEL-KQL---WFTRV 274

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 150/383 (39%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +        +T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------STSNGKILLTEPPMNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +T                     
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPDGRT--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFNRV 328

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 174/424 (41%), Gaps = 80/424 (18%)

Query: 3   PFVIDNGSYEIKFGHANLVTP--FRAN-NGIAK-DKYGAS--------YLSNHMKTIRDI 50
           P VIDNGS  IK G +    P  F  N  G+ K DK   +        Y+ N  ++IR +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
               ++ P   G + +W+    +W + ++N    D  ++  N  E  L++TE   T+ + 
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNV-QNIEEHPLLITEAPLTIEKQ 122

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
                + +FE +   +++ +  S    +A+  GN                          
Sbjct: 123 RHIMCERLFETFNIPSLYVANPSVLSLYAS--GNTT------------------------ 156

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDE 226
               V+D G       PI +G     +I+KM++GGR     L   ++++     Y+  +E
Sbjct: 157 --GCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NE 213

Query: 227 TILLNNIKEKCLFVSP---VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDR 283
             ++  IKEK  ++S     S    +  + + + ++ LPD                    
Sbjct: 214 KEIVRTIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLPD-------------------- 253

Query: 284 GSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGG 343
              + +TL  ERF  PE  F+P++  +    +     E+IS V   LRP L SNI+  GG
Sbjct: 254 --GKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGG 311

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTRE 403
           +       SRL  +LQ    T+   ++ + +  + +  +W   +  +    +K   VT+ 
Sbjct: 312 STLFKGFGSRLLGDLQEL--TNNRAKIKILAPPERKYTSWIGGSILTGLSTFKNLWVTKS 369

Query: 404 EYLE 407
           ++ E
Sbjct: 370 DWEE 373

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 91/383 (23%), Positives = 146/383 (38%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGI-AKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P      I  +    A   +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY       FD   L   T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FDQMKL-PTTSNGKILLTEPPMNPVKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 212 VRQIKEKVCYVSYDLDLDTKLARETTTLVENYELPDGRV--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ + G+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 148/383 (38%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P +   + + +    A   +   K ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +N  +         T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQMQLP------TTSGGKILLTEPPMNPVKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRI--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ + G+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 99/431 (22%), Positives = 166/431 (38%), Gaps = 93/431 (21%)

Query: 3   PFVIDNGSYEIKFGHANLVTP--FRAN-------------NGIAKDKYGASYLSNHMKTI 47
           P V+DNGS  IK G +    P  F  N             N I+ +    +Y+ N  +  
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDL--TYIGNRAQKS 67

Query: 48  RDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTL 107
           R +    +R P   G + +W+    +W +   +  + + F       E  L++TE     
Sbjct: 68  RGL--LRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD------EHPLLITEAPLN- 118

Query: 108 PELSKNSD---QVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXX 164
           PE  KN D   +V FE+++FA ++ +  S    +A+                        
Sbjct: 119 PE--KNRDKMCEVFFEKFDFAAVYIANPSTLSLYAS------------------------ 152

Query: 165 XXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM 224
                R    V+D G      VPI +G     +I+++D+GGR +   L+     R Y  +
Sbjct: 153 ----GRTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGI 206

Query: 225 D-----ETILLNNIKEKCLFVSPVSYFD---SFKTKQQQAVEYVLPDFQTSFLGYLVDES 276
                 E  ++ N+KEK  +VS     D   S    ++   ++ LPD             
Sbjct: 207 SLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD------------- 253

Query: 277 NRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVS 336
              G D      + L   RF  PE  F P++  +    + +   E+IS V   LRP L S
Sbjct: 254 ---GKD------LILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFS 304

Query: 337 NIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYK 396
           +I+  GG+        RL  ELQ +       ++  P     +  +W   +  +    +K
Sbjct: 305 SIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPPER--KYTSWIGGSILTGLSTFK 362

Query: 397 TTRVTREEYLE 407
              +T+ E+ E
Sbjct: 363 QLWMTKAEWQE 373

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 144/383 (37%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKT-IRDI----------S 51
           P V+D G+  +K G A    P      I       +    H  T ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  +   +         T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQMKLP------TTSGGKVLLTEPPMNPIKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F   + +  +    +A  + +                           
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRV--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SRL  EL +QL   W  RV
Sbjct: 310 PGLPSRLEKEL-KQL---WFTRV 328

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 148/384 (38%), Gaps = 75/384 (19%)

Query: 2   VPFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI---------- 50
           VP V+D G+  +K G A    P +   + + +    A   SN    ++DI          
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           S   I  P E G + +W     +WDY  Y+  +        +T    ++LTE      + 
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIP------STAGHKVLLTEPPMNPLKN 118

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            +   +V+FE+Y+F  ++ +  +    +A  + +                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228
              +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFE 210

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
            +  IKEK  +VS     D+    +   +   Y LPD +                     
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTKLAHETTTLVETYELPDGRV-------------------- 250

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
             I +  ERF  PE  F P + ++ + G+ E +   I      +   L   IV  GG+  
Sbjct: 251 --IKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSM 308

Query: 347 LPHMSSRLTSELQRQLPTDWTCRV 370
            P + SRL  EL +QL   W  RV
Sbjct: 309 YPGLPSRLEKEL-KQL---WFTRV 328

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 95/415 (22%), Positives = 167/415 (40%), Gaps = 64/415 (15%)

Query: 3   PFVIDNGSYEIKFGHANLVTP--FRAN-NGIAK-DKYGASYLSNHM----KTIRDISSAT 54
           P VIDNG+  +K G      P  F+ N  G  K DK     L ++M    K   +     
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGLLR 69

Query: 55  IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNS 114
           +R P E G++  W+    +W + L +  + +  H+     E  +++TE      +  ++ 
Sbjct: 70  LRHPMEHGEVKHWDEMEAVWKHTLLH--DLNIQHI----EEHPILITEAPLNSSKNREHM 123

Query: 115 DQVVFEEYEF-ATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
            +++FE +   A   ++PA      A   G                          R   
Sbjct: 124 CEILFESFNIPAIHVENPAV----LALYSGG-------------------------RTTG 154

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNI 233
            VID G      VPI +G     +I+++DIGGR +     E L F+    +  ++  +N 
Sbjct: 155 CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNE 210

Query: 234 KEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD-ESNRKGIDRGSVQTITLT 292
           KE              +T +++A  YV  D       Y++D ESN         +++++ 
Sbjct: 211 KE------------IVRTIKERAC-YVADDISKEEHKYILDSESNSSKFKLPDGKSLSIG 257

Query: 293 DERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSS 352
           + RF   E  F+P +       + E + + +S V   LRP+L  ++V  GG   LP   +
Sbjct: 258 NVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGN 317

Query: 353 RLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
           R+  ELQ     D   R+   +S + +   W   +  +    ++   VT+  + E
Sbjct: 318 RILKELQILTKQDTKLRII--ASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 10/136 (7%)

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVE-------TILEAISMVPEPLRPILVSNIVCV 341
           + L  ER  VPE  F P M  + + G++E           +       +   L SN+   
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSISRSLASNVFLT 663

Query: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTD-VYKTTRV 400
           GGN +LP M  R+  E +  LP      + V  ++DC L AW  MA+ S TD +++ T V
Sbjct: 664 GGNMRLPGMRERVVREFRGLLPI--GTELNVRMANDCALDAWRGMAKLSRTDSLFRDTYV 721

Query: 401 TREEYLEHGTDWCSKH 416
           TR+EY E+G D+  +H
Sbjct: 722 TRQEYHEYGPDYIKEH 737

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 147/385 (38%), Gaps = 77/385 (20%)

Query: 3   PFVIDNGSYEIKFGHANLVTP---FRANNGIAKDKYGASYLSNHMKTIRDI--------- 50
           P V+D G+  +K G A    P   F +  G    +       +    I+DI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 51  -SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPE 109
            S   I  P E G +  W     +WD+  +   +        +T    ++LTE      +
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLP------STSGGKILLTEPPMNPLK 119

Query: 110 LSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEY 169
             +   QV+FE+Y+F  ++ +  +    +A  + +                         
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------ 155

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDET 227
               +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   + 
Sbjct: 156 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 211

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGS 285
             +  IKEK  +VS    FD+   ++   +   Y LPD +                    
Sbjct: 212 ETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELPDGRI------------------- 252

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
              I +  ERF  PE  F P + ++ +PG+ E +   I      +R  L   IV  GG+ 
Sbjct: 253 ---IKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSS 309

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRV 370
             P + SRL  EL +QL   W  RV
Sbjct: 310 MYPGLPSRLEKEL-KQL---WFTRV 330

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/384 (23%), Positives = 149/384 (38%), Gaps = 77/384 (20%)

Query: 3   PFVIDNGSYEIKFGHA-----NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSAT--- 54
           P V+D G+  +K G A     +   P      I + +  AS +S  +K I     A+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-ISTPLKDIMIGDEASEVR 64

Query: 55  ----IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
               I  P E G + +W     +WDY  Y   +        +T    ++LTE      + 
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLP------STSGGKVLLTEPPMNPLKN 118

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            +   +V+FE+Y+F  ++ +  +    +A  + +                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228
              +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +  
Sbjct: 154 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286
            +  IKEK  +VS     D+   ++   +  +Y LPD +                     
Sbjct: 211 TVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPDGRI-------------------- 250

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
             I +  ERF  PE  F P + ++   G+ E +   I      +R  L   IV  GG+  
Sbjct: 251 --IKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSM 308

Query: 347 LPHMSSRLTSELQRQLPTDWTCRV 370
            P + SRL  EL +QL   W  RV
Sbjct: 309 YPGLPSRLEKEL-KQL---WFTRV 328

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 168/423 (39%), Gaps = 81/423 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYG--------ASYLSNHMKTIRDISSA 53
           P V+DNGS  +K G++    P F  ++ +   ++G         +++ N  +  R I   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--L 69

Query: 54  TIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
            +R P + G + +W     IWDY        D   L D   E  +++TE           
Sbjct: 70  QLRHPVDHGVVKNWNDMELIWDYMFK-----DKLKLKD-VDEHPVLITEAPLNPVSNRDE 123

Query: 114 SDQVVFEEYEFATMF-KSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              ++FE +    ++  +PA   +  +  I    ++  CG                    
Sbjct: 124 MCDLLFESFGVQALYVANPAVLSLYASGKISGCVLD--CG-------------------- 161

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMD-----ET 227
                 G++C+  VP+ +G     AIK++D+GGR L   L+  L  R    +      E 
Sbjct: 162 -----DGYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQLRKSTGLSLTTSGEM 212

Query: 228 ILLNNIKEKCLFVSPVSYFDSFKTK---QQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
            L+  IKEK  +V+     +  K      Q  +++ LPD +                   
Sbjct: 213 ELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPDGKF------------------ 254

Query: 285 SVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGN 344
               ITL+ +RF VPE  F P + +     + E I +++S +   LRP + S+I+  GG 
Sbjct: 255 ----ITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGT 310

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREE 404
             L    +RL  EL +        RV + +  + +  +W   +  +    ++   VT+ +
Sbjct: 311 TMLKGFGNRLVQELDKL--NQAQSRVKIWAPPERKYTSWIGGSILAELSTFQKIIVTKSQ 368

Query: 405 YLE 407
           + E
Sbjct: 369 WQE 371

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 126/328 (38%), Gaps = 72/328 (21%)

Query: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYN----PDEFDGFHLGDNTREQDLILTETCFT 106
           S   I  P E G + +W     +WDY  Y     PD  +G           ++LTE    
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNG----------KILLTEPPMN 60

Query: 107 LPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXX 166
             +  +   +V+FE+Y F  ++ +  +    +A  + +                      
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSG--------------------- 99

Query: 167 KEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMM 224
                  +V+DSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N  
Sbjct: 100 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRT 152

Query: 225 DETILLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGID 282
            +   +  IKEK  +VS     D+   ++   +   Y LPD +                 
Sbjct: 153 ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRV---------------- 196

Query: 283 RGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVG 342
                 I +  ERF  PE  F P + ++ + G+ E +   I      +R  L   IV  G
Sbjct: 197 ------IKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSG 250

Query: 343 GNFKLPHMSSRLTSELQRQLPTDWTCRV 370
           G+   P + SRL  EL +QL   W  RV
Sbjct: 251 GSSMYPGLPSRLEKEL-KQL---WFTRV 274

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 128/338 (37%), Gaps = 75/338 (22%)

Query: 1   MVPFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDI 50
           +   VIDNGS   K G A          ++V   R    +       SY+ +  ++ R I
Sbjct: 5   VAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
              T+R P E G + +W+    IW +  YN        L     E  ++LTE        
Sbjct: 65  --LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSN 115

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            +   Q++FE +     + S  +    +++                             R
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSS----------------------------GR 147

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNM--MDETI 228
              +V+DSG   T VVPI  G      I ++D+ GR L   L + LS R Y+     E  
Sbjct: 148 TTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV---EYVLPDFQTSFLGYLVDESNRKGIDRGS 285
           ++ +IKEK  +V+ + +    +T  Q +     Y LPD Q                    
Sbjct: 208 IVRDIKEKLCYVA-LDFEQEMQTAAQSSSIEKSYELPDGQV------------------- 247

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAI 323
              IT+ +ERF  PE  FHP +  +   G+ +T   +I
Sbjct: 248 ---ITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 291 LTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCVGG 343
           L  ER  VPE FF P M    + G+ E     +L      P  +  I   +  N+   GG
Sbjct: 609 LNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGG 668

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVTR 402
           N K+P +  R+  E    LP + +  V +  SSD  L AW  MA+++  +  YK + +++
Sbjct: 669 NAKIPGLRERIVKEFTGFLPVNTSFNVNI--SSDPSLDAWRGMAKYAQNETDYKKSFISK 726

Query: 403 EEYLEHGTDWCSKHRFTYQNW 423
           +EY E+G D+  +H+    N+
Sbjct: 727 KEYEEYGPDYIKEHKLGNMNY 747

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCV 341
           + L  ER  VPE  F P +A   + G+ E     +L+     P  L      +V+N+   
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRV 400
           GGN ++P + +R+  E    LP      ++V  S D  L AW  MA+ ++ +  YK T V
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPA--GTPLSVHMSEDPSLDAWKGMAKLANNETDYKNTAV 725

Query: 401 TREEYLEHGTDWCSKHRF 418
           TR+EY E+G D+  +H+ 
Sbjct: 726 TRKEYEEYGPDYIKEHKL 743

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 96/255 (37%), Gaps = 57/255 (22%)

Query: 4   FVIDNGSYEIKFGHANLVTP---FRANNGIAKDKYGA---SYLSNHM---KTIRDISSAT 54
             ID GSY I+ G+ N  TP   F       +D+      +++ N     +TIR  S + 
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTIRSQSKS- 97

Query: 55  IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLPELS 111
              P +   L +W+    + +Y  +        HLG   +N     LI+ E    L    
Sbjct: 98  ---PFDGTLLTNWDYVEDMLEYTFH--------HLGVSGNNGVSNPLIINERLACLQSQR 146

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
            +  Q++FE ++   +    + G     +  GN   E                       
Sbjct: 147 NSWYQLLFETFDLPEV----SFGIDSLFSFYGNSTKED---------------------- 180

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGG----RFLNGLLKETLSFRHYNMMDET 227
             LVI+ G   T V+PI+ G       K+++ GG     FL+ LL  TL + ++     T
Sbjct: 181 -GLVINCGNEETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLST 237

Query: 228 ILLNNIKEKCLFVSP 242
           +    + E   + SP
Sbjct: 238 LQYTQMYEDYCYTSP 252

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 89/425 (20%), Positives = 161/425 (37%), Gaps = 78/425 (18%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P VIDNGS  IK G +          +LV   +    + +   G +++ N  + +R +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P   G +  W+    IW Y L    +        N  E  L++TE      +  +
Sbjct: 72  LRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQ------NIEEHPLLITEAPMNPLKNRE 125

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              QV+FE +    ++ S  +    +A+                             R  
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYAS----------------------------GRTT 157

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM-------D 225
             V+D G      VPI  G     +I +MDIGGR +     E L F+             
Sbjct: 158 GCVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSS 213

Query: 226 ETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGS 285
           E  ++  IKEK  +++        K  +++   Y+        LG +    + K I+ G 
Sbjct: 214 ELEVVRMIKEKVCYLA--------KNIKKEEDRYLQGHHD---LGSVFKLPDGKCIEIG- 261

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
                  ++R+  PE  F P++      GL +  +++I  V   LR  L+S+I+  GG  
Sbjct: 262 -------NDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTT 314

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405
            L     R+  +L+    +  TC++ + +  + +   W   +  +    ++     + ++
Sbjct: 315 TLRGFGERMLHDLEAL--SKGTCKIKIIAPPERKYTTWVGGSILTGLSTFQKLWTKKSDW 372

Query: 406 LEHGT 410
           LE  T
Sbjct: 373 LEDNT 377

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 93/428 (21%), Positives = 153/428 (35%), Gaps = 89/428 (20%)

Query: 3   PFVIDNGSYEIKFGHANLVTP---------------FRANNGIAKDKYGASYLSNHMKTI 47
           P VIDNG+  IK G      P                  +NGI  D    S++ N  +  
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESD----SFIGNKAQKY 69

Query: 48  RDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTL 107
           R I    +R P   G + +W+    IW Y       FD     +N  E  +++TE     
Sbjct: 70  RGI--LKLRHPMLRGVVQNWDDMETIWQYV------FDDTLYLENLNEHPILITEPPLNN 121

Query: 108 PELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXK 167
               +   + +FE + F  ++ S +    P  +L  +                       
Sbjct: 122 MANRQKMCEALFEIFGFPAVYISVS----PVLSLYASGQTTGC----------------- 160

Query: 168 EYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGG-----RFLNGLLKETLSFRHYN 222
                   +D G      +P+  G     ++KK+DIGG     +    +LK T  F + +
Sbjct: 161 -------AVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS 213

Query: 223 MMDETILLNNIKEKCLFVSPVSYFDSFK---TKQQQAVEYVLPDFQTSFLGYLVDESNRK 279
              E  ++  IKEK  +++     ++ K    +++ A ++ LPD +              
Sbjct: 214 --SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPDGKM------------- 258

Query: 280 GIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIV 339
                    + ++  ++   E  F PE+       L E   ++I  V   LR  L SNIV
Sbjct: 259 ---------LNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 340 CVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTR 399
             GG    P   SRL  ELQ     D   R+  P     +  +W   +  S    +    
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAPPER--KYTSWIGGSILSGLSTFSKIW 367

Query: 400 VTREEYLE 407
           VT+  + E
Sbjct: 368 VTKSMWEE 375

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCV 341
           I L  ER  VPE  F P M  + + G+ E     +L      P+ L  +   + +NI   
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRV 400
           GGN K+P +  R+  E +  LP +   +  V  +SD    AWN MA+ +  +  YK T +
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVN--TQFNVNMTSDPTFDAWNGMAKLAQNETDYKKTII 728

Query: 401 TREEYLEHGTDWCSKHRF 418
           +++EY E+G ++  +H+ 
Sbjct: 729 SKKEYEEYGPEYIKEHKL 746

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/389 (22%), Positives = 160/389 (41%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N   T    ++ ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 160

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K ++  L G     
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT---- 216

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     A+K + I GR +   ++  L 
Sbjct: 217 -----------------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL- 258

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R    +D ++     IK++  +V P  V  F+ F    ++  +YV+ +          D
Sbjct: 259 -RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN---------QD 308

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 309 KTRQKVVDIGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRK 359

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDW--TCRVTVPSSSDCEL---------- 380
            L +NIV  GG+        RL  +L+  +      T R++   S+  ++          
Sbjct: 360 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRN 419

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K    T+++Y E+G
Sbjct: 420 AVWFGGSLLAQTPEFKGYCHTKKDYEEYG 448

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 12/137 (8%)

Query: 291 LTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCVGG 343
           L  ER  VPE  F P M  + + G++E     I+         L  +   + +N+   GG
Sbjct: 607 LNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGG 666

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQF--SSTDVYKTTRVT 401
           N ++P +  R+  E    LP      + V  +SD  + AW  MA+F  SSTD YK + VT
Sbjct: 667 NVRVPGLRDRIVREFTEFLPVGTKYNIKV--ASDPAIDAWKGMAKFAQSSTD-YKGSYVT 723

Query: 402 REEYLEHGTDWCSKHRF 418
           ++EY E+G D+  +H+ 
Sbjct: 724 KKEYEEYGPDYIKEHKL 740

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 93/423 (21%), Positives = 149/423 (35%), Gaps = 78/423 (18%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P VIDNGS  +K G            +L+     N  +       S++ N  + +R +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             ++ P E G +  W+    +W + L     FD   L     E  L++TE     PE +K
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGM-EHPLLITEAPLN-PESNK 121

Query: 113 NSD-QVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
               +V FE +    +  S       +A+                             R 
Sbjct: 122 EKMLEVFFETFNIPAICVSIPGVLSLYAS----------------------------GRT 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM---DETI 228
              V+D G      VP+ +G     +IK++++GG  +   L+  L       +    E  
Sbjct: 154 TGCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSSGERE 213

Query: 229 LLNNIKEKCLFVSPVSYFDSFK---TKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGS 285
           L+  +KEK  +VS     D  K      +    + LPD                      
Sbjct: 214 LVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNTNFKLPDG--------------------- 252

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
              +TL+  RF  PE  F P++    +P L E  L++I  V   LRP L+S I   GG  
Sbjct: 253 -NMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTT 311

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405
                  R   ELQ         R+  P     +  AW   +  +    ++    T+ ++
Sbjct: 312 MFRGFGDRFLQELQISTCKKSNIRILAPPER--KYTAWIGGSMLAGLTTFRKMLTTKSDW 369

Query: 406 LEH 408
            EH
Sbjct: 370 REH 372

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 143/383 (37%), Gaps = 75/383 (19%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGI-AKDKYGASYLSNHMKTIRDI----------S 51
           P V+D G+  +K G A    P      I  +    A    N    ++D+          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111
              I  P E G + +W     +WDY  Y   +        +T    ++LTE      +  
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQMKLP------STSGGKVLLTEPPLNPLKNR 119

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +   +V+FE+Y+F  ++ +  +    +A  + +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229
             +VIDSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 212 VRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRV--------------------- 250

Query: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347
            I +  ERF   E  F P + ++   G+ E +   I      +R  L   IV  GG+   
Sbjct: 251 -IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMY 309

Query: 348 PHMSSRLTSELQRQLPTDWTCRV 370
           P + SR+  EL +QL   W  RV
Sbjct: 310 PGLPSRIEKEL-KQL---WYTRV 328

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 10/133 (7%)

Query: 294 ERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLR---PILVSNIVCVGGNFK 346
           ER  VPE  F P M    + G++E     +L+     P  L      +  N+   GG+ +
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVTREEY 405
           LP + +R+  E    LP D   + +V  S    L AW  MA+FSS D  +K++ ++++EY
Sbjct: 678 LPGLKTRIVKEFTSFLPND--AKFSVNISKHPSLDAWKGMAKFSSDDADFKSSLISKKEY 735

Query: 406 LEHGTDWCSKHRF 418
            E+G ++  +HR 
Sbjct: 736 EEYGPEYIKEHRL 748

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 10/133 (7%)

Query: 294 ERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCVGGNFK 346
           ER  VPE  F P M    + G+ E     +L+     P  L      +V+N++  GGN K
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTREEY 405
           +P +  R+  E    LPT     +TV  SSD  L AW  MA  + + + Y+ T ++++EY
Sbjct: 677 VPGLKERIVKEFTGFLPT--GTNITVNMSSDPSLDAWKGMAALARNEEQYRKTVISKKEY 734

Query: 406 LEHGTDWCSKHRF 418
            E+G ++  +H+ 
Sbjct: 735 EEYGPEYIKEHKL 747

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 84/224 (37%), Gaps = 49/224 (21%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRA-NNGIAKDK-----YGASYLSNHMKTIRDISSATIR 56
           P  ID GS +++ G  N  TP     N + K +        +++ N     + + S + R
Sbjct: 39  PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-R 97

Query: 57  RPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLPELSKN 113
            P +   + +W L   I DY  +        HLG   DN     ++LTE   T+     N
Sbjct: 98  SPFDGPFVTNWNLTEEILDYTFH--------HLGVVPDNGIPNPILLTERLATVQSQRTN 149

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFA-NLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
             Q++FE Y    +     S F  +  N  GNK                           
Sbjct: 150 WYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTG------------------------- 184

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLL 212
            LVI  G   T V+P++ G       K+++ GG     +LN L+
Sbjct: 185 -LVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/389 (22%), Positives = 157/389 (40%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N        +S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 100 YIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 152

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K ++  L G     
Sbjct: 153 LLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT---- 208

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 209 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL- 250

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F    ++  +YV+ +          +
Sbjct: 251 -RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVEN---------QE 300

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 301 KTQKKVVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRK 351

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPTDWTCR---VTVPSSSDCEL 380
            L +NIV  GG+        RL  +L         Q +L +        V+V S      
Sbjct: 352 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRN 411

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 412 AVWFGGSLLAQTAEFKSYCHTKKDYEEYG 440

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 114/254 (44%), Gaps = 37/254 (14%)

Query: 175 VIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETI-LLNNI 233
           VIDSG   T V+P+ +G     AIK + I GR +   ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 234 KEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITL 291
           K++  +V P  V  F+ F  + ++  ++++ +          D++ +K ID G       
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKTTKKVIDIGY------ 316

Query: 292 TDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPH 349
             ERF  PE FF+PE+A  + L P L   + + I   P  +R  L +NIV  GG+     
Sbjct: 317 --ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 373

Query: 350 MSSRLTSELQ----RQLPTDWTCRVTVPSSSDCEL--------AAWNAMAQFSSTDVYKT 397
            S RL  +++     ++  +     T  +  D ++        A W   +  + T  +K 
Sbjct: 374 FSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKG 433

Query: 398 TRVTREEYLEHGTD 411
              T+++Y EHG +
Sbjct: 434 YCHTKKDYEEHGPE 447

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 87/422 (20%), Positives = 165/422 (39%), Gaps = 72/422 (17%)

Query: 3   PFVIDNGSYEIKFGHAN----------LVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P VIDNGS  IK G +           LV   + +  + +   G +++ N+ + +R +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P + G +  W+    IW Y L    +        N  E  L++TE      +  +
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQ------NIGEHPLLITEAPMNPLKNRE 125

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              QV+FE ++ + ++ S  +    +A+                             R  
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYAS----------------------------GRTT 157

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGG----RFLNGLLKETLSFRHYNMMDETI 228
             V+D G      VPI  G     ++ +MDIGG      L   L+++     ++  +  I
Sbjct: 158 GCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI 217

Query: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQT 288
           +   +KEK      V Y      K+++       D  ++F   L D            + 
Sbjct: 218 V-RTMKEK------VCYLAKNIKKEEEKYLQGTQDLISTF--KLPDG-----------RC 257

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLP 348
           I + ++R+  PE  F P++  +   GL +  +++I  V   LR  L+S+I+  GG   L 
Sbjct: 258 IEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLK 317

Query: 349 HMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEH 408
               R+  +L+    T  T ++ + + S+ +   W   +  +    ++     + ++LE 
Sbjct: 318 GFGDRMLWDLEAL--TKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLED 375

Query: 409 GT 410
            T
Sbjct: 376 ST 377

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 86/425 (20%), Positives = 160/425 (37%), Gaps = 84/425 (19%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P VIDNGS  IK G +          +LV   + +  + +   G +++ N  + +R +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P + G +  W+    IW Y L    +        N  E  L++TE      +  +
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQ------NIEEHPLLITEAPMNPLKNRE 125

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              QV+FE +  + ++ S  +    +A+                             R  
Sbjct: 126 MIAQVMFETFNLSAIYVSDPAVLSLYAS----------------------------GRTT 157

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM-------D 225
             V+D G      VPI  G     +I +MDIGG    G + E L F+             
Sbjct: 158 GCVVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSS 213

Query: 226 ETILLNNIKEKCLFVSPVSYFDS---FKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGID 282
           E  ++  IKEK  +++  +  +     +  Q     + LPD ++                
Sbjct: 214 EREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLISAFKLPDGKS---------------- 257

Query: 283 RGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVG 342
                 I + ++R+  PE  F P++      GL    +++I  V   LR  L+S+++  G
Sbjct: 258 ------IEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSG 311

Query: 343 GNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTR 402
           G   L     R+  +L+    T  T ++ + +  + +  AW   +  +    ++     +
Sbjct: 312 GTTTLKGFGDRMLHDLEAL--TKGTSKIKIIAPPERKYTAWIGGSILTGLSTFQKLWTKK 369

Query: 403 EEYLE 407
            ++LE
Sbjct: 370 SDWLE 374

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/392 (22%), Positives = 155/392 (39%), Gaps = 68/392 (17%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 103 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 155

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 156 LLTEPPLNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 211

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 212 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 253

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F    ++  ++++ +          +
Sbjct: 254 -RERGEQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVEN---------KE 303

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
            + +K +D G         ERF  PE FF+PE+A  + L P L   + E I   P  +R 
Sbjct: 304 RTTKKVVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRK 354

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCR-------------VTVPSSSDCE 379
            L +NIV  GG+        RL  +L + +  D   +             V+V S     
Sbjct: 355 GLYNNIVLSGGSTMFKDFGRRLQRDL-KGIVNDRISQSEKLSGTRSTGVDVSVISHKRQR 413

Query: 380 LAAWNAMAQFSSTDVYKTTRVTREEYLEHGTD 411
            A W   +  + T  +K+   T+++Y E+G D
Sbjct: 414 NAVWFGGSLLAQTGEFKSYCHTKQDYEEYGPD 445

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 9/135 (6%)

Query: 291 LTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCVGG 343
           L  ER  VPE  F P M    + G+ E     +L+     P  L      + +NI   GG
Sbjct: 610 LNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGG 669

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTRE 403
           N K+P + +R+  E    LP     +++V  SSD  L +W  MA+++ ++ Y  + +T++
Sbjct: 670 NAKVPGLKNRIVKEFTSFLPV--GTKLSVNMSSDPLLDSWKGMAKWAKSEDYNKSFITKK 727

Query: 404 EYLEHGTDWCSKHRF 418
           EY E+G ++  +H+ 
Sbjct: 728 EYEEYGPEYIKEHKM 742

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 68/135 (50%), Gaps = 18/135 (13%)

Query: 294 ERFAVPETFFHPEMANILKPGLVE---TIL--------EAISMVPEPLRPILVSNIVCVG 342
           ER  VPE  F P +  + + G+VE   T+L         A+S   E +      N+   G
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKM----AKNVFITG 669

Query: 343 GNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVT 401
           GN KLP +  R+  E    LP     +VT+  + D  L+AW  MA+F+S    YK++ +T
Sbjct: 670 GNTKLPGIRERIVREFTGFLPVGTELKVTL--AKDPSLSAWKGMAKFASDPTSYKSSILT 727

Query: 402 REEYLEHGTDWCSKH 416
           + EY E+G ++  +H
Sbjct: 728 KREYEEYGPEYIKEH 742

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (45%), Gaps = 10/134 (7%)

Query: 291 LTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLR---PILVSNIVCVGG 343
           L  ER  VPE  F P MA + + G+ E      L+        L      L +N+   GG
Sbjct: 606 LNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGG 665

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSST-DVYKTTRVTR 402
           N +LP +  R+  E    LP      + V  +SD  + AW  MA+ S     YK + +TR
Sbjct: 666 NMRLPGVRERIVREFTGMLPM--GSNLNVRMASDSAVDAWRGMAKLSQAGSQYKGSYITR 723

Query: 403 EEYLEHGTDWCSKH 416
           +EY E G D+  +H
Sbjct: 724 KEYQELGADYIKEH 737

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 53/263 (20%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRA-NNGIAK-----DKYGASYLSNHMKTIRDIS-SAT 54
           VP  ID GS E++ G  N   P     N I++          +++ N   T  D+S  + 
Sbjct: 37  VPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGND--TNLDLSVRSQ 94

Query: 55  IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTRE---QDLILTETCFTLPELS 111
            + P++   + +W+    I +Y  +        HLG N  +     +++TE   TL    
Sbjct: 95  AKSPYDGAIVSNWDYTEEIMEYTFH--------HLGVNGNDGVSNPILMTEKLATLQSQR 146

Query: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRD 171
           +N  Q++FE +    +     S F  +AN     N     G                   
Sbjct: 147 ENWYQLLFECFGVPQVTFGIDSLFSFYAN-----NDATASG------------------- 182

Query: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDET 227
             LVI+SG   T V+P++ G       K+++ GGR    +L+ LL   L + ++ +   T
Sbjct: 183 --LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPST 238

Query: 228 ILLNNIKEKCLFVSPVSYFDSFK 250
               ++ E   +VS V Y D  +
Sbjct: 239 HQFQSLYEDFCYVS-VDYQDEIR 260

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 94/434 (21%), Positives = 162/434 (37%), Gaps = 80/434 (18%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRAN----NGIAKDKYGASYLSNHMKTIR 48
           P V+DNGS  IK G +          +L+   + N     G+A D   +  + N  + +R
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 49  DISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLP 108
            +    +  P E G +  W     +W +  YN  +        N  E  +++TE      
Sbjct: 68  GL--LKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLA------NIEEHPMLITEAPLNPM 119

Query: 109 ELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKE 168
           +      +++FE +    ++ S  +    +A                             
Sbjct: 120 KNRNKMCEMLFETFGSPAVYVSIQAVLALYAG---------------------------- 151

Query: 169 YRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMM 224
            R    VID G  C   VP+  G     AI+++D+ GR    FL  LL+++      +  
Sbjct: 152 GRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSS 211

Query: 225 DETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
           +  I +  IKEK  FV+          ++Q        + +T F            +  G
Sbjct: 212 EREI-VRMIKEKACFVA-----TDVGNEEQNYEGANSAELETRF-----------KLPDG 254

Query: 285 SVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGN 344
            +  +TL  E+F  PE  F P +       + E   ++IS V   LR  L S+IV  GG+
Sbjct: 255 KI--LTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGS 312

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREE 404
                   RL SE+++    +   ++  P     + + W   +  +    ++   VTR E
Sbjct: 313 TMFSGFGDRLLSEIRKTSEPNTKIKIFAPPER--KYSTWIGGSILAGLSTFEKLWVTRAE 370

Query: 405 YLEHGTDWCSKHRF 418
           + E+    C   RF
Sbjct: 371 WQEN--PQCIHSRF 382

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 89/389 (22%), Positives = 153/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 148

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 204

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 205 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F     +  ++V+ +          +
Sbjct: 247 -RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QE 296

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 297 KTRRKAVDIGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 347

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPTDWTCR---VTVPSSSDCEL 380
            L +NIV  GG+        RL  +L         Q +L +        V+V S      
Sbjct: 348 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRN 407

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K    T+++Y E+G
Sbjct: 408 AVWFGGSLLAQTAEFKGYCHTKKDYEEYG 436

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 66/146 (45%), Gaps = 9/146 (6%)

Query: 280 GIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI-- 333
           G D      + L  ER   PE  F P M  + + G+ E     + +        L     
Sbjct: 597 GEDVHQQHQLHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCL 656

Query: 334 -LVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSST 392
            + SNI   GGN K+P++  R+ +E    LP +    V    + +  L AW  MA+F+ +
Sbjct: 657 DMASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNY--AQNVSLDAWKGMAKFARS 714

Query: 393 DVYKTTRVTREEYLEHGTDWCSKHRF 418
           D Y +T VT+ EY E G ++  +H+ 
Sbjct: 715 DTYSSTCVTKVEYEEFGPNYIKEHKL 740

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 85/228 (37%), Gaps = 44/228 (19%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRA------NNGIAKDKYGASYLSNHMKTIRDISSATI 55
            P  +D GSYE++ G  +  TP              K +   +++ N       + S + 
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS- 98

Query: 56  RRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLPELSK 112
           R P++   + +WE    +  Y  +        HLG   ++     +ILTE   T+     
Sbjct: 99  RSPYDGSLITNWEYMEDMLSYTFH--------HLGVQPNDGISNPMILTEKMATVQAQRS 150

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
           N  Q++FE Y    +       F  +AN     N     G                    
Sbjct: 151 NWYQLLFECYGIPQVTFGIDGLFSFYAN-----NSPDSTG-------------------- 185

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
            L+I+SG   T ++P+IKG       K++D GG      LK  LS ++
Sbjct: 186 -LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 98/428 (22%), Positives = 165/428 (38%), Gaps = 75/428 (17%)

Query: 9   GSYEIKFGHANLVTPFR-ANNGIAKDKYGAS--------YLSNHMKTIRDISSATIRRPH 59
           GS    FG+A   T F  A  G+  +             Y+ N         S ++  P 
Sbjct: 57  GSEASYFGNATSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPI 116

Query: 60  ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVF 119
             GQ+ +W+     W+  ++        +L     +   +LTE     PE  +   ++ F
Sbjct: 117 RHGQVENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 120 EEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXXXXXXXXXXXKEYRDFQLVIDS 178
           E +  A ++ +  +     A+   +K  +  L G                      VIDS
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---------------------VIDS 208

Query: 179 GFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETI-LLNNIKEKC 237
           G   T V+P+ +G     AIK + I GR +   ++  L  R     D ++     IK++ 
Sbjct: 209 GDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEY 266

Query: 238 LFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDER 295
            +V P  V  F+ F     +  ++V+ +          +++ RK +D G         ER
Sbjct: 267 CYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QEKTRRKVVDIGY--------ER 309

Query: 296 FAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSR 353
           F  PE FF+PE+A  + L P L   + + I   P  +R  L +NIV  GG+        R
Sbjct: 310 FLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 368

Query: 354 LTSEL---------QRQLPTDWTCR---VTVPSSSDCELAAWNAMAQFSSTDVYKTTRVT 401
           L  +L         Q +L +        V+V S      A W   +  + T  +K    T
Sbjct: 369 LQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHT 428

Query: 402 REEYLEHG 409
           +++Y E+G
Sbjct: 429 KKDYEEYG 436

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 87/424 (20%), Positives = 161/424 (37%), Gaps = 76/424 (17%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P VIDNGS  IK G +          +LV   + +  + +   G +++ N  + +R +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             ++ P E G +  W+    IW + L    +        N  E  L++TE      +  +
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQ------NIEEHPLLITEAPMNPLKNRE 125

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              QV+FE +    ++ S  +    +A+                             R  
Sbjct: 126 VMAQVLFETFNLPALYVSNPAVLSLYAS----------------------------GRTT 157

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM---DETIL 229
             VID G      VPI  G     ++ +MDIGGR +   L+  L       +    E  +
Sbjct: 158 GCVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI 217

Query: 230 LNNIKEK-CLFVSPVSYFDSFKTKQQQAVEYV--LPDFQTSFLGYLVDESNRKGIDRGSV 286
           +  IKEK C   + +   ++   ++ Q +  V  LPD +                     
Sbjct: 218 VRTIKEKVCYLATDIKKEENTYMQESQDLTSVFKLPDGKC-------------------- 257

Query: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346
             I + ++R+  PE  F P++      GL +  +++I  V   LR  L+S+I+  GG   
Sbjct: 258 --IEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTT 315

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYL 406
           L     R+  +L+    T  T ++ + +  + +   W   +  +    ++     + ++L
Sbjct: 316 LRGFGDRMLHDLEAF--TKGTSKIKIIAPPERKYTTWVGGSILTGLSTFQRLWTKKSDWL 373

Query: 407 EHGT 410
           E  T
Sbjct: 374 EDNT 377

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 63/133 (47%), Gaps = 10/133 (7%)

Query: 294 ERFAVPETFFHPEMANILKPG---LVETIL-EAISMVPEPLRPI---LVSNIVCVGGNFK 346
           ER  VPE  F P M    + G   L ETIL +     P  L      + +N+   GGN K
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVTREEY 405
           +P +  R+  E    LP      + +  SSD  L AW  MA  +  +  YK T ++R+EY
Sbjct: 677 VPGLKERIVKEFTGFLPV--GTNININMSSDPSLDAWKGMAALAQNEEEYKRTIISRKEY 734

Query: 406 LEHGTDWCSKHRF 418
            E+G D+  +H+ 
Sbjct: 735 EEYGPDYIKEHKL 747

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 97/424 (22%), Positives = 163/424 (38%), Gaps = 72/424 (16%)

Query: 8   NGSYEIKFGHANLVTPFRANNGIAKDKYGAS----YLSNHMKTIRDISSATIRRPHELGQ 63
           N +    F   NL +   +NN     K G      Y+ N         S ++  P   GQ
Sbjct: 68  NSTSATSFNDNNLSSMLLSNN--LAGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQ 125

Query: 64  LVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEYE 123
           + +W+     W+  ++        +L     +   +LTE     PE  +   ++ FE + 
Sbjct: 126 VENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQIAEIFFESFN 178

Query: 124 FATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFNC 182
            A ++ +  +     A+   +K  +  L G                      VIDSG   
Sbjct: 179 CAGLYIAVQAVLALAASWTSSKVTDRSLTGT---------------------VIDSGDGV 217

Query: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETI-LLNNIKEKCLFVS 241
           T V+P+ +G     AIK + I GR +   ++  L  R     D ++     IK++  +V 
Sbjct: 218 THVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERIKQEYCYVC 275

Query: 242 P--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVP 299
           P  V  F+ F    ++  ++V+ +           ES RK I       + +  ERF  P
Sbjct: 276 PDIVKEFNKFDRDGEKFAQFVVEN----------QESTRKKI-------VDVGYERFLAP 318

Query: 300 ETFFHPEMA--NILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSE 357
           E FF+PE+A  + L P L   + + I   P  +R  L +NIV  GG+        RL  +
Sbjct: 319 EIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 377

Query: 358 L---------QRQLPT---DWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405
           L         Q ++ +        V V S      A W   +  + T  +K    T+++Y
Sbjct: 378 LKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDY 437

Query: 406 LEHG 409
            E+G
Sbjct: 438 DEYG 441

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/389 (22%), Positives = 151/389 (38%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 101 YIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 153

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+    K  +  L G     
Sbjct: 154 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVTDRSLTGT---- 209

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   +++ L 
Sbjct: 210 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL- 251

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F     +  ++V+             
Sbjct: 252 -RERGEQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVES----------Q 300

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           E  RK I       + +  ERF  PE FF+PE+A  + L P L   + E I   P  +R 
Sbjct: 301 EKTRKKI-------VDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRK 352

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQ----RQLPTDWTCRVTVPSSSDCEL-------- 380
            L +NIV  GG+        RL  +++     ++        T  +  D ++        
Sbjct: 353 GLYNNIVLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRN 412

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 413 AVWFGGSLLAQTAEFKSYCHTKKDYDEYG 441

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/389 (22%), Positives = 153/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 148

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 204

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 205 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F     +  ++V+ +          +
Sbjct: 247 -RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVEN---------QE 296

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 297 KTRRKVVDIGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 347

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPTDWTCR---VTVPSSSDCEL 380
            L +NIV  GG+        RL  +L         Q +L +        V+V S      
Sbjct: 348 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRN 407

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K    T+++Y E+G
Sbjct: 408 AVWFGGSLLAQTAEFKGYCHTKKDYEEYG 436

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 294 ERFAVPETFFHPEMANILKPG---LVETIL------EAISMVPEPLRPILVSNIVCVGGN 344
           ER  VPE  F P M    + G   L ETIL      +   +    L   +V+NI+  GGN
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLD--MVNNILITGGN 674

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVTRE 403
            K+P +  R+  E    LP      V +  SS+  L AW  MA  +     YK T +++E
Sbjct: 675 AKVPGLRERIVKEFTEFLPVGTNVAVNI--SSNPSLDAWRGMAALARNKAEYKKTVISKE 732

Query: 404 EYLEHGTDWCSKHRF 418
           EY E+G D+  +H+ 
Sbjct: 733 EYEEYGPDYIKEHKL 747

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 80/228 (35%), Gaps = 55/228 (24%)

Query: 2   VPFVIDNGSYEIKFGHANLVTP----------FRANNGIAKDKYGASYLSNHMKTIRDIS 51
           +P  ID GS  ++ G  N  TP          FR      K     +++ N     + + 
Sbjct: 38  LPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDR----KLNKNFTFVGNDTLLDQAVR 93

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLP 108
           S + R P +   + +W     I DY  +        HLG   +N     ++LTE   T+ 
Sbjct: 94  SQS-RSPFDGPFVTNWNFTEEIMDYTFH--------HLGVLPNNGISNPILLTERMATVQ 144

Query: 109 ELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKE 168
               N  Q++FE Y    +      G     +   N    +  G                
Sbjct: 145 SQRANWYQILFETYNVPGV----TFGIDSLYSFYNNNPSGNKTG---------------- 184

Query: 169 YRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLL 212
                LVID     T VVPI+ G       K+++ GG     +LN L+
Sbjct: 185 -----LVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/389 (22%), Positives = 153/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 148

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 204

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 205 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F     +  ++V+ +          +
Sbjct: 247 -RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVEN---------QE 296

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 297 KTRRKVVDIGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 347

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPTDWTCR---VTVPSSSDCEL 380
            L +NIV  GG+        RL  +L         Q +L +        V+V S      
Sbjct: 348 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRN 407

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K    T+++Y E+G
Sbjct: 408 AVWFGGSLLAQTAEFKGYCHTKKDYEEYG 436

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 85/389 (21%), Positives = 154/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 107 YIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK-------YLRAEPEDHFF 159

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   ++  +  L G     
Sbjct: 160 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGT---- 215

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 216 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 257

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F  + ++  ++++ +          D
Sbjct: 258 -RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QD 307

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   +   I   P  +R 
Sbjct: 308 KTKQKVVDIGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRK 358

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPT------------DWTCRVTVPSSSDCEL 380
            L +NIV  GG+      S RL  +++  + +                 V V S      
Sbjct: 359 GLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRN 418

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 419 AVWFGGSLLAQTAEFKSYCHTKKDYEEYG 447

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 103/507 (20%), Positives = 183/507 (36%), Gaps = 130/507 (25%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKT--IRDISSATIRRP 58
           +   +ID GS+    G++    P      I    YG  Y+++  K     + S    R+ 
Sbjct: 14  ITAIIIDPGSFNTNIGYSGTDCP----QAILPSCYG-QYINDEEKPSLFNEQSIGLPRKD 68

Query: 59  HEL------GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
           +E+      G++V W+     W++ + +        L ++ +    +LTE  +   +  K
Sbjct: 69  YEIKEIVRSGEVVDWDKAQEQWEWAIKS------VLLFESNKGLPALLTEPIWNSEDNRK 122

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
            S +V+ E  +F   + +P +  + FA  +G                          R  
Sbjct: 123 KSLEVLLEGMDFEACYLTPTATAVSFA--MG--------------------------RPT 154

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH------------ 220
            LV+D G + T V P+I G+   K+  +  I G  LN L++ +L  R             
Sbjct: 155 CLVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRP 214

Query: 221 ---------------YNMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAV-------- 257
                           N ++E       KE  L V+P S    FK++ +Q          
Sbjct: 215 EFVKRSFDYEIHPSLLNFVNERQFFQEFKETMLQVAPTS-LTKFKSELEQLSKRSIEAPW 273

Query: 258 -EYVLPDFQTSFL------------------------------GYLVDESNRKGID---- 282
            E ++ D +T F                                Y+  + N+ G +    
Sbjct: 274 GEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVETWHNDYVPLKRNKPGANSKEK 333

Query: 283 RGSVQTITLTDERFAVPETFFH-----------PEMANILKPGLVETILEAISMVPEPLR 331
            G++    + DE    P    +           PE  N +  GL + I  +I      LR
Sbjct: 334 EGTIDATPVPDENSVTPSEHLNDQGKRSLEDDTPEAKNEIS-GLADLIHSSIMSTDVDLR 392

Query: 332 PILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSS 391
             L  N+V  GG+  +P ++ R+ +EL + LP      +T   + + +  +W   +  +S
Sbjct: 393 TTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSGQAREKQYQSWLGGSILAS 452

Query: 392 TDVYKTTRVTREEYLEHGTDWCSKHRF 418
              +    V ++EY E G D   K RF
Sbjct: 453 LGTFHQLWVGKQEYAEVGADRLLKDRF 479

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 10/133 (7%)

Query: 294 ERFAVPETFFHPEMANILKPGLVE----TILEAISMVPEPLRPI---LVSNIVCVGGNFK 346
           ER  VPE  F P +    + G+ E     +L+     P  L      +V+N+   GGN K
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTREEY 405
           +P +  R+  E    LP       +V  SSD  L AW  MA  + + + YK T ++++EY
Sbjct: 677 VPGLRERIVREFTEFLPV--GTNFSVNMSSDPSLDAWKGMAALAQNKEEYKKTVISKKEY 734

Query: 406 LEHGTDWCSKHRF 418
            E+G D+  +H+ 
Sbjct: 735 EEYGPDYIKEHKL 747

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 84/234 (35%), Gaps = 55/234 (23%)

Query: 2   VPFVIDNGSYEIKFGHANLVTP----------FRANNGIAKDKYGASYLSNHMKTIRDIS 51
           VP  ID GS +++ G  N   P          FR      K     +++ N     + + 
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDR----KLNKNFTFVGNDTLLDQAVR 93

Query: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLP 108
           S + R P +   + +W     I DY  +        HLG   +N     ++LTE   T+ 
Sbjct: 94  SQS-RSPFDGPFVTNWNFTEEIMDYTFH--------HLGVSPNNGVRNPILLTERMATVQ 144

Query: 109 ELSKNSDQVVFEEYEF--ATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXX 166
               N  Q++FE Y     T       GF    N  GNK                     
Sbjct: 145 SQRANWYQIMFETYNVPGVTFGIDSLYGFYN-QNTSGNKT-------------------- 183

Query: 167 KEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
                  LVID G   T V+P++ G       K+++ GGR     L + ++ ++
Sbjct: 184 ------GLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 132/327 (40%), Gaps = 54/327 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 98  YIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 150

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K ++  L G     
Sbjct: 151 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT---- 206

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 207 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 248

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D T+     IK++  +V    V  F+ F    Q+  ++++ +          +
Sbjct: 249 -RERGEEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVEN---------SE 298

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK ID G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 299 KTKRKVIDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 349

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQ 359
            L +NIV  GG+        RL  +L+
Sbjct: 350 GLYNNIVLSGGSTMFKDFGRRLQRDLK 376

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 88/382 (23%), Positives = 153/382 (40%), Gaps = 71/382 (18%)

Query: 8   NGSYEIKFGHANLVTPFRA--------NNGIAKDKYGAS----YLSNHMKTIRDISSATI 55
           NGS    FG++   T F          +N +A  K G      Y+ N         S ++
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLA-GKRGTEDLDFYIGNEALVAAQSPSYSL 121

Query: 56  RRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSD 115
             P   GQ+ +W+     W+  ++        +L     +   +LTE     PE  +   
Sbjct: 122 SYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHYFLLTEPPLNPPENREQVA 174

Query: 116 QVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXXXXXXXXXXXKEYRDFQL 174
           ++ FE +  A ++ +  +     A+   +K ++  L G                      
Sbjct: 175 EIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT--------------------- 213

Query: 175 VIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETI-LLNNI 233
           VIDSG   T V+P+ +G     AIK + I GR +   ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAERI 271

Query: 234 KEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITL 291
           K++  +V P  V  F+ F  + ++  ++++            +++ +K +D G       
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIVES---------QEKTKQKVVDVGY------ 316

Query: 292 TDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPH 349
             ERF  PE FF+PE+A  + L P L   + + I   P  +R  L +NIV  GG+     
Sbjct: 317 --ERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 373

Query: 350 MSSRLTSELQRQLPTDWTCRVT 371
            S R    LQR + +    R++
Sbjct: 374 FSRR----LQRDMKSIVNARIS 391

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 85/389 (21%), Positives = 154/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 103 YIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 155

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 156 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 211

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 212 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 253

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R    +D ++     IK++  +V P  V  F+ F     +  ++++ +           
Sbjct: 254 -RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVEN----------S 302

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ES +K I       + +  ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 303 ESTKKKI-------VDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 354

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQ----RQLPTDWTCRVTVPSSSDCEL-------- 380
            L +NIV  GG+        RL  +L+     ++        T  +  D ++        
Sbjct: 355 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRN 414

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 415 AVWFGGSLLAQTAEFKSYCHTKQDYEEYG 443

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 291 LTDERFAVPETFFHPEMANILKPGLVET----ILEAISMVPEPLRPI---LVSNIVCVGG 343
           L  ER  VPE  F P +  + + G+VE     +L+        L  I   +  NI   GG
Sbjct: 606 LNVERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGG 665

Query: 344 NFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTR 402
           N KLP +  R+  E    LP      V +  + D  ++AW  MA+F+ +T +Y+T+ +T+
Sbjct: 666 NAKLPGIRERVVREFTGFLPVGTNLNVKL--AEDPSMSAWRGMAKFANNTSLYETSIMTK 723

Query: 403 EEYLEHGTDWCSKH 416
           +EY E G ++  +H
Sbjct: 724 KEYEELGPEYIKEH 737

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 88/389 (22%), Positives = 154/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S  +  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 108 YIGNEALIAAQGPSYGLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHCF 160

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K ++  L G     
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT---- 216

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   +++ L 
Sbjct: 217 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL- 258

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F    ++  ++V+            +
Sbjct: 259 -RERGEEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVES---------QE 308

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK +D G         ERF  PE FF+PE+A  + L P L   +   I   P  +R 
Sbjct: 309 KTRRKVVDVGC--------ERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRK 359

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQ-----RQLPTDW-------TCRVTVPSSSDCEL 380
            L +NIV  GG+        RL  +L+     R + +++          V V S      
Sbjct: 360 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRN 419

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E G
Sbjct: 420 AVWFGGSLLAQTAEFKSYCHTKKDYEEIG 448

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 88/389 (22%), Positives = 153/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 109 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFF 161

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 162 LLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 217

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 218 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 259

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R    +D ++     IK++  +V P  V  F+ F     +  ++++ +          +
Sbjct: 260 -RERGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVEN---------QE 309

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   +   I   P  +R 
Sbjct: 310 QTRKKVVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRK 360

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL-----------QRQLPTDWT-CRVTVPSSSDCEL 380
            L +NIV  GG+        RL  +L           +R   T  T   V V S      
Sbjct: 361 GLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRN 420

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 421 AVWFGGSLLAQTAEFKSYCHTKKDYEEYG 449

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 87/389 (22%), Positives = 152/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+  W      W+  ++        +L     +   
Sbjct: 102 YIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK-------YLRTEPEDHFF 154

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 155 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 210

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 211 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL- 252

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R    +D ++     IK++  +V P  V  F+ F     +  ++++ +          +
Sbjct: 253 -RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVEN---------KE 302

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 303 KTQKKVVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRK 353

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPT---DWTCRVTVPSSSDCEL 380
            L +NIV  GG+        RL  +L         Q +L +        V V S      
Sbjct: 354 GLYNNIVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRN 413

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 414 AVWFGGSLLAQTAEFKSYCHTKKDYEEYG 442

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 294 ERFAVPETFFHPEMANILKPGLVET----ILEAISMVPEPLRPI---LVSNIVCVGGNFK 346
           ER  VPE  F P +    + G+ E     I +     P  L      +  N+  VGGN +
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRVTREEY 405
           +P + SR+  E    LP+D   ++ V  S    L  WN M + ++T+  Y+ T VT EEY
Sbjct: 677 VPGLKSRVVKEFTEFLPSD--TKINVNISEAPTLDVWNGMYRLANTEEDYQRTIVTSEEY 734

Query: 406 LEHGTDWCSKHRFT 419
            E G D+  +H+ +
Sbjct: 735 DECGVDYLKEHKLS 748

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 152/390 (38%), Gaps = 68/390 (17%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N   T     + ++  P + GQ+ +W      W+  ++        +L     +   
Sbjct: 105 YIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK-------YLRTEPEDHFF 157

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 213

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 214 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 255

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R    +D ++     IK++  +V P  V  F+ F     +  ++++ +           
Sbjct: 256 -RERGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN---------QG 305

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   +   I   P  +R 
Sbjct: 306 KTQKKIVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRK 356

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCR-------------VTVPSSSDCE 379
            L SNIV  GG+        RL  +L R +  D   +             V V S     
Sbjct: 357 GLYSNIVLSGGSTMFKDFGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQR 415

Query: 380 LAAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
            A W   +  + T  +K+   T+ +Y E+G
Sbjct: 416 NAVWFGGSLLAQTAEFKSYCHTKRDYEEYG 445

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 62/131 (47%), Gaps = 10/131 (7%)

Query: 294 ERFAVPETFFHPEMANILKPGLVET----ILEAISMVPEPLRPI---LVSNIVCVGGNFK 346
           ER  VPE  F P M    + G+ E     +L         L  +   +  N+   GGN K
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTREEY 405
           LP +  R+  E    LP+      ++  S D  L AW  MA+ + +T+ +K   +T++EY
Sbjct: 671 LPGLRERIVKEFSEFLPS--GSPFSIRKSQDPSLDAWRGMAKLAQNTEDFKHGYITKQEY 728

Query: 406 LEHGTDWCSKH 416
           LE+G ++  +H
Sbjct: 729 LEYGPEYIKEH 739

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 10/136 (7%)

Query: 289 ITLTDERFAVPETFFHPEMANILKPGLVET----ILEAISMVPEPLRPI---LVSNIVCV 341
           I +  ER  VPE  F P +    + G+ E      L   +  P  L  I   +++N+   
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSS-TDVYKTTRV 400
           GG+ KLP +  R+  E    LP     ++++  S+D  L  W  MA+ +S TD  K  +V
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPV--GTKMSINISNDPSLDTWKGMAKLASNTDYLKKIQV 734

Query: 401 TREEYLEHGTDWCSKH 416
           T+++Y E+G ++  +H
Sbjct: 735 TKKDYEEYGPEYMMEH 750

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 100/261 (38%), Gaps = 61/261 (23%)

Query: 2   VPFVIDNGSYEIKFGHANLVTPFRA-NNGIAKDKYGASYLSNHMKTIRDISS------AT 54
           +P  ID GSY +K G+ N   P     N + +  Y    L+  M  I + ++        
Sbjct: 37  IPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRIQ 94

Query: 55  IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTR----EQDLILTETCFTLPEL 110
            +RP++   + +WE    I+DY L+        HLG  T        +ILTE    L   
Sbjct: 95  AKRPYDGLFIANWEYAEEIFDYTLH--------HLGVQTTNGSISNPIILTEKMACLQSQ 146

Query: 111 SKNSDQVVFEEYEFATMFKSPASGF-----MPFANLIGNKNMEHLCGKXXXXXXXXXXXX 165
             N  Q++FE       F  P++ F       F N   N                     
Sbjct: 147 RANWYQLLFE------TFDVPSATFGLDSLYAFYNNCANP-------------------- 180

Query: 166 XKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHY 221
              +    LVI+ G   T +VPI++G       K+++ GGR    +L+ LL  TL + ++
Sbjct: 181 ---FESDGLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYF 235

Query: 222 NMMDETILLNNIKEKCLFVSP 242
                      + E   +VSP
Sbjct: 236 PTKLSEFQYQTMYEDFCYVSP 256

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 132/327 (40%), Gaps = 54/327 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ +         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 92  YIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHYF 144

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K ++  L G     
Sbjct: 145 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT---- 200

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 201 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 242

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D T+     IK++  +V    V  F+ F    ++  ++++ +          +
Sbjct: 243 -RERGEEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVEN---------SE 292

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ RK ID G         ERF  PE FF+PE+A  + L P L   + + I   P  +R 
Sbjct: 293 KTRRKVIDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRK 343

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQ 359
            L +NIV  GG+        RL  +L+
Sbjct: 344 GLYNNIVLSGGSTMFKDFGRRLQRDLK 370

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 85/389 (21%), Positives = 152/389 (39%), Gaps = 66/389 (16%)

Query: 39  YLSNHMKTIRDISSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDL 98
           Y+ N         S ++  P   GQ+ +W+     W+  ++        +L     +   
Sbjct: 96  YIGNEALAAAQGPSYSLSYPIRHGQIENWDHMERFWENSIFK-------YLRTEPEDHFF 148

Query: 99  ILTETCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEH-LCGKXXXX 157
           +LTE     PE  +   ++ FE +  A ++ +  +     A+   +K  +  L G     
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT---- 204

Query: 158 XXXXXXXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
                            VIDSG   T V+P+ +G     AIK + I GR +   ++  L 
Sbjct: 205 -----------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNMMDETI-LLNNIKEKCLFVSP--VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVD 274
            R     D ++     IK++  +V P  V  F+ F     +  ++++ +          +
Sbjct: 247 -RERGETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVEN---------QE 296

Query: 275 ESNRKGIDRGSVQTITLTDERFAVPETFFHPEMA--NILKPGLVETILEAISMVPEPLRP 332
           ++ +K +D G         ERF  PE FF+PE+A  + L P L   +   I   P  +R 
Sbjct: 297 KTQKKIVDVGY--------ERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRK 347

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSEL---------QRQLPTDWTCR---VTVPSSSDCEL 380
            L +NIV  GG+        RL  ++         Q +L +        V V +      
Sbjct: 348 GLYNNIVLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRN 407

Query: 381 AAWNAMAQFSSTDVYKTTRVTREEYLEHG 409
           A W   +  + T  +K+   T+++Y E+G
Sbjct: 408 AVWFGGSLLAQTAEFKSYCHTKKDYEEYG 436

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/421 (19%), Positives = 160/421 (38%), Gaps = 80/421 (19%)

Query: 3   PFVIDNGSYEIKFGHA----------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS 52
           P V+DNGS  +K G            +L+   + +  +        ++ N  +  R +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +R P + G + +WE    +WD+       F       N  E  L++TE         +
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDHI------FKDCLKVSNLGEHPLVVTEAPLNPKPNRE 124

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              + +FE +    ++ +  +    +A+                             R  
Sbjct: 125 KMCETLFESFNIPALYIANPAVLSLYAS----------------------------GRTT 156

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMM-----DET 227
             V+++G      VPI +G     +I+++DIGGR +   L+  L  R    M      E 
Sbjct: 157 GCVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSSSEQ 214

Query: 228 ILLNNIKEKCLFVSPVSYFDSFK---TKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
            ++  IKE   ++      +  K    ++++++ + LPD +   +G              
Sbjct: 215 EIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIG-------------- 260

Query: 285 SVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGN 344
                     RF  PE  F+P +       L + I+++IS V   LR  L++NI   GG+
Sbjct: 261 --------PGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGS 312

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREE 404
                   RL +EL      D T +V + +  + + +A+   +  ++   ++   VT+++
Sbjct: 313 TMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILANLSTFRNMWVTKDQ 370

Query: 405 Y 405
           +
Sbjct: 371 W 371

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 83/418 (19%), Positives = 156/418 (37%), Gaps = 69/418 (16%)

Query: 3   PFVIDNGSYEIKFGHANLVTPF----------RANNGIAKDKYGASYLSNHMKTIRDISS 52
           P ++DNGS  IK G A    P            A   +       +Y+ N     R  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSK 112
             +  P+    ++SW+    +WDY L N  E +        +E  ++LT +  T  +  +
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQL------QEHPVVLTNSMSTSKKEEE 123

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
              +V+FE++    ++ S      P  +L G                          R  
Sbjct: 124 KMCEVLFEKFSIPAIYCSRD----PIMSLYGLG------------------------RTT 155

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH---YNMMDETIL 229
              +  G     +  +I G+    + +  + GG  +   + + L   H    N  +   L
Sbjct: 156 GCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIEL 215

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTI 289
           + +IKE+C  +S   +++  +        Y L   +TS   Y + + N           I
Sbjct: 216 IRSIKERCCVLSK-DFYNEIRA-------YELITSKTSNNKYRLPDGN----------II 257

Query: 290 TLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPH 349
            +  ERF  PE  F+P+     +  L + I+ +IS      R  L+ +IV  GG+  +  
Sbjct: 258 EIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKG 317

Query: 350 MSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407
              RLT E+++++  D   ++ + +  +     W   +  S     K    ++  Y E
Sbjct: 318 FGERLTKEIRKEI--DGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSKSAYRE 373

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 89/433 (20%), Positives = 162/433 (37%), Gaps = 78/433 (18%)

Query: 3   PFVIDNGSYEIKFGHANLVTP----FRANNGIAKDKYGASYLSNHMKTIRDISSAT---- 54
           P V+DNGS  IK G +    P    +        DK  A  LS+  + + + +       
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 55  -IRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
            ++ P E G +  W     +W +  Y+  + +      N  +  +++TE      E    
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLN------NIGDHPMLVTEAPLNPLENRDK 124

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
             ++++E +    ++ S  +    +A                              R   
Sbjct: 125 MCEMLYETFNVPAVYVSIQAVLALYAG----------------------------GRTTG 156

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMDETIL 229
            VID G  C   VP+  G     AI+++D+ GR    FL  LL++++     +  +  I+
Sbjct: 157 CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREIV 216

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAVE----YVLPDFQTSFLGYLVDESNRKGIDRGS 285
              IKEK  +V+P    +  K    +  E    + LPD +                    
Sbjct: 217 -RMIKEKACYVAPEVAAEEQKYASSRGSEELTKFKLPDGKI------------------- 256

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
              ++L  E+F  PE  F P++       + +   ++IS V   LR  L S++V  GG+ 
Sbjct: 257 ---LSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGST 313

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405
                  RL +EL+ +   +   ++  P     + + W   +  +    ++   VTR E+
Sbjct: 314 LFAGFGDRLLNELRSRCEPNVKIKIFAPPER--KYSVWIGGSILAGLSTFEKIWVTRSEW 371

Query: 406 LEHGTDWCSKHRF 418
            E+    C   RF
Sbjct: 372 QEN--PQCVHSRF 382

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 85/422 (20%), Positives = 164/422 (38%), Gaps = 74/422 (17%)

Query: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIA-KDKYGA---------SYLSNHMKTIRDISS 52
           P V+DNGS  +K G +   TP      +A K +Y           +++ N  + +R    
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--GL 70

Query: 53  ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTRE---QDLILTETCFTLPE 109
             +RRP   G++ +W+    +W +  Y+        LG    +     L++TE      +
Sbjct: 71  LALRRPISRGEVTNWDDMELLWSHIFYSK-----LQLGQGNSQIGDHPLLITEAPLNSTK 125

Query: 110 LSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEY 169
             +   ++++E + F  ++ +  +    +A            G+                
Sbjct: 126 NRETMCEILYETFNFDALYVAHPAVLSLYA-----------TGQTTG------------- 161

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGR----FLNGLLKETLSFRHYNMMD 225
                V++ G   +   P+ +G     +I+++DIGGR     L   ++++     ++  +
Sbjct: 162 ----CVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSE 217

Query: 226 ETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGS 285
           + I+   IKEK  +V+    F+  K                    ++ +  N   +    
Sbjct: 218 QEIV-RTIKEKANYVALDYKFEEEKF-------------------FIHERENTSTVKLPD 257

Query: 286 VQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNF 345
            Q +T    ++   E  F P++       + E +LE+I+ V   LR  L+ NIV  GG  
Sbjct: 258 GQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTT 317

Query: 346 KLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEY 405
            L     R  SE ++ LP     +V + S ++    AW   +  S    ++   +TRE Y
Sbjct: 318 MLKGFDQRTMSETKKMLPKH--TKVKIRSLAERSYIAWIGGSILSGLYGFRNLWLTREMY 375

Query: 406 LE 407
            E
Sbjct: 376 EE 377

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 289 ITLTDERFAVPETFFHPEMANILKPG---LVETILE-AISMVPEPLRPI---LVSNIVCV 341
           + L  ER  VPE  F P +    + G   L ETIL       P  L      +  NI   
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDV-YKTTRV 400
           GG+ KLP +  R+  E    LP     ++ V  S +  L AW  M + +  +  YK + +
Sbjct: 669 GGHSKLPGLRERIVKEFTGFLPV--GTKLGVKMSKNPSLDAWYGMRKLAQNEADYKDSII 726

Query: 401 TREEYLEHGTDWCSKHRF 418
           ++++Y E+G ++  +H+ 
Sbjct: 727 SKKDYEEYGAEYIKEHKL 744

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 89/228 (39%), Gaps = 44/228 (19%)

Query: 2   VPFVIDNGSYEIKFGHANLVTP---FRANNGIAKDKYGA---SYLSNHMKTIRDISSATI 55
            P  ID GSYE++ G+ +   P   F       +D+  +   +++ N +   + + S + 
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS- 95

Query: 56  RRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLG---DNTREQDLILTETCFTLPELSK 112
           + P +   + +W+    I  Y           HLG   DN+    LI+ E   +L    K
Sbjct: 96  KSPFDGSFIANWDYVEDIMQYTFN--------HLGVVGDNSVRNPLIINEPLGSLQSQRK 147

Query: 113 NSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDF 172
           N  +++FE +    +       F  +AN  GN++                          
Sbjct: 148 NWYELLFECFHLPNVSFGIDGMFGFYANNEGNQD-------------------------- 181

Query: 173 QLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
            +VI+     T V+P++ G       K+++ GGR     L + +S ++
Sbjct: 182 GIVINCSNEETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 57/120 (47%), Gaps = 14/120 (11%)

Query: 294 ERFAVPETFFHPEMANILKPGLVE---TIL------EAISMVPEPLRPILVSNIVCVGGN 344
           ER  VPE  F P M    + G++E   TIL      E   + P  L   + +N+   GGN
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLWITGGN 671

Query: 345 FKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFS-STDVYKTTRVTRE 403
            KLP M  R+  E    LP        V  S +  L AWN MA+ + +++ YK T ++++
Sbjct: 672 SKLPGMKERIVKEFTGFLPV--GTAFNVKQSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 49/106 (46%)

Query: 313 PGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTV 372
           PG+V+ I  +I      LR  L  NIV  GG   +P  S RL  EL ++LP      +T 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 373 PSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
             + + +  AW   +  SS   +    V ++EY E G D   K RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 64/159 (40%), Gaps = 34/159 (21%)

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           G+++ W+     WD+ L N       +L  N+      LTE  +   E  K S +V+ E 
Sbjct: 95  GEVIDWDGAQEQWDWALKN-----ALYLESNSG-IPAFLTEPIWNTVENRKKSLEVLLEG 148

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
            +F   + SP    + FA+  G  N    C                      LV+D G +
Sbjct: 149 LQFEACYLSPTPTCISFAS--GRPN----C----------------------LVVDIGHD 180

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
              V P+I G+   K+  +  I GRF+N  +KE L  R 
Sbjct: 181 VASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 87/219 (39%), Gaps = 45/219 (20%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATI-RRPHEL-- 61
           VID GSY    G++    P      I    YG S      KTI    S  I R+ +EL  
Sbjct: 18  VIDPGSYTTNIGYSGSDFP----QSILPSVYGKSTSDKDSKTIFSEQSIGIPRKDYELKP 73

Query: 62  ----GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQV 117
               G ++ W+     W + L N       +L  N+    L LTE  +   E  K S +V
Sbjct: 74  IIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPAL-LTEPVWNSTENRKKSLEV 127

Query: 118 VFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVID 177
           + E  +F   + +P S  + FA   G  N                           LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFA--AGRPNC--------------------------LVVD 159

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
            G +   V PI+ G+   K+ ++  I G+F+N L+K+ +
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL + +  +I      LR  L  N+V  GG   +P +S RL +EL + LP+     +T  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
            + + +  +W   +  +S   +    V ++EY E G D     RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 104/271 (38%), Gaps = 44/271 (16%)

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH-----YNMM 224
           R   LV+D G +   V PI+ G      I +    G FL+  L + L  R      Y+  
Sbjct: 138 RSTALVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDRPDGTSLYHWQ 197

Query: 225 DETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
                + + K   L VS +   +  K  Q+Q++ ++            +    RK     
Sbjct: 198 QSRTWMRDFKNTMLQVSLMRLSEVEKQLQKQSISFIP-----------IPLEGRKHFLFK 246

Query: 285 SVQTITLTDER-FAVPETFFHPEMANI---LKPGLVETILEAI----------------- 323
             +T+T   ++ + +PE+ F P   +       GL + + +AI                 
Sbjct: 247 RQKTVTWDLKQCYRIPESLFDPSSVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQP 306

Query: 324 ------SMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSD 377
                 S  PE +   L++N+V +GG   L  +  RL ++L  Q P         P+  D
Sbjct: 307 AAAGLPSATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVD 366

Query: 378 CELAAWNAMAQFSSTDVYKT-TRVTREEYLE 407
            +L +W           +K  + VT++EYLE
Sbjct: 367 RQLQSWQGGVNMCHLPDWKLGSWVTKQEYLE 397

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 80/187 (42%), Gaps = 12/187 (6%)

Query: 232 NIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITL 291
           NIK+K    +  +  D  +T ++   + +L           ++E+ ++ I+ G       
Sbjct: 421 NIKDKENNNNGNNNND--ETSKEHTADAILAPTNADTPSENINENGKRSIEDG------- 471

Query: 292 TDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMS 351
             E   VP+     ++ NI+ PG+ + +   ++     LR  L  N++  GG   +P ++
Sbjct: 472 --ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLA 528

Query: 352 SRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTD 411
            RL  EL ++LP      ++     + +  AW   +  +S   +    V + EY E G D
Sbjct: 529 DRLMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPD 588

Query: 412 WCSKHRF 418
              K RF
Sbjct: 589 RLLKDRF 595

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 116/291 (39%), Gaps = 65/291 (22%)

Query: 51  SSATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           S   ++R  E G +  W++    W + L      D F      +    +LTE  +   + 
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF------KGIPALLTEPVWNTVQN 210

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            K S +V+ E+ EF   + +     + FA   G  N    C                   
Sbjct: 211 RKKSLEVLLEKMEFEACYLTTIPTNVSFA--AGKPN----C------------------- 245

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILL 230
              LV+D G +   V P+I G+   K++++    GR+LN LL+  +  R      E I L
Sbjct: 246 ---LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPR------EIIPL 296

Query: 231 NNIKEK-----------CLFVSPVSYFDSFKTKQQ--QAVEYVLPDFQTSFLGYLVDE-- 275
             ++++            +  S +SY +  +  Q+  + +  + P+   SFL  + DE  
Sbjct: 297 FMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKETLCQIYPN--NSFLANVKDELE 354

Query: 276 -SNRKGIDRGSVQTITLTD-ERFAVPETFFHPEMANI------LKPGLVET 318
            S ++ I+    + I   +  RF   E  F+P  +NI       K G+VET
Sbjct: 355 SSAKRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNIPDNWNTSKDGIVET 405

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 86/219 (39%), Gaps = 45/219 (20%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATI-RRPHEL-- 61
           VID GSY    G++    P      I    YG        K I    S  I R+ +EL  
Sbjct: 18  VIDPGSYTTNIGYSGSDFP----QSILPSVYGKYTADEGKKNIFSEQSIGIPRKDYELKP 73

Query: 62  ----GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQV 117
               G ++ W+     W + L N       +L  N+    L LTE  +   E  K S +V
Sbjct: 74  IVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPAL-LTEPVWNSTENRKKSLEV 127

Query: 118 VFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVID 177
           + E  +F   + +P S  + FA   G  N    C                      LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFA--AGRPN----C----------------------LVVD 159

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
            G +   V PI+ G+   K+ ++  + G+F+N L+K+ L
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL   +  +I      LR  L  N+V  GG   +P +S RL +EL + LP+     +T  
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
            + + +  +W   +  +S   +    V ++EY E G +     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL + +  AI+     LR  L  N+V  GG+  +P ++ RL +EL ++LP      +T  
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +  AW   +  SS   +    V R+EY E G +   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 82/221 (37%), Gaps = 40/221 (18%)

Query: 5   VIDNGSYEIKFGHAN-----LVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPH 59
           VID GSY    G++      L  P       A  K G    ++    I       I+R  
Sbjct: 18  VIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFEIKRIL 76

Query: 60  ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVF 119
           E G +V WE     W + + +  +F+ F      +     LTE  +   E  K S +V+ 
Sbjct: 77  ENGCVVDWEAAQEQWAWAIRDELKFESF------KGTPAFLTEAIWNPEENRKKSLEVLL 130

Query: 120 EEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSG 179
           E  EF   + +P +    FA  +G                          R   LV+D G
Sbjct: 131 EGMEFEACYIAPTATCTSFA--MG--------------------------RPTCLVLDIG 162

Query: 180 FNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
            +   V P++ G+   K+  +  + G+ LN L++  L  R 
Sbjct: 163 HDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 85/219 (38%), Gaps = 45/219 (20%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATI-RRPHEL-- 61
           VID GSY    G++    P      I    YG        K I    S  I R+ +EL  
Sbjct: 18  VIDPGSYTTNIGYSGSDFP----QSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELKP 73

Query: 62  ----GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQV 117
               G ++ W+     W + L N       +L  N+    L LTE  +   E  K S +V
Sbjct: 74  IIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPAL-LTEPVWNSTENRKKSLEV 127

Query: 118 VFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVID 177
           + E  +F   + +P S  + FA   G  N                           LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFA--AGRPNC--------------------------LVVD 159

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
            G +   V PI+ G+   K+ ++  I G+F+N L+K+ L
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL + +  +I      LR  L  N+V  GG   +P +S RL +EL + LP+     +T  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
            + + +  +W   +  +S   +    V ++EY E G +     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 88/232 (37%), Gaps = 50/232 (21%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYG----ASYLSNHMKT-IRDISSATI 55
           +   VID GSY    G++    P      I    YG     +   N  KT +    S  +
Sbjct: 12  ITSIVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGL 67

Query: 56  RRPH-------ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLP 108
            RP        E G++  W+     WD+ L N        L  N+    ++LTE  +   
Sbjct: 68  ARPDYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSG-IPVLLTEPIWNSV 121

Query: 109 ELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKE 168
           E  K S +V+ E  +F   + SP S  + FA   G  N                      
Sbjct: 122 ENRKKSLEVLLEGMDFEACYLSPVSTCVSFA--AGRPNC--------------------- 158

Query: 169 YRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
                LV+D G + T V P+I G+   K+  +  I GR++N L++  L  R 
Sbjct: 159 -----LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           G+ + +  +I      LR  L  N+V  GG   +P ++ RL  EL ++LP      +T  
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +  AW   +  +S   +    V +EEY E G D     RF
Sbjct: 470 HLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 46/105 (43%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL + I  +I      LR  L  N+V  GG   LP +  R+++EL R LP      +T  
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +   W   +  +S   +    V ++EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/349 (20%), Positives = 129/349 (36%), Gaps = 81/349 (23%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHE 60
           +   VID GS+    G++    P      I    YG        +   + S    R+ +E
Sbjct: 14  ITAVVIDPGSFTTNIGYSGTDCP----QAILPSCYGKYTEGEKDELFSEQSIGLPRKDYE 69

Query: 61  L------GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNS 114
           +      G++V WE     WD+ + +   F      +       +LTE  +   E  K S
Sbjct: 70  IHNIVQNGEVVDWEKAEKQWDWAIRSELRF------ETNSGMPALLTEPIWNSEENRKKS 123

Query: 115 DQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQL 174
            +V+ E  +F+  +  P +  + FA  +G                          R   L
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSFA--MG--------------------------RPTCL 155

Query: 175 VIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIK 234
           V+D G + T V P++ G+   K+  +  I G  LN L++  L+ R      + I L  + 
Sbjct: 156 VVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR------KVIPLFQVA 209

Query: 235 EK-----------------CLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESN 277
           ++                   FV+   +F  FK    Q     +  F++      ++ ++
Sbjct: 210 QRRPVFMERKFDYEIHPSLQKFVNERQFFQEFKETMLQVAPTSISKFKSE-----IETTS 264

Query: 278 RKGIDR--------GSVQTITLTDERFAVPETFFHPEMANILKPGLVET 318
           ++ I+          S+Q +   ++ F  P+    PE   I K G+VET
Sbjct: 265 KRSIEAPWGEELVYDSLQRLEFAEQLF-TPDLSQFPEDWPISKDGVVET 312

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 111/296 (37%), Gaps = 68/296 (22%)

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL------------- 216
           R+  LV+D G +   V PII G     A+ +    G FL+  + E L             
Sbjct: 137 RNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDS 196

Query: 217 ----SFRHYNMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYL 272
               SF+++        +++ K   L VSP    +    +   A  +   D +  FL   
Sbjct: 197 KVPESFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFL--- 251

Query: 273 VDESNRKGIDRGSVQTITLTD-ERFAVPETFFHPEMAN---ILKPGLVETILEAI----- 323
                +KG      +T+TL   E + + E  F P++A+     K GL E +++A+     
Sbjct: 252 ----YKKG-----NKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGA 302

Query: 324 ---------------------------SMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTS 356
                                      +  PE +   L++NIV  G    +P +  R+ +
Sbjct: 303 AVTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVN 362

Query: 357 ELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTR-VTREEYLEHGTD 411
           EL  Q P         P   D +L +W      S+   ++    +TR+EY  +G +
Sbjct: 363 ELSYQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 87/219 (39%), Gaps = 45/219 (20%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGA-SYLSNHMKTIRDISSATIRRPHEL-- 61
           VID GSY    G++    P      I    YG  +   N  K   + S    R+ +EL  
Sbjct: 18  VIDPGSYTTNIGYSGSDFP----QSILPSVYGKLTADENSKKMFSEQSIGIPRKDYELKP 73

Query: 62  ----GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQV 117
               G ++ W+     W + L N       +L  N+    L LTE  +   E  K S +V
Sbjct: 74  IIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPAL-LTEPVWNSMENRKKSLEV 127

Query: 118 VFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVID 177
           + E  +F   + +P S  + FA   G  N    C                      LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFA--AGRPN----C----------------------LVVD 159

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
            G +   V PI+ G+   K+ ++  I G+F+N L+++ L
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL   +  +I      LR  L  N+V  GG   +P +S RL +EL + LP+     +T  
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 442

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +  +W   +  +S   +    V ++EY E G +     RF
Sbjct: 443 HIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 63/145 (43%), Gaps = 7/145 (4%)

Query: 274 DESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPI 333
           +E+N  GID  S +T     +R        +PE  N +  GL + I  +I      LR  
Sbjct: 359 EEANEDGID--SSETPNENGKR----PVDDNPESKNEIA-GLTDLIYSSIMATDVDLRAT 411

Query: 334 LVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTD 393
           L  N+V  GG   +P ++ R+ +EL + LP      +T     + +  +W   +  SS  
Sbjct: 412 LAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSGHLKERQYQSWLGGSILSSLG 471

Query: 394 VYKTTRVTREEYLEHGTDWCSKHRF 418
            +    V ++EY E G     K RF
Sbjct: 472 TFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 58/155 (37%), Gaps = 34/155 (21%)

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           G ++ W+     W + + +   F+      +T+     LTE  +   E  K S +V+ E 
Sbjct: 92  GSVIDWDSAQEQWSWAIQHELHFE------STKGMPAFLTEPIWNTEENRKKSLEVLLEN 145

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
            EF   F SP    + FA  +G                          R   LV+D G +
Sbjct: 146 MEFEACFLSPTPTCVSFA--MG--------------------------RPTCLVVDIGHD 177

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
              V P++ G+   K+     I G  LN LL + L
Sbjct: 178 VCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%)

Query: 313 PGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTV 372
           PG+V+ I  +I+     LR  L  N+V  GG   +P +S R+  EL ++LP      +  
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 373 PSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
             + + +  +W   +  SS   +    V ++EY E G D     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 60/159 (37%), Gaps = 34/159 (21%)

Query: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121
           G++V W+     W + L N        L  N     L LTE  +   E  K S +V+ E 
Sbjct: 101 GEVVDWDAAQEQWSWALENE-----LFLKSNEGVPAL-LTEPIWNTVENRKKSLEVLLEG 154

Query: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVIDSGFN 181
             F   + S     + FA   G  N                           LV+D G +
Sbjct: 155 MGFEACYLSATPTCVSFA--AGRSNC--------------------------LVVDIGHD 186

Query: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
              V P++ G+ F K+ ++  I G++LN L+ + L  R 
Sbjct: 187 IISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 48/105 (45%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           G+V+ I +++      LR  L  N+V  GG  K+P +S R+  EL + LP      ++  
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +   W   +  +S   +    V REEY E G +   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/321 (20%), Positives = 118/321 (36%), Gaps = 62/321 (19%)

Query: 4   FVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRD-------ISSATIR 56
            VID GS+    G++    P      I    YG        K I +        +   I+
Sbjct: 17  IVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 57  RPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQ 116
              E   +V W+     W+Y L    +F+      + +   ++LTE  +      K S +
Sbjct: 73  PIVENSTIVDWDRAQEQWEYALNTDLKFE------SNKGTPVLLTEPIWNSEASRKKSLE 126

Query: 117 VVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVI 176
           ++ E  EF   + +  S  + FA  +G                          R   LV+
Sbjct: 127 ILLESMEFEACYLAANSSAVSFA--MG--------------------------RPTCLVV 158

Query: 177 DSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEK 236
           D G + + V P+I G+   K+  +  + G++LN L+ + L  R         +   +K+K
Sbjct: 159 DIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREI-----VPIFQVLKKK 213

Query: 237 CLFVSPVSYFD------SFKTKQQ------QAVEYVLPDFQTSFLGYLVDESNRKGIDRG 284
             FV     FD      +F  ++Q      + + ++ P   +SF   L  ++ R      
Sbjct: 214 PDFVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLEAPW 273

Query: 285 SVQTITLTDERFAVPETFFHP 305
             + I   D R++  E  F P
Sbjct: 274 GEELIFDADTRYSFAEQLFRP 294

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 106/277 (38%), Gaps = 40/277 (14%)

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETIL 229
           R+  LV+D G   + V PII G     A+ +    G FL+  + E L+       +E   
Sbjct: 134 RNTALVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGD 193

Query: 230 LNNIKEKCLFV--SPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287
            NN K+  L +  +  ++   FKT   Q     L D  ++ L  ++  +  K       +
Sbjct: 194 PNNRKDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALD-MMGLTYIKNFLLQKQK 252

Query: 288 TITLTDERFA-VPETFFHPEMAN---ILKPGLVETILEAIS---------------MVPE 328
           TI+LT ++   + E  F P   +   +   GL E + +++                  PE
Sbjct: 253 TISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPE 312

Query: 329 PLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNA--- 385
                L++NI+  G +  +  +  R+ ++L  Q P         P   D +L +W     
Sbjct: 313 QTHAALLTNILITGSSSLISGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQGGVT 372

Query: 386 MAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422
           MA   S D+                DW S+  +  +N
Sbjct: 373 MANLPSWDL---------------GDWVSQSDYEARN 394

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           G+ + +  +I      LR  L  N+V  GG   +P +S RL +EL  +LP      +T  
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
            + + +  +W   +  +S   +    V +EEY + G D     RF
Sbjct: 440 HTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 80/224 (35%), Gaps = 49/224 (21%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSN-----HMKTIRDISSATIRRPH 59
           VID GSY    G++    P      I    YG    ++       K   + S    R+ +
Sbjct: 18  VIDPGSYSTNIGYSGTDCP----QAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKDY 73

Query: 60  EL------GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKN 113
           E+      G ++ W+     W + L N       +L  N+    L LTE  +   E  K 
Sbjct: 74  EIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPAL-LTEPIWNTVENRKK 127

Query: 114 SDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQ 173
           S +++ E  +F   + +     + F                               R   
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGT----------------------------GRSSC 159

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLS 217
           LV+D G +   V P++ G+   K+ K+    G +LN L+K  +S
Sbjct: 160 LVVDLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 85/235 (36%), Gaps = 49/235 (20%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTP---FRANNGIAKDKYGASYLSNHMKT--IRDI---SS 52
           +   +ID GSY    G+A    P     ++ G   +   ++   N  KT   R +    S
Sbjct: 14  ITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQS 73

Query: 53  ATIRRPH-------ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCF 105
             I RP        E GQ+  W+     W + L N       H+  N R    +LTE  +
Sbjct: 74  IPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESN-RGIPAMLTEPLW 127

Query: 106 TLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXX 165
              E    S +++ E  EF   + +  S  + FA                          
Sbjct: 128 NSKENRSKSLEILLEGMEFEACYLTATSTAVSFAT------------------------- 162

Query: 166 XKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
               R   L++D G +   V P+I G+   K+ +     GRFLN LL + L  R 
Sbjct: 163 ---GRPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%)

Query: 313 PGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTV 372
           PG+V+ I  +IS     +R  L  N+V  GG+  +P +S R+ +EL  + P      +  
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 373 PSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTD 411
             S + +  +W   +  SS   +    + ++EY E G++
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSE 485

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 92/246 (37%), Gaps = 23/246 (9%)

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETIL 229
           R+  L++D G     V P+I G     AI +    G FL+  + + LS +      E   
Sbjct: 90  RNTALIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESH 149

Query: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTI 289
                E  L+ +  ++   FK+   Q     L D  ++ L  +     +  + R      
Sbjct: 150 EPTPLE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNFLYRRQKTIS 207

Query: 290 TLTDERFAVPETFFHPEMAN---ILKPGLVETILEAI---------------SMVPEPLR 331
            +  E  A+ E  F P   +       GL E + +A+               +  PE + 
Sbjct: 208 LMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIH 267

Query: 332 PILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNA---MAQ 388
             L++NIV  G +  +P +  R+ ++L  Q P         P   D +L +W     MA 
Sbjct: 268 AALLTNIVITGSSSLIPGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQGGVTMAN 327

Query: 389 FSSTDV 394
             S D+
Sbjct: 328 LPSWDL 333

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 7/146 (4%)

Query: 279 KGIDRGSVQTITLTDERFAVPETFFHPEMANILKP------GLVETILEAISMVPEPLRP 332
           K  D  +  T TL +    V E    P + +I +P      GL + +  AI      LR 
Sbjct: 352 KAEDTSATTTETLDNISDTVNENGKRP-VDDISEPTKNDIAGLADLVYSAIIKSDVDLRA 410

Query: 333 ILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSST 392
            L  N+V  GG+  +P +S RL  EL R+LP      ++   + + +  AW   +  +S 
Sbjct: 411 SLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGHTKERQYQAWLGGSILTSL 470

Query: 393 DVYKTTRVTREEYLEHGTDWCSKHRF 418
             +    V + EY E G +     RF
Sbjct: 471 GTFHQLWVGKNEYNEVGVERLLMDRF 496

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 95/246 (38%), Gaps = 50/246 (20%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTP---FRANNGIAKDKYGASYLSNHMKTIRDISSATIRR 57
           +   +ID GS+    G++    P     ++ G  K+       +   K I   SS  I R
Sbjct: 14  ITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPR 73

Query: 58  PH-------ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           P        E G ++ W+     W + L +       HL  +T     +LTE  +   E 
Sbjct: 74  PDYEIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHL-QSTSGIPALLTEPIWNSVEN 127

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
            K S +++ E   F   + S     + FA   G  N    C                   
Sbjct: 128 RKKSLEILLEGMNFEACYLSSVPTCVSFA--AGRPN----C------------------- 162

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILL 230
              LV+D G + T V P++ G+   K+  +  I G+++N L+++ L  R      E I L
Sbjct: 163 ---LVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPR------EIIPL 213

Query: 231 NNIKEK 236
            +IK++
Sbjct: 214 FSIKQR 219

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 307 MANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDW 366
           +AN++   ++ET ++        LR  L  N+V  GG+  +  ++ RL +EL ++LP   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 367 TCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              +T     + +  AW   +  SS   +    V R+EY E G +   K RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 86/223 (38%), Gaps = 44/223 (19%)

Query: 5   VIDNGSYEIKFGHA-------NLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRR 57
           VID GSY    G++       N+ + +    G  K+    S+    M   R      I+R
Sbjct: 18  VIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGK-KSFNDQFMGMAR--PDFEIKR 74

Query: 58  PHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQV 117
             E G +V WE     W + + +  +F  F      +     LTE  +   E  K S +V
Sbjct: 75  ILEDGCVVDWEAAQEQWTWAIRDELKFGSF------KGTPAFLTEAIWNSEENRKKSLEV 128

Query: 118 VFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYRDFQLVID 177
           + E  EF   + +P +  + FA  +G                          R   LV+D
Sbjct: 129 LLEGMEFEACYIAPTATCVSFA--MG--------------------------RPTCLVVD 160

Query: 178 SGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
            G +   V P++ G+   K+  +  + G+ LN L+++ L  R 
Sbjct: 161 IGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 40/89 (44%)

Query: 330 LRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQF 389
           LR  L  NIV  GG   +P  S RL SEL ++LP      +T     + +  AW   +  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 390 SSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
           +S   +    V ++EY E G D     RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 80/226 (35%), Gaps = 48/226 (21%)

Query: 1   MVPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYG---ASYLSNHMKTIRDISSATIRR 57
           +   VID GS+    G +    P      I    YG   A    N  K I    S  I R
Sbjct: 14  ITAVVIDPGSFSTNIGFSGTDCP----QAILPSCYGEQKAETEDNAPKKIFAEQSIGIPR 69

Query: 58  PH-------ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110
           P        +   +V W+     W + L      D  +L  N+    L LTE  +   E 
Sbjct: 70  PDYEIKPIVQNSMVVDWDAAEEQWSWALK-----DILYLNSNSGIPAL-LTEPIWNTLEN 123

Query: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXXXXXXKEYR 170
              S +++ E  +F   + S     + FA+  G  N                        
Sbjct: 124 KTKSLEILLESLQFEACYLSSTPTCVSFAS--GRPNC----------------------- 158

Query: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETL 216
              LV+D G + T V P++ G+   K+  +  + G  +N L+K+ L
Sbjct: 159 ---LVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 44/105 (41%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           GL + +  +I      LR  L  N+   GG   +P +S RL  EL  +LP      +T  
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + E  +W   +  +S   +    V R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 85/238 (35%), Gaps = 60/238 (25%)

Query: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISS--ATIRRPH--- 59
           VID GSY    G++    P    + I   +YG+   +N      D  S  +  +R H   
Sbjct: 18  VIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKRAHIFS 73

Query: 60  -----------------ELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTE 102
                            E G +  W+     W++ L N          ++T+    +LTE
Sbjct: 74  EQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE------LFLESTKGIPALLTE 127

Query: 103 TCFTLPELSKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKXXXXXXXXX 162
             +   +  K S + + E   F   + +P S  + FA    N      C           
Sbjct: 128 PVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRAN------C----------- 170

Query: 163 XXXXKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRH 220
                      LV+D G +   V P++ G+   K+ ++    G+++N L++  L  R 
Sbjct: 171 -----------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%)

Query: 314 GLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVP 373
           G+ + +  +I+     LR  L  NIV  GG+  +P  S RL +EL ++LP      +T  
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 374 SSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRF 418
              + +  +W   +  +S   +    V + EY E G +     RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 324 SMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAW 383
           ++ PE +  +L++N++  GG   +  M  R+  EL  + P       T P      L AW
Sbjct: 433 NITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAW 492

Query: 384 NAMAQFSSTDVYKTTR-VTREEYLEH 408
           N     S+   +  T+  T+E++  H
Sbjct: 493 NGAVSLSNLPKWGLTQWFTKEDFNNH 518

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 79/194 (40%), Gaps = 30/194 (15%)

Query: 174 LVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNI 233
           LVID   + + V PI+ GV     I K   GG FL+  +      + ++ +DE +     
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEMT 210

Query: 234 KEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSV------- 286
               ++VS  S+  +FK    Q  +  L D +  +   L  ++  +  ++GS+       
Sbjct: 211 NSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQ--NQGSITSVGTNP 268

Query: 287 ------------QTITL-TDERFAVPETFFHPEMAN---ILKPGLVETILEAISMVPEPL 330
                       +T+T  + E +   E  F P++A+       GL E I  +I+      
Sbjct: 269 LSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGN 328

Query: 331 RPILVSNIVCVGGN 344
            P  V+    +GG+
Sbjct: 329 MPAAVAASNNIGGS 342

>KNAG0E03940 Chr5 (776891..781327) [4437 bp, 1478 aa] {ON} Anc_4.318
           YML059C
          Length = 1478

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 14/141 (9%)

Query: 262 PDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILE 321
           P  QT+ LG L      +G   G V+ +T  + RF         E+A I +     T+ E
Sbjct: 805 PTSQTTSLGELA-----QGESLGEVEVLTAMN-RFTTTVAVRDSELARIPR-----TLFE 853

Query: 322 AISMVPEPLRPILVSNIVC--VGGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCE 379
            ++M   P   I VS +V   + GN K    SS++T E   +   D T   T P S    
Sbjct: 854 LLAM-EHPSIMIRVSRLVAKKILGNNKQGFSSSKITGENGNRYDFDLTIPPTKPKSHHHT 912

Query: 380 LAAWNAMAQFSSTDVYKTTRV 400
            +++N  +  S T  Y+T  +
Sbjct: 913 YSSYNQTSANSGTVKYRTITI 933

>YCL047C Chr3 complement(43661..44437) [777 bp, 258 aa] {ON}
           POF1ATPase involved in the protein quality control and
           filamentation pathways; interacts physically with Kss1p
           and suppresses the filamentation defect of a kss1
           deletion; also interacts with Ubc7p
          Length = 258

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 40  LSNHMKTIRDISSATIRRPHELGQLVSW--ELEGCIWDYCLYNPDEFD 85
           + N    +R++SS+ IR   + GQ+ S   EL  CI+DY + N   FD
Sbjct: 211 MQNDYPALRNVSSSEIRNKLKNGQVESLKDELPLCIYDYLINNKTIFD 258

>Skud_3.17 Chr3 complement(31746..32522) [777 bp, 258 aa] {ON}
           YCL047C (REAL)
          Length = 258

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 40  LSNHMKTIRDISSATIRRPHELGQL--VSWELEGCIWDYCLYNPDEFD 85
           + N   ++R++SS+ IR+  + GQ+  +  EL  CI+ Y + N   FD
Sbjct: 211 MQNDYPSLRNVSSSEIRKKIKAGQVEKLRDELPSCIYGYVMKNKTIFD 258

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 170 RDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLN-----GLLKETLSFRHYNMM 224
           R   +V+D G +   V  +I GV F +  K+  IGG FLN       LK+          
Sbjct: 142 RSSGIVVDIGHSGVKVDVVIDGVLFKQYRKENKIGGAFLNWQICDQYLKQDSGKSTKIWR 201

Query: 225 DETILLNNIKEKCLFVSPV 243
           D T  L N K   L VSP+
Sbjct: 202 DATEWLPNFKNSMLQVSPI 220

>Suva_3.166 Chr3 complement(253416..254192) [777 bp, 258 aa] {ON}
           YCL047C (REAL)
          Length = 258

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 40  LSNHMKTIRDISSATIRRPHELGQL--VSWELEGCIWDYCLYNPDEFD 85
           + N   ++R++SS+ IR   + GQ+  +  EL  CI+DY   N   FD
Sbjct: 211 MQNDYPSLRNVSSSEIRNKLKSGQVENLKDELPPCIYDYVTKNMTIFD 258

>Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 42/103 (40%), Gaps = 16/103 (15%)

Query: 293 DERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSS 352
           D+ F VP+  +      ILKPG VE   +   +  E  +              K P + +
Sbjct: 284 DKSFVVPQEVYDHYQKTILKPG-VEANNKWNKLFSEYQK--------------KYPELGA 328

Query: 353 RLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVY 395
            L   L  QLP +W  ++   ++ D  +A    +++    DVY
Sbjct: 329 ELARRLSGQLPANWESKLPTYTTKDSAVAT-RKLSEIVLEDVY 370

>Kwal_27.11307 s27 (741350..742789) [1440 bp, 479 aa] {ON} YLR142W
           (PUT1) - proline oxidase [contig 28] FULL
          Length = 479

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 307 MANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361
           MA I KP +++ +L+    VP  L  +LVS++ C G NFK      R T E  RQ
Sbjct: 80  MATINKP-MLDLVLKMFPFVPVWLMKLLVSSLYCGGDNFK----EVRETGERLRQ 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,529,991
Number of extensions: 1999100
Number of successful extensions: 4968
Number of sequences better than 10.0: 155
Number of HSP's gapped: 4835
Number of HSP's successfully gapped: 241
Length of query: 424
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 312
Effective length of database: 40,638,807
Effective search space: 12679307784
Effective search space used: 12679307784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)