Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G020008.256ON1202120258790.0
NDAI0B023808.256ON1219124019600.0
Suva_10.1688.256ON1220124319280.0
NCAS0B049808.256ON1204121718920.0
Skud_12.1528.256ON1220124018930.0
Smik_12.1438.256ON1220123718670.0
YLR084C (RAX2)8.256ON1220124018290.0
Kpol_392.108.256ON1226123817970.0
ZYRO0C01804g8.256ON1209122817820.0
SAKL0H17204g8.256ON1211124217810.0
TPHA0B032508.256ON1215122417560.0
KAFR0B026908.256ON1210118717050.0
TDEL0F038308.256ON1195122916510.0
TBLA0E043908.256ON1278126515790.0
KLLA0F18975g8.256ON1200123414630.0
Ecym_43158.256ON1212125514401e-178
CAGL0L12144g8.256ON1156119214311e-177
KLTH0G13838g8.256ON1214121414211e-175
AGR095W8.256ON1201124913751e-169
Kwal_56.235898.256ON1213123513441e-164
CAGL0K02101g8.157ON163385729.2
TBLA0A018706.177ON100451729.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G02000
         (1202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...  2269   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   759   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   747   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   733   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   733   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   723   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   709   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   696   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   691   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   690   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   681   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   661   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   640   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   612   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   568   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   559   e-178
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   555   e-177
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   551   e-175
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   534   e-169
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   522   e-164
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    32   9.2  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    32   9.6  

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score = 2269 bits (5879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1130/1202 (94%), Positives = 1130/1202 (94%)

Query: 1    MWCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYE 60
            MWCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYE
Sbjct: 1    MWCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYE 60

Query: 61   YLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMIN 120
            YLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMIN
Sbjct: 61   YLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMIN 120

Query: 121  NVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMXXXXXXXXXXAIMWDSRDR 180
            NVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFM          AIMWDSRDR
Sbjct: 121  NVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNTGAIMWDSRDR 180

Query: 181  SINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLL 240
            SINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLL
Sbjct: 181  SINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLL 240

Query: 241  NPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSP 300
            NPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSP
Sbjct: 241  NPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSP 300

Query: 301  DKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTV 360
            DKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTV
Sbjct: 301  DKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTV 360

Query: 361  AIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXX 420
            AIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFG  
Sbjct: 361  AIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNN 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHSGE 480
                                  LSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHSGE
Sbjct: 421  SFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHSGE 480

Query: 481  YSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSS 540
            YSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSS
Sbjct: 481  YSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSS 540

Query: 541  CEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQISNFTNDS 600
            CEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQISNFTNDS
Sbjct: 541  CEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQISNFTNDS 600

Query: 601  IPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRL 660
            IPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRL
Sbjct: 601  IPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRL 660

Query: 661  ISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVF 720
            ISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVF
Sbjct: 661  ISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVF 720

Query: 721  NNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADF 780
            NNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADF
Sbjct: 721  NNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADF 780

Query: 781  NDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVY 840
            NDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVY
Sbjct: 781  NDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVY 840

Query: 841  DKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSISSLLYFAKNDTLLVAGD 900
            DKNDTLLMVGYY                  VIKEENLNVGSSISSLLYFAKNDTLLVAGD
Sbjct: 841  DKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGD 900

Query: 901  FEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNM 960
            FEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNM
Sbjct: 901  FEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNM 960

Query: 961  AFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSS 1020
            AFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSS
Sbjct: 961  AFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSS 1020

Query: 1021 ATSISSVQFISMEGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHL 1080
            ATSISSVQFISMEGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHL
Sbjct: 1021 ATSISSVQFISMEGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHL 1080

Query: 1081 FMNRDISLHNIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDR 1140
            FMNRDISLHNIAQIPLLNSTRVLTNQSFA                    HSKPGRRIVDR
Sbjct: 1081 FMNRDISLHNIAQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDR 1140

Query: 1141 GFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKLKN 1200
            GFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKLKN
Sbjct: 1141 GFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKLKN 1200

Query: 1201 AT 1202
            AT
Sbjct: 1201 AT 1202

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1240 (38%), Positives = 713/1240 (57%), Gaps = 67/1240 (5%)

Query: 1    MWCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQ-FQILDDINGISFY 59
            M  S V+     + I +AS L N++ ILN T V +PT ++   N+  FQ+L DI+G+SFY
Sbjct: 1    MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFY 60

Query: 60   EYLGQQNFTTDA-NVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118
             Y GQQNFTT     ++   LIYYSN T + L +  + +  I  I P G DSFILSG G 
Sbjct: 61   RYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEP-SNDTYIAKITPFGSDSFILSGTGS 119

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            ++  SL +QL++N+T LSI  IF+T +  ++ + +D  LVYF                IM
Sbjct: 120  LSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIM 179

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEES-VR 233
            WDS   S   L F GFG  + INSI+KLNDDNILFAG F T+     L+Q+  S ++ + 
Sbjct: 180  WDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF 239

Query: 234  NTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQITP 291
            N+T++ +   VPL  S W T GE   DS   +CPD +++SW  S TTG  TC+LPF++ P
Sbjct: 240  NSTTVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAP 298

Query: 292  SKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQW 351
            +KIRIYNSP++D+QVSLFR LT  A  IMNLTY+DP+S  +  CDAFCPLYSK +L   +
Sbjct: 299  TKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAY 358

Query: 352  DNT-AEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIY 410
             NT + ++T+ ++ +N+T+I+WT  +QEFA ++ ++ +S++F AL SYGNN+ L+ FQ+Y
Sbjct: 359  ANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLY 418

Query: 411  QASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTS--VGE-YLTVGYTPNENPVP 467
            Q +++ F                          S N+W     G+ Y++  YTPN++PVP
Sbjct: 419  QNAYAVFANDTLNEPNCNSIESSSSSSL-----SANDWEMGLTGQTYISTTYTPNQDPVP 473

Query: 468  KVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEI 527
             V++   I++ G+YSIN++TPGC+ D+TCS+R IVN T++D+    +LAT LIYQNN E+
Sbjct: 474  YVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKEL 533

Query: 528  KYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL-------SHRTEV 580
            KYD LYSG L+SS  +T+ Y SGLYASNTV T+VADR+++ I S+++       ++ TE+
Sbjct: 534  KYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEI 593

Query: 581  SKLALNGLFQYQISNF---TNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLS 637
              + LNGL QYQISNF   ++++  +KI NTSLNQ +L  F  + S+ A    ++++LL 
Sbjct: 594  --MNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLG 651

Query: 638  GTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNT 697
             + G +  + LN ++ +++S     T N   F  YS G++   G+ N+S       N N 
Sbjct: 652  NSNGGIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAY-GEYNLSSKITYLVNYNG 710

Query: 698  TMD-------GSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGA 750
            T +        S  T+V N+T++  ELLV +N  IYNV+S     ++S++  L++ S+G+
Sbjct: 711  TFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSAL-QLSLWSSGS 769

Query: 751  NSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFY 810
            N   DT+F G +    Y   N S  +  +F       ++ S      G+FLND  + Y  
Sbjct: 770  NLNRDTVFSGAIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYAS 829

Query: 811  KESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXX 870
            K  + S+L  +N  S +   ++     +VY  + T+L V                     
Sbjct: 830  KTDSYSELLFSNGYS-APWSFFEGINYMVYSSHQTMLAVA-SSDFNKNSELSILNLTTFE 887

Query: 871  VIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVS 930
             I  E LNV S I+ L+ F  N TL+V G+F     NCS LCLYNY S +W + AN+S++
Sbjct: 888  TIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSIN 947

Query: 931  GSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSN 990
            G++A ++L     +L+ G       + VN+A ++LS   V S+ M  DA + L S     
Sbjct: 948  GTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKM-GDANI-LQSFATIG 1005

Query: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISM---------EGTDDALLL 1041
             +I+ WN  +L S++  +W+  ++    +S+T+I S++ I            G+ D  ++
Sbjct: 1006 DKIITWNGIMLESYENGAWS--TIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFII 1063

Query: 1042 LGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTR 1101
             G    +E+G I++++YNF++W PY +      Q  G +FMNRD S        L NS  
Sbjct: 1064 NGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDS-------ALYNSQS 1116

Query: 1102 VLT--NQSFAXXXXXXXXXXXXXXXXXXXXHSKP-GRRIVDRGFVVLIGLALALATVSVM 1158
            VL   N +                      H K  GR+ +DRGFVVLIGLALAL TVS++
Sbjct: 1117 VLQNPNNATVTTPSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLL 1176

Query: 1159 GVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            G+ G++LAYIF+D  G S+  LNPR +E+ M+ T+PPEKL
Sbjct: 1177 GIIGLVLAYIFKDGDG-SHDALNPRTNEDEMLETVPPEKL 1215

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1243 (37%), Positives = 712/1243 (57%), Gaps = 79/1243 (6%)

Query: 6    VYCLW-FAVAI----TRASNLENVRRILNATEVTVPTFDVGNKN-NQFQILDDINGISFY 59
            V+ LW  A+ +    ++AS L++++ +L+  +  +P+ ++   N N  QIL  ++ +SFY
Sbjct: 3    VHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFY 62

Query: 60   EYLGQQNFTTD-ANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118
            EY GQQNFT +  + T+ + L+YYSN T++ L ++   + +I  I P G DSFILSG G 
Sbjct: 63   EYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEA-DEDTRIDKITPFGADSFILSGSGS 121

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            IN V L +Q+++N++ LS+ +IF   L S+E V V+   VYF               A++
Sbjct: 122  INGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALV 181

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVR- 233
            WDS   +  LLPF GFG  +N+NSI+KLNDDNILFAG F T+ +SS+L  S+ +  +   
Sbjct: 182  WDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASS 241

Query: 234  --NTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQI 289
              N T+L L   +PL+Y+ W + G    +SS L+CPD SKD+W    T+G   C LP+++
Sbjct: 242  TLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEV 301

Query: 290  TPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQS 349
             P+KIR+YNSP+ D+ +SLF+ LT P+GSIMNLTYLDP+SG + SCD FCPLYS+  L S
Sbjct: 302  APTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLS 361

Query: 350  QWDNTAEA-NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQ 408
               N + + + ++ I+NN+T+++W+ ++Q+FA  + ++ TSL+F AL SYGN +GL+G +
Sbjct: 362  ASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLE 421

Query: 409  IYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTS--VGE-YLTVGYTPNE-N 464
            +YQ +FS +                         LS N W     G+ Y+ + Y PN+  
Sbjct: 422  LYQDTFSTYA----NNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTK 477

Query: 465  PVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNN 524
            P P VT+   I H G Y+IN +TPGC  DNTCS+RGIVN T+++   N M+ T LIYQNN
Sbjct: 478  PTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNN 537

Query: 525  DEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIIS------MDLSHRT 578
            + +KYD +YSG L+ S EI M Y SG+YASNT T +VAD+V  NII+        LS  T
Sbjct: 538  NNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQV--NIITDSLDSFSSLSETT 595

Query: 579  EVSK-LALNGLFQYQISNFT-NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILL 636
             V +   LNG+ QYQ SNFT   S   KIANT+LN F+++N+  + S+ A  + +  ++L
Sbjct: 596  SVKRHTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFA-DVYDKKLIL 654

Query: 637  SGTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKD 690
             G + ++  I+ N +L V +S       +       + GL++       D +  V +F  
Sbjct: 655  GGKDNHISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNG 714

Query: 691  NFKNLNTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGA 750
            +F++++         +  NITL  ++L+VFNN YI+N +S  Q  SNS+ F+L++ SAG 
Sbjct: 715  SFESVSNYSKA--VENAINITLANNDLIVFNNDYIFNASSNSQI-SNSTSFSLSLWSAGN 771

Query: 751  NSINDTIFLGKVVQWQYAIANQSAQVNADFNDG-IEQMSLPSNTVPSRGIFLNDDSTGYF 809
            N  +D +F G V Q Q++  + SA+     N+  +E ++L    VP  G +LN+ +  Y 
Sbjct: 772  NDNDDVLFSGAVSQMQFSDLSGSARF---LNESTVEALNLNKGIVPYLGAYLNESTIAYA 828

Query: 810  YKESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXX 869
            YK ++ SK+Y +N N +    W      +VY  N TLL++G                   
Sbjct: 829  YKTNSLSKIYFSN-NVSPSWNWSNNITKMVYANNQTLLVIG--SESSTTAELSILNLRNF 885

Query: 870  XVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSV 929
              I  E L   + I++ + F KN +LLV GDF+ S  NC+ LC+YNY+S  W +  NN++
Sbjct: 886  TTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTI 945

Query: 930  SGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVS 989
             G +  L       +++ G     +   + +   NL+N+ +  L+      +N  S  V+
Sbjct: 946  VGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLN--SFTVT 1003

Query: 990  NSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQ------FISMEGTDDA----- 1038
               IVAWNDT L  +    W   S+PG  SS +S++++        +    T DA     
Sbjct: 1004 EESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSI 1063

Query: 1039 LLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGH---LFMNRDISLHNIAQIP 1095
            LLL G F   ++G+++ ++++ ++W PY  +     + + +   +F+NRD+S    +QIP
Sbjct: 1064 LLLNGNFSIPQYGNLQGLLFDSQNWTPY--FTSETLEASSYNPTIFINRDVSADFNSQIP 1121

Query: 1096 LLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATV 1155
            L NS   +T+                        + K  ++ +DRGFVVLIGLALAL TV
Sbjct: 1122 LSNSNMTVTSPQST-------SPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTV 1174

Query: 1156 SVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            SV+G+ GV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1175 SVLGIVGVILAYVFKDPEGD-YRPIKPRIDENEMLDTVPPEKL 1216

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1217 (38%), Positives = 709/1217 (58%), Gaps = 70/1217 (5%)

Query: 18   ASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDA-NVTDV 76
            AS L +++  LN T + +P  ++   +N F++L  I+ +SFY Y GQQNFT+     ++ 
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNS 77

Query: 77   QRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDLS 136
              L YYSN TF+ L +  + +++I+ IIP G DSFILSG+G +   SL++QL+FN++  S
Sbjct: 78   NGLTYYSNNTFIQLYEP-SLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 137  ITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSINLLPFHGFGP 192
            + +IF+  L S+  + VDG +V F                 +W+    S +LLPF GFG 
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 193  YANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWK 252
             + INSI KLNDDNILFAG F T+ NS+LL   NV  +++RN + + L   +PL  + W 
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL---NVVNDTMRNISDINLGQLIPLSAATWS 253

Query: 253  TNGEL-DSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRF 311
            + G   D    +CPDP+ ++W  + T+G   C LPF + P+KIRIYNSPD D+++SLFR 
Sbjct: 254  STGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRI 313

Query: 312  LTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIINNNSTNI 370
             + P+ SIMNLTY+DP+ G +  CDAFCPLY+K VL+S  +N T  +  + ++N+N+++I
Sbjct: 314  FSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDI 373

Query: 371  QWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXXXXXXXXXXXX 430
            +W+ ++QEFA V+ ++A+SL F AL SYG N+GL+ FQIYQ +++ F             
Sbjct: 374  RWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNSL 433

Query: 431  XXXXXXXXXXXXLSPNNWTSVGE---YLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFT 487
                        LS N WT   +   Y+   Y P++  +P+VT+  D+++SG+YSI ++T
Sbjct: 434  ESFSSSD-----LSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYT 488

Query: 488  PGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTY 547
            PGC  DNTCS+RGIVN T+++T  N +L+T+LIYQNND++KYD LYSG LN S +IT+TY
Sbjct: 489  PGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTY 548

Query: 548  YSGLYASNTVTTIVADRVDLNIISMDLSHRTEVS--KLALNGLFQYQISNF---TNDSIP 602
            +SG+Y+  T  T+V DR+++ I S+D+ +    S   L LNGLFQYQ+SNF   + DS  
Sbjct: 549  HSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSI 608

Query: 603  MKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLIS 662
             ++ANTS+NQ  L  F  +VSL A  L N ++L+   +  +    LN DL++Q+S++   
Sbjct: 609  ARVANTSINQLTLTGFSSNVSLSA-SLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGI 667

Query: 663  TENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDG-----SLATDVANITLNGDEL 717
                T  + YSNG V++ G  N S    N  + N + D      S  T+ ANIT++  EL
Sbjct: 668  EGKITGLKSYSNG-VLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSEL 726

Query: 718  LVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVN 777
            LVF+N  I+NV+S  Q  + SS  +L++ S+G+NS  DT+F G + Q Q+   N S  V+
Sbjct: 727  LVFDNNLIFNVSSSSQISNTSSF-SLSLWSSGSNSNGDTLFSGALSQVQF--TNLSGSVS 783

Query: 778  ADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPET 837
               N  +   SL S   P   IFLND  TGY  K  + +   I +  S +   W G  ++
Sbjct: 784  IANN--LSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841

Query: 838  VVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSISSLLYFAKNDTLLV 897
            ++Y  N ++L VG                    V+  E LN  SS+ ++++F +N ++LV
Sbjct: 842  MLYLTNQSMLAVG--SSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILV 899

Query: 898  AGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQAND 957
             G+F  SN  C  LCLYNY   QW +  N +++G++  LQ++ +  +++ G       + 
Sbjct: 900  GGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSS 959

Query: 958  VNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGT 1017
            VN+A +NL++N +  +      PV     I  +  I AWN+T LF +  NSW  + +  +
Sbjct: 960  VNLALMNLTDNKLVLIRWGFKEPV--KDFITIDDNIFAWNETSLFEYTSNSWVDIPISNS 1017

Query: 1018 DSSATSISSVQFISM-----------EGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPY 1066
            +SS T+I S+ + +            E +++ L++ G+   + +G I++++YNF +WIPY
Sbjct: 1018 NSS-TTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPY 1076

Query: 1067 L---LYVDGPRQGTGHLFMNRDISLHNIAQIPLL--NSTRVLTNQSFAXXXXXXXXXXXX 1121
            L     V    Q    LF++RD+S    +Q+ L   N+T  +T                 
Sbjct: 1077 LSINSLVSSANQ-PAELFIDRDVSKLFDSQLALQVSNTTASIT-----------ASSSTP 1124

Query: 1122 XXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLN 1181
                         ++ +DRGFVVLIGLALAL T++V+G+ GV+LAY FRD+ GD Y  + 
Sbjct: 1125 TPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGD-YDVIT 1183

Query: 1182 PRMDENAMVNTLPPEKL 1198
            PR++E+ M+ T+PPEKL
Sbjct: 1184 PRVNEDEMLKTVPPEKL 1200

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1240 (36%), Positives = 704/1240 (56%), Gaps = 73/1240 (5%)

Query: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVGNKN-NQFQILDDINGISFY 59
            V+ LW     F    ++AS L+N++ +L+  +  +P  ++   N N  QIL  ++ +S Y
Sbjct: 3    VHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLY 62

Query: 60   EYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118
            EY GQQNFT + +  T+ + L+YYSN T++ + D+ + + +I  I P G DSFILSG G 
Sbjct: 63   EYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDA-SDDTRIDKITPFGADSFILSGSGT 121

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            INN+ + +Q+++N++ LS+  IFD PL S+E V ++G  VYF               A++
Sbjct: 122  INNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALI 181

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSN----VSEE 230
            WDS      LLPF GFG  +N+NSI+KLNDDNILFAG F T+ +SS L+ +      +  
Sbjct: 182  WDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNST 241

Query: 231  SVRNTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQ 288
            S+ N T L L   +PL+Y+ W   G    +S+ L+CP+ ++D+W   AT+G   C+LP++
Sbjct: 242  SLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYE 301

Query: 289  ITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQ 348
            ++P+K+R+YNS D D ++S+F+ LT P+ SIMNLTYLDPLSG + +CD FCPLYS+  L 
Sbjct: 302  VSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLL 361

Query: 349  SQWDN-TAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGF 407
            S   N ++  + ++ ++NN+T+++W+ ++Q+FA  + +  T L+F A+ SYG ++GL+G 
Sbjct: 362  SASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGL 421

Query: 408  QIYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVGE-YLTVGYTPNEN-P 465
            ++YQ +FS +                            N     GE Y+   Y PN++ P
Sbjct: 422  ELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLG--GESYIATEYVPNQDEP 479

Query: 466  VPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNND 525
             P+V +  +I H G Y IN +TPGC  D+TCS+RGIVN T+++     M+ T  IYQNND
Sbjct: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539

Query: 526  EIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVS 581
             +KYD +YSG L+ S EI + Y SG++ SNT T +VAD+V++  + +D    LS      
Sbjct: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599

Query: 582  K-LALNGLFQYQISNFTN-DSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGT 639
            + + LNG+ QYQ SNFT+  S   KI NT+LN FA++N+  + SL A   +   ++L GT
Sbjct: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFA-DTNGDRLILGGT 658

Query: 640  EGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFK 693
              ++  I LN +L V  S + I   +       S GL++       + Q +V LF  +F+
Sbjct: 659  NNHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFE 718

Query: 694  NL---NTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGA 750
            N+   + T++ ++     NI+L  ++L+VF+N YI N +S  Q   NS+ F+L++ SAG+
Sbjct: 719  NVFNYSRTVNSAI-----NISLANNDLIVFDNDYIVNTSSSAQIL-NSTSFSLSLWSAGS 772

Query: 751  NSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFY 810
            N  +D +F G V + Q+   N SA+  ++  D ++ ++L +  VP    +LN+ +T Y Y
Sbjct: 773  NGNDDVLFSGAVSRMQFGGLNGSARFLSE--DKVQALNLDNAVVPYLAAYLNESTTAYAY 830

Query: 811  KESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXX 870
            + +  +K+Y +N N      W      ++Y  N +LL VG                    
Sbjct: 831  ETNLLNKIYFSN-NVDPSWNWSTSITRMLYANNQSLLTVG--SESSTTAELSIFNLKNFT 887

Query: 871  VIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVS 930
            +I  E +   + I++L+ F KN +LLV G+F+ S  NCS LCLYNY+S  W +  NN+  
Sbjct: 888  MIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFF 947

Query: 931  GSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSN 990
            G +  L       +++ G     +   V +A  NL+N+ +  L+   +  +N  S +V+ 
Sbjct: 948  GEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKIN--SFVVTE 1005

Query: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQ------FISMEGTDDA-----L 1039
              IVAWNDT L  +    W   SVPG DSS  S+S++        ++   T++A     L
Sbjct: 1006 ESIVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTIL 1065

Query: 1040 LLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTG-HLFMNRDISLHNIAQIPLLN 1098
            LL G F   ++G+++ ++++F  W PY +            +F+NRD+S    +QIP   
Sbjct: 1066 LLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIP--- 1122

Query: 1099 STRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVM 1158
                L+N +                        K  +RI DRGFVVLIGLALAL TVSV+
Sbjct: 1123 ----LSNLNVTETGPQSASSQFPSSSASSELKPKSKKRI-DRGFVVLIGLALALGTVSVL 1177

Query: 1159 GVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            G+AGV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1178 GIAGVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1237 (36%), Positives = 702/1237 (56%), Gaps = 67/1237 (5%)

Query: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQILDDINGISFY 59
            V+ LW     F    ++AS L+N++ +L+  +  +P  ++  N +N  QIL  ++ ISFY
Sbjct: 3    VHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFY 62

Query: 60   EYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118
            +Y GQQNFT   +  T+   L+YYSN T++ L D+ + + +I  I P GDDSFILSG G 
Sbjct: 63   KYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDA-SDDTRIDKITPFGDDSFILSGSGT 121

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            INN+S+ +Q+++N++ LS+  IF+  L  +E V V+   VYF               A++
Sbjct: 122  INNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALV 181

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSN---VSEES 231
            WD+   +  LLPF GFG  +N+NSILKLNDDNI+FAG F T+ +SS+L+ S+    +   
Sbjct: 182  WDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTF 241

Query: 232  VRNTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQI 289
              N T L L   + L+Y+ W + G   L S+ L+CP+ + ++W   AT+G   C LP+++
Sbjct: 242  SLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEV 301

Query: 290  TPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSK-TVLQ 348
            +P+KIR+YNS D  S+++LF+ LT P+ SIMNLTYLDPLSG + +CD FCPLYS+ T+L 
Sbjct: 302  SPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLA 361

Query: 349  SQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQ 408
            +  + ++  + +  I+ N+T+++W+ ++Q+FA  + +  TSL+  AL SYG+++GL+G +
Sbjct: 362  ASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLE 421

Query: 409  IYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVGE-YLTVGYTPNEN-PV 466
            +YQ +FS +                            N  T  GE Y+   Y P++N P+
Sbjct: 422  LYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLT--GESYIATNYIPDQNEPI 479

Query: 467  PKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDE 526
            P+V +  +I HSG Y+IN +TPGC  DNTCS+RGIVN T+++   N M+ T  IYQNND 
Sbjct: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539

Query: 527  IKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSK 582
            +KYD ++SG L+ S EI + Y SG+Y+SNT T +VADRV++  +S+D    LS    V +
Sbjct: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599

Query: 583  -LALNGLFQYQISNFTN-DSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTE 640
               LNG+FQYQ SNFT   S   K+ NT+LN F +NN+  + SL    + N  +++ G  
Sbjct: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLV-EIYNDKLIVGGVS 658

Query: 641  GNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFKN 694
              + +I+LN +  +++S       +         GL++       D Q  V LF ++F  
Sbjct: 659  NRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGK 718

Query: 695  L-NTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSI 753
            + N +   + AT   NI++  +EL VF+N YI N +S  Q  SNS+ F+L++ +AG N  
Sbjct: 719  VPNYSKRVNSAT---NISIADNELFVFDNNYIINASSNAQI-SNSTSFSLSLWAAGNNGN 774

Query: 754  NDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKES 813
             D +F G V   +++  N SA    +  D ++ +++    VP  G +LN+  + Y Y+  
Sbjct: 775  GDVLFSGTVSHMEFSNLNGSASFKNE--DQVQALNIGRGIVPYFGAYLNESVSAYAYETD 832

Query: 814  NKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIK 873
              +K+Y +N  + S   W      ++Y  N T+L+V                      I 
Sbjct: 833  ALNKIYFSNKVNPS-WNWSNTITRMLYANNQTMLVVS--SESSSTADLTIFNLRNMTTIA 889

Query: 874  EENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSV 933
             E L   + +S+L+ F KN ++LV GDF+ +  NCS LCLYNY++  W +  NN++ G V
Sbjct: 890  NETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEV 949

Query: 934  AALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRI 993
              L L  +  +++ G     +   + +   NL+N  +  L+   +  +N  S +V+++ +
Sbjct: 950  TQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLN--SFVVTDNSL 1007

Query: 994  VAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSV------QFISMEGTDDA-----LLLL 1042
            VAWNDT LF +    W   S+P  DS   S+S++        ++   T++A     LLL 
Sbjct: 1008 VAWNDTSLFIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLN 1067

Query: 1043 GEFRHSEFGDIKSIVYNFRDWIPYLL-YVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTR 1101
            G F   ++G+++S++++F+ W PY +  +          F+NRD+S    +QI L N   
Sbjct: 1068 GNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNI 1127

Query: 1102 VLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVA 1161
             +TN                         SK  ++ +DRGFVVLIGLALAL TVSV+G+ 
Sbjct: 1128 TVTNPQST-------SSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIV 1180

Query: 1162 GVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            GV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1181 GVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1240 (35%), Positives = 693/1240 (55%), Gaps = 73/1240 (5%)

Query: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQILDDINGISFY 59
            V+ LW     F V I++AS LEN++ +L+  +  +P  ++  N +N  QIL  ++ +SFY
Sbjct: 3    VHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFY 62

Query: 60   EYLGQQNFTTDAN-VTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118
            EY GQQNFT +    T    L+YYSN T++ L D+ + + +I  I P G DSFILSG G 
Sbjct: 63   EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDA-SDDTRIDKITPFGVDSFILSGSGT 121

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            INN+S+ +Q+++N++ LS+T IF+  L +++ V  D   +YF               A++
Sbjct: 122  INNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALI 181

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSN---VSEES 231
            WDS   +  LLPF GFG  +++NSI+KLN+DNILFAG F T+ + S L+ S+    +  S
Sbjct: 182  WDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTS 241

Query: 232  VRNTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQI 289
              N T+L L   +PL+Y+ W + G     S  L+CP+ ++D+W    T+G   C LP+++
Sbjct: 242  SLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYEV 301

Query: 290  TPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQS 349
            +P+KIR+YNS   DS++S+F+ LT P+ SIMNLTYLDPLSG + +C  FCPLYS+  L S
Sbjct: 302  SPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLS 361

Query: 350  QWDNTAEA-NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQ 408
               N + + + +  I+NN T+++WT ++Q+FA V+ +  +SL+F AL SYG ++GL+G +
Sbjct: 362  ASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLE 421

Query: 409  IYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVGE-YLTVGYTPNEN-PV 466
            +YQ +FS +                            N  T  GE Y+   Y P++N P+
Sbjct: 422  LYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLT--GESYIAAKYVPDQNEPI 479

Query: 467  PKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDE 526
            P+V +  +I H G Y+IN++TPGC  DNTCS RGIVN T+++   N ++ T LIYQNND 
Sbjct: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539

Query: 527  IKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSK 582
            +KYD +YSG L+ S EI + Y SG+Y +NT T +VAD+V++  +S+D    LS  +   K
Sbjct: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599

Query: 583  LA-LNGLFQYQISNFTNDSI-PMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTE 640
               LNG+ QYQ SNFT+  +   K+ NT+LN F + N+  + SL A  + ++ +++ G  
Sbjct: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYA-DIYDNKLVIGGVS 658

Query: 641  GNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFKN 694
              +  ++LN D  V +S       +       + GL++       + Q  V LF  +F+N
Sbjct: 659  NRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFEN 718

Query: 695  L---NTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGAN 751
            +   + T++ +L     NI+L  ++ +V +N Y+ N +S    R NSS F+L++ +AG N
Sbjct: 719  VFNQSRTVNSAL-----NISLANNDFIVLDNDYVVNASSNALIR-NSSSFSLSLWAAGNN 772

Query: 752  SINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYK 811
               D +F G V   QY   N S +   +  + IE ++L    VP  G +LN+ +T Y Y+
Sbjct: 773  GDGDVLFSGAVSHMQYGNLNGSVRFLNE--NEIEPLNLEGGIVPYLGAYLNESATAYAYE 830

Query: 812  ESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXV 871
              + +K+Y +N    S   W      ++Y  N TLL V                     +
Sbjct: 831  VDSLNKIYFSNEVYPS-WNWSSGITQMLYADNQTLLAVS--AGSSTTAELSIFDLRNLTM 887

Query: 872  IKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSG 931
            I  E L   + I++L+ F KN ++LV GDF+ +  NC+ LCLYNY+S  W +  NN++ G
Sbjct: 888  IANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFG 947

Query: 932  SVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNS 991
             +  L    +  +++ G     +   + +   NL+N+ +  L+   +  +N  S  V+  
Sbjct: 948  EITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLN--SFTVTED 1005

Query: 992  RIVAWNDTVLFSFDGNSWTRVSVPG------------TDSSATSISSVQFISMEGTDDAL 1039
             IVAWNDT LF +    W   S+PG            TD  + +++  + I+       L
Sbjct: 1006 SIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNK-RGINNVNNGSIL 1064

Query: 1040 LLLGEFRHSEFGDIKSIVYNFRDWIPYLL-YVDGPRQGTGHLFMNRDISLHNIAQIPLLN 1098
            LL G F  S++G ++S++++F+ W PY +            +F+NRD+S    +Q PL N
Sbjct: 1065 LLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLAN 1124

Query: 1099 STRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVM 1158
                +T+                         SK  ++ + RGFVVLIGLALAL TVSV+
Sbjct: 1125 VNITVTSPQST-------SSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVL 1177

Query: 1159 GVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            G+AGV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1178 GIAGVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1238 (36%), Positives = 704/1238 (56%), Gaps = 81/1238 (6%)

Query: 13   VAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDAN 72
            + +++AS L NV+  L    V +P  + GN NN+ QIL +I G++FY+Y GQQNFT   +
Sbjct: 14   IGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSID 73

Query: 73   V-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFN 131
              ++   LIYYSN+T + L +  +   +I  I+PL +D+FILSG G +    L +QL++N
Sbjct: 74   TNSNTHGLIYYSNDTLIKLLEG-SDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYN 132

Query: 132  MTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSINLLPF 187
            ++DLSI  +F+  L++I+ + VD  +VYF                I W+   +++++LPF
Sbjct: 133  LSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPF 192

Query: 188  HGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVS-------EESVRNTTSLLL 240
             GFG  + +NSILKL++DN+LF G FST+ + SLL+ SN++         S    T+L L
Sbjct: 193  IGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLV-SNITTYTQQNSTSSSSTETNLEL 251

Query: 241  NPSVPLQYSQWKTNGELDSS-QLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNS 299
               + L+Y+ W + G+L SS Q ICP+   ++WS + TTG+ TC L F+ + SKIRI+NS
Sbjct: 252  EQQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNS 311

Query: 300  PDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEAN 358
            P +  Q++ FR +T P+  IMNLTYLDPL+  +  CDAFCPLYS   LQ+  +N T  A+
Sbjct: 312  PYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSAS 371

Query: 359  TVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFG 418
            T A IN N TNI W+ +YQEFA V+ V  T+L+  AL SYG+N+GL+GFQ+YQ S+S F 
Sbjct: 372  TSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFA 431

Query: 419  XXXXXXXXXXXXXXXXXXXXXXXXLSPNNW---TSVGEYLTVGYTPNENPVPKVTYKIDI 475
                                    LS N W    +   Y+   YTP ++P P V +   I
Sbjct: 432  NNSLNEPACDSPNTVIPSSY----LSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSI 487

Query: 476  QHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSG 535
               G Y++N++TPGC+ D TCS RGIVN TL+DT TN +++T+LIYQNN+E+KYD L+ G
Sbjct: 488  NRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEG 547

Query: 536  QLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL-------SHRTEVSKLALNGL 588
             L+ + ++T+ YYSG+   N+   +VAD VDL  I+++L       +  TE  K+ LNG+
Sbjct: 548  FLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGM 607

Query: 589  FQYQI--SNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSI 646
            FQYQ+     +N++  +K+ NTSLN F ++ F  SVSL      N ++LL G+   ++++
Sbjct: 608  FQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEY-NETLLLGGSIAGVYAL 666

Query: 647  NLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMD--GSLA 704
            +L+   +++ STR++ T    T      G V+L G  N+S    +  + N T D  G++ 
Sbjct: 667  SLSNYTNIR-STRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVN 725

Query: 705  TDVA---NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGK 761
            +++A   N+T    E+L FNN Y +N TS      N+S  +L++ SAG+N   DT+F G 
Sbjct: 726  SNIATFSNLTFGESEILAFNNEYFFN-TSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGL 784

Query: 762  VVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYIT 821
            + + ++   N SA +    N   + + L +   P  G++LND  T Y Y  S+ S +  +
Sbjct: 785  ITRNEFPNLNNSAVLTG--NGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFS 842

Query: 822  NSNSTSGLEW-YGEPETV---VYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENL 877
            N     GL+  +  P +V    Y  N+T+ +                      ++  E  
Sbjct: 843  N-----GLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETF 897

Query: 878  NVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQ 937
            +V SSI+S++ F +N +LLV GDF   N NCS+LCL N  + QW S + N   G++  L+
Sbjct: 898  DVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFS-NKFDGTITGLE 956

Query: 938  LYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWN 997
               +  +L+ G+      + +++ +++L+N    SL+        ++S   +N  IVAW+
Sbjct: 957  FANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQK---VNSFNYNNGTIVAWD 1013

Query: 998  DTVLFSFDGNSWTRVSVPGTDSSATSISSVQFIS------------MEGTDDALLLLGEF 1045
             + ++S+ G+SW+   +P T+SS TSI +VQ +S                D+ +L+ GE 
Sbjct: 1014 SSTIYSYRGDSWSNHQIPNTNSS-TSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGEL 1072

Query: 1046 RHSEFGDIKSIVYNFRDWIPYLLYVDGP----RQGTGHLFMNRDISLHNIAQIPLLN-ST 1100
               ++G ++++ Y+F++WIPY  Y+  P          LFMN+DISL   +Q+ L N ++
Sbjct: 1073 YSEDYGFVQAMFYDFQNWIPY--YITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNS 1130

Query: 1101 RVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGV 1160
             +  + + +                     SK     + RG+VVLIGLALA+ TV+++G+
Sbjct: 1131 TISISSTSSSSATTRSSSTSSTSLKNGNIESK-----IHRGYVVLIGLALAIGTVAILGI 1185

Query: 1161 AGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
             GV +AYIF D+ G+ Y  + PR+DE+ M++T+PPEKL
Sbjct: 1186 FGVTMAYIFSDDKGE-YVRIKPRIDEHEMLDTVPPEKL 1222

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1228 (35%), Positives = 675/1228 (54%), Gaps = 71/1228 (5%)

Query: 9    LWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQ-FQILDDINGISFYEYLGQQNF 67
             +F +AIT  S L +++++LNA+ + VP  D+ +  NQ  ++L D   ++FY+Y GQ+NF
Sbjct: 9    FYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENF 68

Query: 68   TTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLAS 126
            T+  N  TD   LIYYSN+TF+ L++  + +  I+ I+PLG+DSFILSG G I+  +L  
Sbjct: 69   TSPLNSSTDSHGLIYYSNDTFLQLANG-SNDTDIKQIVPLGEDSFILSGSGHIDGYNLQR 127

Query: 127  QLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSI 182
            QL +N+TDLS   IF   L  +  + VD PLVYF                ++W+S   S 
Sbjct: 128  QLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNST 187

Query: 183  NLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLL---LQSNVSEESVRNTTSLL 239
            +LLPF GFG  + +NSI++L+ DNILFAG+F  + +  LL   +  + +  S  N T + 
Sbjct: 188  SLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVE 247

Query: 240  LNPSVPLQYSQW-KTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYN 298
            L  ++PLQ + W  ++ + D+   ICPDP ++SW  S T+G   C LP + TP KIRIYN
Sbjct: 248  LGLAIPLQNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYN 307

Query: 299  SPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEA- 357
            SP +D++VSLFR L  P   I+NL+Y+DP  G +  CDAFCPLY++  L+    N++   
Sbjct: 308  SPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVE 367

Query: 358  NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAF 417
            N     +NN+T+I+W  ++QEFA V+ V  +S+EF AL+SYG+N+GL+ +Q +Q+  S +
Sbjct: 368  NMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIY 427

Query: 418  GXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSV--GE-YLTVGYTPNENPVPKVTYKID 474
                                     +S N+W     G+ YL+  Y  ++  +P+VT+   
Sbjct: 428  A-----NNSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQ 482

Query: 475  IQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYS 534
            IQ+ G YSI ++TPGC  D TC+ R IVN TL+D  +N+ L++ +IY+NN+E+KYD L+ 
Sbjct: 483  IQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWD 542

Query: 535  GQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL--SHRTEVSKLALNGLFQYQ 592
            G L SS ++T+ Y+S +Y +N  + +VAD + L   S D    H+ +++   LNG+FQYQ
Sbjct: 543  GHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDIT---LNGIFQYQ 599

Query: 593  ISNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDL 652
            ISNFT +     I NTSL+ F L+ F  + SL A    N ++LL+ ++     I L+ + 
Sbjct: 600  ISNFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNW 659

Query: 653  SVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSL--------- 703
            SV +S              YS+GL++  G  N S      + L  + +GS          
Sbjct: 660  SVDSSKSFNLASQVRGIGSYSDGLILF-GDYNSS----QRQPLALSFNGSFNSYDKINRS 714

Query: 704  ATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVV 763
                 NI L G ELLVF+N + YNV+SQ    SN++ F+L+V SAG N+  D IF G V 
Sbjct: 715  VERFTNIDLKGTELLVFDNEFFYNVSSQSYV-SNTTRFSLSVWSAGQNTNGDLIFSGAVS 773

Query: 764  QWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNS 823
               Y   N    V+   N      ++  N  P  G +LND  T Y YK+ + S++  +N 
Sbjct: 774  DNDY--ENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNG 831

Query: 824  NSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSI 883
            +      W    ET++Y   D LL +G                    V+  E L+ G+ +
Sbjct: 832  DE-GPWRWTNSIETMIYRNRDALLALG-TSSSPSLPQLSVLNLTTSEVLANETLDKGAEV 889

Query: 884  SSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDT 943
            +S++ F KN TLL+ G+F  S+ +C+ LCLYNYK+ +W + AN+S++G V  +QL  +  
Sbjct: 890  NSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSE 949

Query: 944  ILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFS 1003
            +L+ G+L +   +DVN+  VN++   + +L+   + P  L S +VS  R+V WNDT L +
Sbjct: 950  LLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGP--LRSFVVSEDRLVVWNDTSLMA 1007

Query: 1004 FDGNSWTRVSVPGTDSSATSISSVQFISMEGT------------DDALLLLGEFRHSEFG 1051
            +D  SW  +S   + +S T +  +  +S+E +             D LL+ G  + ++  
Sbjct: 1008 YDNTSWRHISTSNS-TSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGNDK-TQGD 1065

Query: 1052 DIKSIVYNFRDWIP-YLLYVDGPRQGTG-HLFMNRDISLHNIAQIPLLNSTRVLTNQSFA 1109
              ++ +Y++  W P ++         +G ++FMN+D+S   I++  L N T      +  
Sbjct: 1066 SYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPT------NHT 1119

Query: 1110 XXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIF 1169
                                H    +  VDRG+VVLIGLALA+ TV V+GV G+L+AY+F
Sbjct: 1120 SSRSSSSSSSAVTSNSGDKKHRASHK--VDRGYVVLIGLALAIGTVVVIGVFGILIAYMF 1177

Query: 1170 RDNVGDSYQTLNPRMDENAMVNTLPPEK 1197
             +++G  Y+ L+P  +      T PP K
Sbjct: 1178 GEDIG-GYEFLSPPAEGTKAAETAPPAK 1204

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1242 (36%), Positives = 686/1242 (55%), Gaps = 83/1242 (6%)

Query: 2    WCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNK-NNQFQILDDINGISFYE 60
            +  ++   +    +   S L +++  LN  ++++P  D+ +  N++  +L D   ++FY 
Sbjct: 4    FLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYR 63

Query: 61   YLGQQNFTTDANVTDVQR-LIYYSNETFMSLSDSIAAE---AQIQGIIPLGDDSFILSGQ 116
            Y GQ+NFT   ++T+ ++ LIYYSN TF+ L DS++ E   A I  IIP GDDSFILSG 
Sbjct: 64   YTGQENFT--GSITETEKDLIYYSNGTFIKL-DSLSDENATADINHIIPFGDDSFILSGT 120

Query: 117  GMI-NNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXX 171
            G +    +L  QL++N++ L  T IF+  + ++  +  D  +VYF               
Sbjct: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180

Query: 172  AIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEES 231
             ++W+S    I LLPF GFG  + +NSIL+L++DNI+FAG F+T+ +++LL Q   S  S
Sbjct: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240

Query: 232  VRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSAT-TGDFTCELPFQIT 290
             +N T +  +  +PL+++ W + G L+ S LICP    D W    T TGDFT  L   + 
Sbjct: 241  -KNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLR 299

Query: 291  PSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVL-QS 349
            PSK+RIYN+ D D QVSLFR +T PA  IMNLTYLDP +G ++ CDA+CPL S  +L Q+
Sbjct: 300  PSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQA 359

Query: 350  QWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQI 409
            + + T  +++VA I NN+TNI+WT  YQEFA V+ V+  SL F AL SYG+++GL GF++
Sbjct: 360  EANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEM 419

Query: 410  YQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTS--------VGEYLTVGYTP 461
            YQ  +  F                          S   WT         +  Y   G  P
Sbjct: 420  YQNGYPTFANDTLNQPNCDNINSYSHAVTS----SKQQWTQGSMDSSYILSTYDGTGDLP 475

Query: 462  NENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIY 521
            + N  P +TY      +G+Y++N+ TPGC+ D +CS+RGIVN T++D + + +L+T LIY
Sbjct: 476  SVNFYPNITY------AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIY 529

Query: 522  QNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSH-RTEV 580
            QNN++ KYD LYSG L S+ +IT+ +Y  +   ++ + +VADRVD+ I S+D S    + 
Sbjct: 530  QNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKT 589

Query: 581  SKLALNGLFQYQISNFT---NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLS 637
                LNGLFQYQISNFT   NDS  +KI NT++N++++ N  PS S       N+++L+ 
Sbjct: 590  INETLNGLFQYQISNFTTISNDS--LKIGNTTINRYSIENV-PSNSELFAGYYNNTLLVD 646

Query: 638  GTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNT 697
            G    +  + LN DL++ +  R+ +         YSNGL+ L G  N+S  + +  + N 
Sbjct: 647  GAFNGIAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFL-GDFNLSSQQISTLSYNG 705

Query: 698  TMD--GSLATDVA---NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANS 752
            T    G+L T++    NIT++  ELLVFNN YI+NV+S +  R N+S F L++ SAG+NS
Sbjct: 706  TFSSFGNLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIR-NTSSFALSLWSAGSNS 764

Query: 753  INDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPS--NTVPSRGIFLNDDSTGYFY 810
              D I +G V Q QY   N +  +N D N  I  + LPS          ++ND ST Y Y
Sbjct: 765  KEDGILVGAVSQRQYTELNGAVYIN-DAN-SISTIGLPSFDGKRVYTATYINDSSTAYAY 822

Query: 811  KESNKS--KLYITNSNSTSGL--EWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXX 866
               N S   + I   N +  L   W     T++Y+K+D+LL VG                
Sbjct: 823  SSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNI 882

Query: 867  XXXXVIKEENLNVGSSISSLLYFAKNDTLLVAGDF--EPSNGNCSDLCLYNYKSGQWDSL 924
                +I EENL   SS+++++ F KN +LLV GDF  +  + +CS LCLYNY + +W + 
Sbjct: 883  SNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNF 942

Query: 925  ANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLH 984
             NNS+SG++  LQ +    +L+ GNL       +N+A +N+++N V  L        +  
Sbjct: 943  YNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFV 1002

Query: 985  SMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISMEGT-------DD 1037
            +   +   ++  +D  +  +    W  ++    D + +     Q I ++ T       + 
Sbjct: 1003 TFDHTTDELITQSDNEISYYTNGEWKNLT--SEDFNDSLYMGAQLIPLKQTSSKRDVSNR 1060

Query: 1038 ALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTG-HLFMNRDISLHNIAQIPL 1096
            ALL+ G+ +HS +G + +++Y+F DW+PY + VDG   G   ++FMN+D+S         
Sbjct: 1061 ALLVNGDLKHSTYGSVSAMLYDFEDWMPYFI-VDGENAGRASNIFMNKDLS--------- 1110

Query: 1097 LNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVS 1156
                 + T Q+                       ++     +DRGFVVLIGLALA+ TV+
Sbjct: 1111 ----SLYTTQTILQGSNTSTSTTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVA 1166

Query: 1157 VMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            V+G AG ++AY F  N G  Y+ L PR+DE  M++T+PPEKL
Sbjct: 1167 VLGGAGAIIAYFFAGNKG-QYEPLKPRVDEGDMIDTVPPEKL 1207

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1224 (34%), Positives = 656/1224 (53%), Gaps = 77/1224 (6%)

Query: 18   ASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDAN--VTD 75
            AS+L N+ ++LN  E  +P  +  N +N  Q+L D+  + FY Y GQQNFT D N  ++ 
Sbjct: 22   ASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISS 81

Query: 76   VQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDL 135
               LIYYS++  + L +  + +  IQ IIP+GDDSF+LSG G +N  +L  QL++N+T L
Sbjct: 82   TNNLIYYSDDVLIQL-EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTL 140

Query: 136  SITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSINLLPFHGFG 191
            SI  IFD  L +I  + VD  +VYF                I W+     +  LPF GFG
Sbjct: 141  SIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFG 200

Query: 192  PYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSE-----ESVRNTTSLLLNPSVPL 246
              + +NSILKLNDDNILF G F T+ NSSLL  +  S       S  N++++ L   + L
Sbjct: 201  SDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISL 260

Query: 247  QYSQWKTN-GELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKDSQ 305
            +Y+ W       D +  +C   S ++W V   +G+     P  ++PSKIRIYN+   +  
Sbjct: 261  KYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDG 320

Query: 306  VSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIIN 364
            VSLFR +T P+  IMNLTY+DPL+G +  CDAFCPL + + L++   N T+E      IN
Sbjct: 321  VSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFIN 380

Query: 365  NNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXXXXXX 424
            NN+T++ W+ +YQEFA ++ +  ++L   A  SYG+   L+G +++Q S +A+       
Sbjct: 381  NNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQ 440

Query: 425  XXXXXXXXXXXXXXXXXXLSPNNWTS---VGEYLTVGYTPNENPVPKVTYKIDIQHSGEY 481
                              LS N W        Y+   Y  + +P+P V +  +IQ  G++
Sbjct: 441  PGCDTESTSLFSSSV---LSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDF 497

Query: 482  SINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSC 541
            SI ++TPGC AD TC +R IVN T+ D     +L+T LIYQNN+E+KYD +++G+L  S 
Sbjct: 498  SIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSP 557

Query: 542  EITMTYYSGLYASNTVTTIVADRVDL-----NIISMDLSHRTEVSKLALNGLFQYQISNF 596
            EIT+T+YS +        IVADRVDL     N+  + L    + + L LNGLFQYQ+SNF
Sbjct: 558  EITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNF 617

Query: 597  TNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQN 656
            T+D+   K+ N S++Q AL+ F  SVSL      N+SI L+G+  N+  + LN+DL ++N
Sbjct: 618  TSDT-KTKVGNNSIHQLALSQFPSSVSLIGNTF-NNSIFLAGSTSNIVQLQLNSDLELRN 675

Query: 657  STRLISTENFTTFQPYSNGLVMLDGQGNVS--------LFKDNFKNLNTTMDGSLATDVA 708
            +  + +    T  + YS GL+   GQ N+S         F   F + +   D    T  A
Sbjct: 676  TVVVDNGGETTRIENYSQGLLFF-GQYNISSTNVVDNLSFNGTFSSFSQLGDN--VTTFA 732

Query: 709  NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYA 768
            N T  G ELL FNN Y+YNV+S+     N+++F  +V + GANS NDT+ LG +V+ +Y+
Sbjct: 733  NFTYEGSELLFFNNDYLYNVSSESYIY-NNTMFTASVLATGANSNNDTLLLGNIVRSEYS 791

Query: 769  IANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSG 828
              N+  ++    N  +E ++  S+ VP   +FLND +  Y YK+   SK+ I  +N T+ 
Sbjct: 792  NFNEPLKLYG--NSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKI-IYGNNMTTS 848

Query: 829  LEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSISSLLY 888
            L++ G    + +  N +LL                        +  ENLN    I+S++ 
Sbjct: 849  LDFSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMS-LASENLNNYGYITSMID 907

Query: 889  FAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLG 948
            F  N+T+LV+G+F   + +C  +CLYNY + +W + AN+++ GS+  +QL+ +D IL+ G
Sbjct: 908  FNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISG 967

Query: 949  NLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNS 1008
              +    + + +A +++   ++   ++  D+ + + S I     I  W++  +  +    
Sbjct: 968  LFSAQNYSSITLASLDIKGYNIS--VLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEK 1025

Query: 1009 WTRVSVPGTDSSATSISSVQFISME------GTDDALLLLGEFRHSEFGDIKSIVYNFRD 1062
            W  +S P T S    I SV+ +S++           L   GEF  + +G + ++++   D
Sbjct: 1026 WNEISFPNTTSKY--IESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGD 1083

Query: 1063 WIPYL----LYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVL----TNQSFAXXXXX 1114
            W PY       V+     T  LF NRD+S        L NS   L    T+   +     
Sbjct: 1084 WKPYFSINNFQVNEDPAIT--LFENRDLS-------SLFNSKNSLPANITSAETSSRSTV 1134

Query: 1115 XXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVG 1174
                           HSK     +DRGFVVLI LALA+ TV+++G+ GV +AYIFRD   
Sbjct: 1135 SSATATTVVNKIEGKHSK-----IDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDE-- 1187

Query: 1175 DSYQTLNPRMDENAMVNTLPPEKL 1198
              Y+++ PR+D   M++T+PPEKL
Sbjct: 1188 QKYESIKPRIDGQEMLDTVPPEKL 1211

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1187 (36%), Positives = 677/1187 (57%), Gaps = 55/1187 (4%)

Query: 42   NKNNQFQILDDINGISFYEYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQI 100
            N ++  Q+L   + +S Y Y GQQNF+      T+   L+YYSN T + L+  +  + +I
Sbjct: 45   NNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLD-DTRI 103

Query: 101  QGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF 160
              I+P+G DSFILSG G +N  SL +QL +N++ LS+  IF+T L  +E + VD  LVYF
Sbjct: 104  NNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYF 163

Query: 161  ----MXXXXXXXXXXAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTV 216
                             +W+    S  LLPF GFG  ++IN+IL+LNDDNILFAG F T+
Sbjct: 164  GGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTL 223

Query: 217  WNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWKTN-GELDSSQLICPDPSKDSWSVS 275
             ++SLL  SN S  +  N   L L+P +PL  + W ++  + D+S  IC +P  D+W VS
Sbjct: 224  DDASLL-TSNTSN-ATTNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVS 281

Query: 276  ATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSC 335
             TTG   C LP+    +KIRIYNSPD  +Q+S FR ++ P+GSIMN+TY+DP +GN+  C
Sbjct: 282  GTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHC 341

Query: 336  DAFCPLYSKTVLQSQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNAL 395
            D++CPL S+  L S  D  + +    ++++N+T I+W+  YQEF  V+ V+ T L+F AL
Sbjct: 342  DSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLAL 401

Query: 396  ASYGNNLGLAGFQIYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNW---TSVG 452
             SYG+N+ LAG+ +YQ  ++ F                         LS N+W    S  
Sbjct: 402  NSYGSNVALAGYSLYQDEYAVFA----NNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQ 457

Query: 453  EYLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTN 512
             Y+T  YT  ++P+P+VT+  ++ +SG+Y IN++TPGCS D TCSTRG+VN T++D   +
Sbjct: 458  TYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDD 517

Query: 513  KMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISM 572
             +L+T  IYQNN+ +KYD L+SG L +S  I + Y SG+ + +T TT+VADR ++ + S+
Sbjct: 518  SILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSL 577

Query: 573  DLSHRTEVSK----LALNGLFQYQI--SNFTNDSIPMKIANTSLNQFALNNFEPSVSLRA 626
            D+  +   SK    +ALNGLFQYQ+   + T +S   K+  T LNQ+ L+ F  + SL A
Sbjct: 578  DILGQISSSKNGSTVALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFA 637

Query: 627  FPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS 686
                N  +L+ G E +++++  + DL+   S        F   QP+S G + L G  N+S
Sbjct: 638  STYDN-YLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEG-IFLYGNFNLS 695

Query: 687  LFKDNFKNLNTTMD-----GSLATDV-ANITLNGDELLVFNNGYIYNVTSQQQTRSNSSI 740
               +     N + +     G+ + D   N+T    E+LVFNN Y+YNV+S     ++SS+
Sbjct: 696  GVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSL 755

Query: 741  FNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIF 800
             +L++ SAGAN+  D +F G   Q  Y+  N+S  + A  N+ ++ ++   +  P  G++
Sbjct: 756  -SLSLWSAGANANGDLLFNGASSQMSYSFNNESINIGA--NNIVQGLNFNESIDPYLGLY 812

Query: 801  LNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXX 860
            +N     YFY++ + +++Y TN +  S  +W  +    +Y  N +LL+ G          
Sbjct: 813  MNTSHGAYFYQDDDNTRVYFTNGSQPS-WQWPNDVVAAIYSDNQSLLIAGTSSSLESSSF 871

Query: 861  XXXXXXXXXXVIKEE-NLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSG 919
                      VI  E   +  S IS ++ FA N T ++ G+F   N NC  LCL+NY + 
Sbjct: 872  LTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNS 931

Query: 920  QWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDA 979
             W S A+ S++G+V  +QL+    ++V G  +    + + MA +NL NN + +L  K   
Sbjct: 932  TWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITAL--KSGE 989

Query: 980  PVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISME------ 1033
                 S  V++ +IVAWN+T L  ++ N WT   +   +SS+  + ++ ++++       
Sbjct: 990  SNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSSV-VDNLNYVTLASALSKR 1048

Query: 1034 --GTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDISLHNI 1091
               + DA+L+ G+   + +G I+++VY+F  W+PYLL ++     + + F++RD+S    
Sbjct: 1049 DTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLL-INSESDSSINAFIDRDMSSFTN 1107

Query: 1092 AQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALA 1151
             Q+ LL ++  ++N S                       +K  +R +DRGFVVL+GLALA
Sbjct: 1108 TQVALLTNSGTVSNSS-------SSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALA 1160

Query: 1152 LATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            L TV+V+G+AGV++AY+FRD+ G +Y+ +NPR+DEN M+ T+PPEKL
Sbjct: 1161 LGTVAVLGIAGVIMAYVFRDDNG-AYEPINPRIDENEMIETVPPEKL 1206

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1229 (33%), Positives = 672/1229 (54%), Gaps = 76/1229 (6%)

Query: 5    VVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQ 64
            +++ L+ +V ++ AS LEN++       +  P  D   +    Q+    N ++F +Y GQ
Sbjct: 4    LLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGE--ALQLFGGFNALTFPQYEGQ 61

Query: 65   QNFT-TDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVS 123
            +NFT T  N TD + ++YYSN+TF+ L +  ++++ ++ I+P G +SFIL G G +    
Sbjct: 62   ENFTGTINNNTDSRGIVYYSNDTFIKLING-SSDSYVEKIVPFGSESFILGGSGSLLGYE 120

Query: 124  LASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMXXXX----XXXXXXAIMWDSRD 179
            L  QL++N++DLS+  IF+  L  +  +  D P+ YF                  W+S  
Sbjct: 121  LGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSS 180

Query: 180  RSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLL 239
             + +LLPF GFG  + +NSI+KL+ DNILF G F T+ + +LL+ +N +     ++ S+ 
Sbjct: 181  NTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLI-TNENTSKTNHSQSIE 239

Query: 240  LNPSVPLQYSQWKTNGELDSS--QLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIY 297
            +N  +PL+ + W T+ +        ICP+  K++WSV +T+G     LP++  P K+RIY
Sbjct: 240  INELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIY 299

Query: 298  NSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEA 357
            NSP++ + VSLFR +T P+  IMNLTY+DPLSG + +CDAFCPL  +  L++   N    
Sbjct: 300  NSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVAN-GNT 358

Query: 358  NTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAF 417
            + V  ++NN T+IQW+ +YQ+FA V+ +A T L+F AL+SYG+ +GL+ FQ+YQ + + +
Sbjct: 359  SQVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTY 418

Query: 418  GXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTS--VGE-YLTVGYTPNENPVPKVTYKID 474
                                     LS + W     G+ YL   +   +  +PKVT+   
Sbjct: 419  ANNSLNEVGCESNDIASTSA-----LSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPA 473

Query: 475  IQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYS 534
            I ++G+Y++N++TPGCS+D TC++R IVN T++  V   +L++ L++QNN+ +KYD +YS
Sbjct: 474  INYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYS 533

Query: 535  GQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQIS 594
            G L ++  +T+ YYS +  +N    +VADR+++ + S+D+        + LNG+FQYQ+S
Sbjct: 534  GHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDETIPLNGMFQYQLS 593

Query: 595  NFTN--DSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDL 652
            NFTN  DS P  IANT+LN + + NF  + SL +  + N+++ + G+   + ++ L+ DL
Sbjct: 594  NFTNSTDSKP-SIANTTLNSYTVQNFPKNASLFS-SMYNNTLWVGGSVSGVAAVELDEDL 651

Query: 653  SVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS-----------LFKDNFKNLNTTMDG 701
             V ++ +  +         YS+G+++  G  N+S           +F  +F NL TT+  
Sbjct: 652  HVSSTAKYATGGTVEGISSYSDGIILF-GTFNLSSQPVSTLTFNGVFG-SFGNLETTL-- 707

Query: 702  SLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGK 761
                   N++   DELLVFNN Y++N++S     ++S+ F L++ SAG N  +DT+F G 
Sbjct: 708  ---RTYTNVSFQQDELLVFNNEYVFNLSSNSYISNSST-FGLSLWSAGRNQFDDTLFSGA 763

Query: 762  VVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYIT 821
            V + Q+     SA + +  N  +   SL +   P     LND  T Y Y+  + S+LY  
Sbjct: 764  VTKNQFPGLYGSASIYS--NSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFD 821

Query: 822  NSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGS 881
            N        W+G   ++ Y KN T+L +G                    V+    ++   
Sbjct: 822  NGKE-GPWTWFGTINSMRYSKNSTILAIG-TDGSTDEPILSLFNLTSFDVLANTTISENG 879

Query: 882  SISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQN 941
            +ISS+++F +N +LLV GD+  S+ +CS LCLYNY   QW   ANNS++G++  +QL ++
Sbjct: 880  TISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSES 939

Query: 942  DTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVL 1001
              +L+ G + +     VN+   N+SN  V  L+   + P+   S I  ++ I+ WN+T L
Sbjct: 940  YDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPI--KSFIAEDNDIITWNETSL 997

Query: 1002 FSFDGNSWTRVSVPGTDSSATSISSVQFISME----------GTDDALLLLGEFRHSEFG 1051
              +    W  +     +SS  SI  V  +  E           T DA+L+ G+  ++E+ 
Sbjct: 998  SGYSDGDWQNLEF--DNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYP 1054

Query: 1052 DIKSIVYNFRDWIPYLL--YVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLTNQSFA 1109
              ++ +YNF+ W+PY +    D         F N+D S        L +S  +L++ +  
Sbjct: 1055 --QASIYNFQRWLPYYVANKADDEDPSRTTFFTNQDDS-------QLYDSQNLLSDPTRT 1105

Query: 1110 XXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIF 1169
                                  +   +I +RGFVVLIGLALAL TV ++G+ GVLLA +F
Sbjct: 1106 TTSSSSSTTSSSQTSPSKGSLVRKSGKI-NRGFVVLIGLALALGTVVIIGITGVLLALVF 1164

Query: 1170 RDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
              + G  Y+ ++PR DE+ M++T+PPEKL
Sbjct: 1165 NGHSG--YEQVDPRADESEMIDTVPPEKL 1191

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1265 (33%), Positives = 676/1265 (53%), Gaps = 98/1265 (7%)

Query: 18   ASNLENVRRILNATEVTVPTFDVGNKNNQ-FQIL--DDINGISFYEYLGQQNFTTDANVT 74
            A+ L +++ IL    +  P F++ +  NQ  Q+L  +  + ++F  Y GQQNFT     +
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 75   DVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTD 134
                LIYYSN+T++ L D I    +IQ IIP G D+FILSG G +N   L++QLV+N+TD
Sbjct: 83   SQNHLIYYSNDTYIRLLD-IPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 135  LSITKIFDTPLRSIEGVTVDGP---LVYF-----MXXXXXXXXXXAIMWDSRDRSINLLP 186
            LS+T IF+  L          P   LVYF                 I+WDS         
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 187  FHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLL-------LQSNVSEE-SVRNTTSL 238
            F GFG  + IN+ILKLN +++LF+G F T+ + S+L         +N S   S +N ++ 
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 239  LLNPSVPL---QYSQWKTNGELDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIR 295
             LN  +PL   ++S   TN  ++ +QLICP    ++W+  +  G     LPF I PSKIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 296  IYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQ-SQWDNT 354
            I+NSPD D +V+ FR       SIM+L YLDPL G +  C  FCPLY++  L+    ++ 
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 355  AEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASF 414
             +++ + +++NN+T+I+W+  YQEFA V+    T+LEF AL+SYG+ +GL+G  ++Q+  
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 415  SAFGXXXXXX-----------XXXXXXXXXXXXXXXXXXLSPNNWTSV---GEYLTVGYT 460
            + F                                    LS N+W +     +YL   Y 
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 461  PNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLI 520
             +   +P VT+  ++ ++G Y++++ TPGC+ADN+C +RGIVN T+++   + +L TSLI
Sbjct: 502  SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLI 561

Query: 521  YQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDL-----S 575
            YQ N+  K+D +++G L+   +ITM++YSG+Y++    TIVADR++L I S+D      S
Sbjct: 562  YQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSS 621

Query: 576  HRTEVSKLALNGLFQYQISNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSIL 635
            +  ++  + LNGLFQY   N  N+ +     N+++NQ+A +N+  +VSL A      ++L
Sbjct: 622  NEIDIYNVTLNGLFQYPEYNSVNN-LNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLL 680

Query: 636  LSGTEGNM--FSINLN-TDLSVQNSTRLISTENFTTFQPYSNGLV----MLDGQGN---V 685
            + G+   +  F I  N  ++S+QN+ + +++   T   PYS+GL+    ++D  G+   +
Sbjct: 681  VGGSINKLQEFQIEKNGQNISLQNTFKDLNS--VTGIVPYSDGLIAYGDIMDSSGSYKAI 738

Query: 686  SLFKDNFKNLNTTMDGSLATDVANITLNGD-ELLVFNNGYIYNVTSQQQTRSNSSIFNLT 744
            +   + F  L    D       +NI+L    E+L FNN Y YN ++ +  + N+S F L+
Sbjct: 739  TFTNNKFGTLGNFTDE--IQSFSNISLTTSWEILSFNNKYFYNQSNMEDFK-NTSTFELS 795

Query: 745  VSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDD 804
            + SAG N+ ND IF G V + +    N +  V+ + N+ I++++L +N  P   +FLND 
Sbjct: 796  LWSAGKNAQNDLIFSGLVSENEN--VNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDS 853

Query: 805  STGYFYKESNKSKLYITNSNSTS-GLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXX 863
            ST Y Y E N     + +SN       W  +  ++ +  N++LL VG             
Sbjct: 854  STIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSI 913

Query: 864  XXXXXXXVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDS 923
                   VI  E LN  S ISSLLYF KN ++LV G+F  S+  CS LCL+NY++  W +
Sbjct: 914  LNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWST 973

Query: 924  LANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNL 983
              NN++ G+V+ L+L  N  IL+ G L+  ++ ++++A +NL+  +V  L+       NL
Sbjct: 974  FMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQN----TNL 1029

Query: 984  HSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVP-GTDS---------SATSISSVQFISME 1033
             S   + ++I AWN + LF ++  +W+++ +P GT+S           T+ +S   +   
Sbjct: 1030 TSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKR 1089

Query: 1034 GTDDALLLL--GEFRHSEFGDIKSIVYNFRDWIPYL---LYVDGPRQGTGHLFMNRDISL 1088
               D  +++  G+F     G ++++ Y    WIPY    L  +     + ++F N+DIS 
Sbjct: 1090 ALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISS 1149

Query: 1089 HNIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKP--------------- 1133
              I+   L N    L++   +                     + P               
Sbjct: 1150 KIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQN 1209

Query: 1134 GRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTL 1193
             +  + RGFVVLIGLAL+LATV+++G+ G+LL++IFRD+ GD Y++L PR  E+ M + +
Sbjct: 1210 KKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGD-YESLKPRTTEHEMFDAV 1268

Query: 1194 PPEKL 1198
            PPEKL
Sbjct: 1269 PPEKL 1273

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1234 (32%), Positives = 640/1234 (51%), Gaps = 84/1234 (6%)

Query: 5    VVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQ 64
            ++Y L     + R S L N+ ++LN +    P +D  +       +++   ++   Y GQ
Sbjct: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPD----LTYMNNFEELTVISYTGQ 62

Query: 65   QNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSL 124
            QNFT  AN +    L+YYSN+TF+ L ++ + E  +  I+PL +DSFILSG G IN V+L
Sbjct: 63   QNFTVQANES---SLLYYSNDTFVKLFET-SPETTVTMIVPLFEDSFILSGTGQINGVAL 118

Query: 125  ASQLVFNMTDLSITKIFDTPLRSIEGV-TVDGPLVY---FMXXXXXXXXXXAIMWDSRDR 180
              Q++ N+T L+ + IF + + ++  + TV+  +++   F           A++WD    
Sbjct: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178

Query: 181  SINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQ-SNVSEESVRNTTSLL 239
            +  L PF GFG  + +NS++KLN DNILFAG F  + N+SLL +  N +  S  + TSL 
Sbjct: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238

Query: 240  LNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVS-ATTGDFTCELPFQITPSKIRIYN 298
             + SVPL+ S   T   + S  L+CP   ++ WS S A       +L  +I PSK+RIYN
Sbjct: 239  FDQSVPLKLSSI-TGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297

Query: 299  SPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEAN 358
            S +++S++SLFR +T P+  IMNLTYLDP SG +  CDA+CPL S   L     N+  A 
Sbjct: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357

Query: 359  TVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFG 418
                INNNSTN++W+ +YQEFA V+ +  T L+F ALASYG+N  L   +I++  F  + 
Sbjct: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417

Query: 419  XXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHS 478
                                    LS +NW +  E  T   T  ++ +P VT+  +I + 
Sbjct: 418  -----NNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYP 472

Query: 479  GEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLN 538
            G Y+ N++TPGC  DN+CS RGIVN T+ D   N++LA+ LIYQ N+E K+D LY+G L 
Sbjct: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532

Query: 539  SSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD-LSHRTEVSKLALNGLFQYQISNFT 597
            S+ EI +T+   +  S++V  +V DR+ +    +D +S  +  +   LNGLFQY  +N T
Sbjct: 533  SAPEIIVTWDKAIGESDSV--MVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVT 590

Query: 598  NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNS 657
                 +   N + N +AL NF    +L A  L N+ IL+ G    +  + LN +  + +S
Sbjct: 591  ---ASIFSTNDTFNDYALYNFPLDANLYAASL-NNDILIGGNFNGIAKVELNDEALISSS 646

Query: 658  TRLISTENFTTFQPYSNGLVML-------DGQGNVSLFKDN----FKNLNTTMDGSLATD 706
             +L ++   T    YSNGL++        D +  +  +  N    F  L+  +D      
Sbjct: 647  QKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPID-----R 701

Query: 707  VANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQ 766
            + N T++G ELL+F+N YI+NV++     SNSS F +T  SAG NS ND++  G  ++  
Sbjct: 702  IVNFTIDGHELLLFDNAYIFNVSANMYV-SNSSTFEITGQSAGINSGNDSLLFGSFLKRS 760

Query: 767  YAIANQSAQVNADFNDGIEQM-SLPSNTVPSRGIFLNDDSTGYFYKESN----KSKLYIT 821
                N  A +++D       +  LP++  P +  ++ND S  Y  +E +    + ++ IT
Sbjct: 761  VGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLIT 820

Query: 822  NSNSTSGL---EWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXV---IKEE 875
            N+NS+S +   +W       +YD    +L +G                        +   
Sbjct: 821  NTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARV 880

Query: 876  NLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAA 935
            N +    ++S++ F+ N+++LV G +E    NC+DLCLYNY++ +W S  N+S++G +  
Sbjct: 881  NFSTNERVNSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQ 938

Query: 936  LQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMK--KDAPVNLHSMIV---SN 990
            +Q       L++G L +   N+ N+  +++    VGS I    K     L S +    S 
Sbjct: 939  MQFADEGKTLLVGGL-IKTNNESNIQLLSV---EVGSNIFSTVKSGTEPLLSFVPIDDST 994

Query: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATS----ISSVQFISMEGTDDALLLLGEFR 1046
              I+A  ++ +   +  +W+       + S  S    +S  +    +     +LL G   
Sbjct: 995  DNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLN 1054

Query: 1047 HSEFGDIKSIVYN--FRDWIPYLLYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLT 1104
             SE+G++ S+VY+   + W PY +  D   Q +    +       N+  + L +S  VL 
Sbjct: 1055 SSEWGNLTSVVYDGSTQKWQPYFVISDPKEQES----LPSSSFFQNVNDLYLSSSQTVLQ 1110

Query: 1105 NQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVL 1164
            + +                            + +DRGF+VLIGLALALATV+V+G+ G L
Sbjct: 1111 SNN------SDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGAL 1164

Query: 1165 LAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            + Y F +N G  Y++L PR++++ M++T+PPEKL
Sbjct: 1165 ICYFFINNNG--YESLKPRINQDEMLDTVPPEKL 1196

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  559 bits (1440), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 415/1255 (33%), Positives = 646/1255 (51%), Gaps = 120/1255 (9%)

Query: 8    CLWFAVAITRASNLENVRRILNATEVTVPTFDVGN-KNNQFQILDDINGISFYEYLGQQN 66
             L F   + + S +  V    N T+ T P  D+   +N+Q  I DD     +Y Y GQQ 
Sbjct: 10   VLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQI 69

Query: 67   FTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLAS 126
            FT  A+      LIYYSN T++ L++ +   A+I+ I+P GDDSFILSG+G+     L  
Sbjct: 70   FTGLADERK-NSLIYYSNNTYVQLAE-LPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEH 127

Query: 127  QLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSI 182
            QL++N++   IT+I   PL  +  +  DG +VYF                + WD+ D+S 
Sbjct: 128  QLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSS 187

Query: 183  NLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNP 242
            +LLPF+GFG  + +N+I+KL+D NILF G FST+ N++LL   NVS   + N+T++  N 
Sbjct: 188  SLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNA 247

Query: 243  SVPLQYSQWKTNGELDSSQLICPDPSKDSWSV-SATTGDFTCELPFQITPSKIRIYNSPD 301
               L++S    +G L+SS  +CP+ S DSW++  +T G+ T  +  Q+TPSKIRIYNS D
Sbjct: 248  LASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKD 307

Query: 302  KDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVA 361
             ++QV+LFR +T P+ SIMN+TY+DP++G +  CDA+CPL   +VL +  +N+  +   A
Sbjct: 308  SNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMAA 367

Query: 362  IINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXXX 421
              NNN+  ++WT  YQEFA V+ V    L F A+ S+G+N+GL G +++QA +  +    
Sbjct: 368  FPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNT 427

Query: 422  XXXXXXXXXXXXXXXXXXXXXLSPNNWTSV---GEYLTVGYTPNENPVPKVTYKIDIQHS 478
                                 +    W        Y+   +T  +   P VT    I + 
Sbjct: 428  LNQPNCDSQQNFPASVVSKDTV----WYQGLPDQSYMATSFTAGK---PSVTLTPSIPYP 480

Query: 479  GEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLN 538
            G Y++N+ TPGC  DNTC+ RGIVN T+        L    IYQNN+ +KYD L+ G L+
Sbjct: 481  GIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRGYLD 539

Query: 539  SSCEITMTYYSGLYASNTVTTIVADRVDLNIIS---MDLSHRTEVSKLALNGLFQYQISN 595
             S  + + +   +  +     +VADRV   I S   +++ + T  S L LNGLFQY  SN
Sbjct: 540  DSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNL-LNGLFQYAASN 598

Query: 596  FTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDL--S 653
            FTN ++   + +T+++Q+ + N   S SL     +++  + S +   +  I+   D    
Sbjct: 599  FTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWND 658

Query: 654  VQNSTRLISTEN-FTTFQPYSNGLVM------------LDGQGNVS-LFKDNFKNLNTTM 699
            +    +LI TE   T   PYSNGL +            L   G++S +F+ N  +L+   
Sbjct: 659  IIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLS--- 715

Query: 700  DGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFL 759
                   + N+T++G E+LVF+NGY+YNV+SQ    SNS    L++ SAGAN  +D I  
Sbjct: 716  -------ILNLTIDGSEILVFDNGYVYNVSSQSDI-SNSETLKLSLLSAGANLEDDLILA 767

Query: 760  GKVVQWQYAIANQSAQVNADFNDGIEQMSLPS--NTVPSRGIFLNDDSTGY-FYKESNKS 816
            G V   ++ + N +  ++AD N+ +    LPS  + +  RG+F+ND S+ Y +Y +S  S
Sbjct: 768  GNVQSTKHFVPNGAIAIDADSNEVVTS-GLPSVDDGIIYRGLFINDSSSAYAYYSKSLGS 826

Query: 817  KLYITNSNSTSGLEWYGEPET------------VVYDKNDTLLMVGYYXXXXXXXXXXXX 864
                    S  G+  YGE E             ++Y K+  LL V               
Sbjct: 827  --------SKGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIH 878

Query: 865  XXXXXXVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSL 924
                     +E   +G  I++++ F +N TLLV G F  +   C DLCLYNY +  W   
Sbjct: 879  DLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRF 936

Query: 925  ANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLH 984
             + +++G +  LQ    +T++V G L    + D+ +  ++LSN  + S +   +     H
Sbjct: 937  MDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQH 996

Query: 985  SMIVSN--SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISMEGT------- 1035
             + V N  S ++A +   +F F    W  +S P T S  T I+ +  +S + +       
Sbjct: 997  VLTVGNSSSELIAHDGNQVFHFVDGQWKNIS-PDT-SGQTQINGLTLLSTDFSQRNSIMK 1054

Query: 1036 -----DDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQG-------TGHLFMN 1083
                 ++ +++ G F   ++GDI ++ Y+F  W PY  Y   PR+         G LF+N
Sbjct: 1055 RDRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPY--YFSVPRESNSDEVIPQGQLFLN 1112

Query: 1084 RDISLHNIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFV 1143
            +D+S  + +QI L N                               H K  +++  + FV
Sbjct: 1113 KDVSFTSSSQIYLSNDND----------------NDDTPAASEPATHEKHTKKLA-KIFV 1155

Query: 1144 VLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            VLI LALALATV+V+GV GVL AY+F D+  ++Y+ L PR++E  M+ T+PPEKL
Sbjct: 1156 VLIALALALATVAVLGVVGVLFAYLFGDH--NAYEPLKPRINEAEMLKTVPPEKL 1208

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  555 bits (1431), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 394/1192 (33%), Positives = 605/1192 (50%), Gaps = 83/1192 (6%)

Query: 43   KNNQFQILDDINGISFYEYLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQG 102
            +NN+ Q+L  I   ++Y Y GQQNFTT ++  +   LIYYSN T + L D++  + +++ 
Sbjct: 8    RNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRL-DAVPTDVEMRH 66

Query: 103  IIPLGDDSFILSGQGMINNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF-- 160
            IIP  DD FILSG G I+ + L+ Q++ N+T LS   IF+  L  ++ + VD  +VYF  
Sbjct: 67   IIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGG 126

Query: 161  --MXXXXXXXXXXAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWN 218
                          + W+S   S +LLPF GFG  + +NSI++L ++N+LF G F+ + N
Sbjct: 127  DITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLEN 186

Query: 219  SSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSATT 278
            +S + ++N +     +     +   + L+ + W  N  LD    ICP+  + +W    + 
Sbjct: 187  NSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAWYSEGSY 246

Query: 279  GDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAF 338
            G  TC  P  +T SKIRIYN+P  D+Q+SLFR +  P   I+NLTYLDP+S ++  C   
Sbjct: 247  GVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKHCTEN 306

Query: 339  CPLYSK-TVLQSQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALAS 397
            CPL+++ T+L +  + T E++ +  INNNSTNI+W   YQEFA V+ +  TSL+F A  S
Sbjct: 307  CPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFVASNS 366

Query: 398  YGNNLGLAGFQIYQASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWTSVG---EY 454
            Y  N+GL+GFQIYQ SF  F                         LS N W +V     Y
Sbjct: 367  YYQNVGLSGFQIYQDSFPIF----PNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSY 422

Query: 455  LTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKM 514
            L   Y PN+   P +TY + I   GEY +N+ TPGC  DNTCSTRGIVN T FD     +
Sbjct: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482

Query: 515  LATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD- 573
            L ++LIYQNN+ +KYD +++G LN+S  + + YYSG+  +    T+V   VD+  +S+  
Sbjct: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISS 542

Query: 574  --LSHRTEVSK-LALNGLFQYQISNFTNDS--IPMKIANTSLNQFALNNFEPSVSLRAFP 628
              +S + +  + L LNG+F+Y  SNFT D+  +  KI  T L+ F ++NF    S+ A  
Sbjct: 543  EFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVD 602

Query: 629  LSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTEN-----FTTFQPYSNGLVMLDG-- 681
              N ++ L  T G+++ +N        N + + STEN              GLV+     
Sbjct: 603  -QNQNLYLGSTNGSVYELN------SLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIA 655

Query: 682  ----QGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSN 737
                +    +   +   L+   + S+     N TL G  LLVF+N  I+N+TS      N
Sbjct: 656  HRGREYGAVILNKSITPLDIVANDSIQASF-NSTLFGSNLLVFDNSTIFNMTS-FMVFEN 713

Query: 738  SSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSR 797
            +S  NL + +AG NS +D + +G +V    AI N+S  +++  N      SL  N     
Sbjct: 714  TSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISS--NGTYSPFSLSDNDTIEG 771

Query: 798  GIFLNDDSTGY--------FYKESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMV 849
             I+LND    Y        +++ S+K +L  T         W      V Y     LL  
Sbjct: 772  AIYLNDTKALYSLSSGNVNYFQLSDKQRLPWT---------WQSTVVPVFYSNGQQLL-- 820

Query: 850  GYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCS 909
            G                    VI +        I++++ FA N T LV GDF  SN  C 
Sbjct: 821  GAIQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACV 880

Query: 910  DLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVL-GNLTLPQANDVNMAFVNLSNN 968
             LCLYNY +  W S  NNS++G+++ ++   NDT ++L G L + +  D+N+  +NL++N
Sbjct: 881  GLCLYNYNNSNWSSFLNNSITGNISQIKF--NDTQMLLSGKLEVNKTADINLLSINLTSN 938

Query: 969  HVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQ 1028
                 I+  +  V L   I+  + +V WN T +F  +   W+ +++    ++AT    + 
Sbjct: 939  KQD--ILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNAT----IN 992

Query: 1029 FISMEGTDD--ALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDI 1086
             I   G D   AL++ G+F   ++G I +++Y+F  W PY       +  T   F +RD 
Sbjct: 993  RIENFGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRDQ 1052

Query: 1087 SLHNIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLI 1146
            S +        N+  V+ +                        + KP +  + RGFVVLI
Sbjct: 1053 SSYG-------NTRHVVPDHIIV---SSSHSSSAPSSSSSHKTNEKPYK--IRRGFVVLI 1100

Query: 1147 GLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            GLALALAT+ V+G+ GV++A +F  +V   Y  +     +N   + + PEKL
Sbjct: 1101 GLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKL 1152

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  551 bits (1421), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 377/1214 (31%), Positives = 616/1214 (50%), Gaps = 56/1214 (4%)

Query: 18   ASNLENVRRILNATEVTVPTFDVG-NKNNQFQILDDINGISFYEYLGQQNFTTDANVTDV 76
             S+L+ +   L      +P  D+  +KNN+ Q+L +   I+  +Y GQ+NFT + +    
Sbjct: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPE 79

Query: 77   QRLIYYSNETFMSLSDSIAAEA--QIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTD 134
              LIYYSNETF+ +  S  +     +  I+P  DD+FILSG G I+   L+ QL+FN++ 
Sbjct: 80   NALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSS 139

Query: 135  LSITKIFDTPLRSIEGVTVDGPLVYFMXXXXXXXXXXAI----MWDSRDRSINLLPFHGF 190
            L   +IF   L  +  +T +G  V+F            I    +WDS    + +LPF GF
Sbjct: 140  LEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGF 199

Query: 191  GPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQ 250
            G  + +NSIL L++ NILFAG+FS V N+  L   NVS  S  NT+   L   + LQ + 
Sbjct: 200  GKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS--NTSVPELGHQISLQSAA 257

Query: 251  WKTNGELDSSQLICPDPSKDSW-SVSATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLF 309
            W ++G LD S + CP      W    +T G F   +P +  PSK+R++N+ D D QVSLF
Sbjct: 258  WVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLF 317

Query: 310  RFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVAIINNNSTN 369
            R +T P+  IMNLTYLDP +G + SCDA+CPL S   L      +   + V    N +T 
Sbjct: 318  RIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYFENRTT- 376

Query: 370  IQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXXXXXXXXXXX 429
            +QW+ ++Q+FA V+ V  + L F AL SYG+++GLAG ++Y++++S +            
Sbjct: 377  LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQ 436

Query: 430  XXXXXXXXXXXXXLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPG 489
                          + ++ +S G YL+     +E   P V +   I + G Y+I+V TPG
Sbjct: 437  GSATSNALLSNSS-AWDSGSSEGNYLSTSVQDSETN-PFVIFYPSIIYPGVYTIDVLTPG 494

Query: 490  CSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYS 549
            C  D++C TRGI+N T+ D   N +L +  IYQNND  K+DTLYSG L+S  ++T+ +  
Sbjct: 495  CLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDG 554

Query: 550  GLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQISNFTNDSIPM-KIANT 608
             + +   V  +VA ++ +NI   D S     +   +NGL  Y  SN ++    +   + T
Sbjct: 555  AINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSNTSSFLSELGSYSAT 614

Query: 609  SLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTENFTT 668
             L  ++++      ++ A    +  +L + T+G M  + L  +LS++  T     ++ +T
Sbjct: 615  DLAHYSVSKLPKHSNIFANMFEDDLVLFT-TDGEMARLKLANNLSIEEYTFETIGKDIST 673

Query: 669  FQPYSNGLVML---DGQGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVFNNGYI 725
               YS GL+++   +G    +    N    N T   S     +N+TL   E+L+F+   I
Sbjct: 674  ISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKNII 733

Query: 726  YNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIE 785
             N T+ ++    S +  L V+SAG N  NDT+F G V+Q  Y   N S  ++ +  +  +
Sbjct: 734  LNGTTGEKIYDTSKL-TLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQ 792

Query: 786  QMSLPSNTVPSRGIFLNDDSTGY-FYKESNKSKLY----ITNSNSTSGLE-WYGEPETVV 839
                    +P    F+++ +T Y +Y   N S  +    + +S ST  L  W G+   + 
Sbjct: 793  NFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAMA 852

Query: 840  YDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIKEENLNVGSSISSLLYFAKNDTLLVAG 899
              KND+LL +G                    +   +  +   S++S+++FA+N+++LV G
Sbjct: 853  SSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYK-WDSEISLNSIIFFARNNSVLVGG 911

Query: 900  DFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVN 959
             F  +N  CS LCL+NY+  +W    NNS+ G +  ++++ N  +L+ G+  L + + V+
Sbjct: 912  SFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVS 971

Query: 960  MAFVNLSNN-----HVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSV 1014
            +A + L ++     H G++ +         SM  S++ +VA++DT L   +   W ++S 
Sbjct: 972  LASICLKDSSSEILHEGNITLN-----GFVSMDGSSNNVVAFSDTSLLQLESGKWQQIST 1026

Query: 1015 PGTDSSATS-------ISSVQFISMEGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYL 1067
              T++S            + +    + +   LL+ G  +H++FG I +  Y+  +W P+L
Sbjct: 1027 NFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFL 1086

Query: 1068 LYVDGPRQG---TGHLFMNRDISLHNIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXX 1124
                        T H+F+NRD+S         L+    L     +               
Sbjct: 1087 SSNQATSSSDLETSHVFLNRDLS-------DFLDYKGYLQGTFSSNTSSGTSGTPSPSGS 1139

Query: 1125 XXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRM 1184
                   K  ++ +DRGF+VLI LALAL T++V+G+ GV+ +Y F D+ GD YQ   PR 
Sbjct: 1140 SPSNLQRK--KKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDS-GDGYQLSKPRT 1196

Query: 1185 DENAMVNTLPPEKL 1198
            DEN M++T+PPEKL
Sbjct: 1197 DENEMIDTVPPEKL 1210

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  534 bits (1375), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 385/1249 (30%), Positives = 618/1249 (49%), Gaps = 133/1249 (10%)

Query: 15   ITRASNLENVRRILNATEVTVPTFDV-GNKNNQFQILDDINGISFYEYLGQQNFTTDANV 73
            + R S+LE+V +  +      P  D+   +N +  + DD     +Y Y GQQ FT     
Sbjct: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQH 76

Query: 74   TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMT 133
                 LIYYS  T++ L+  +  +  ++ I+P G DSFILSG G + +  L  QL++N++
Sbjct: 77   QG-SSLIYYSEGTYVQLA-KLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134

Query: 134  DLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIMWDSRDRSINLLPFHG 189
             L +T+I    L S+  + VDG +VYF               A+ W++  R+ +LLPF G
Sbjct: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194

Query: 190  FGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNV---SEESVRNTTSLLLNPSVPL 246
            FG  +++N+ILKL+   +LF G FS +  +S    ++V   +E+   N T++  N    L
Sbjct: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254

Query: 247  QYSQWKTNGELDSSQLICPDPSKDSWSV-----SATTGDFTCELPFQITPSKIRIYNSPD 301
            +YS   ++G LD  + ICP  + DSW V         G+   ++  +I PSKIRIYNS  
Sbjct: 255  RYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKK 314

Query: 302  KDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVA 361
              +++ LFR +T P+ SIMN+TY+DP +G + +CDA+CPL  ++ L S+   +  A+   
Sbjct: 315  NGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVAR 374

Query: 362  IINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGXXX 421
            ++N+    I+WTP+YQEFA ++ +    ++F AL SYGNN+GL G +++Q  + A+    
Sbjct: 375  LVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAY---- 430

Query: 422  XXXXXXXXXXXXXXXXXXXXXLSP-----NNW---TSVGEYLTVGYTPNENPVPKVTYKI 473
                                 LSP     N W    +   YL+     +    P V  K 
Sbjct: 431  -------VNSTLNQPNCGEQQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKP 480

Query: 474  DIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLY 533
             I HSG Y++N++TPGC  D TC  RGIVN TL  +     L T  IYQNN  +KYD LY
Sbjct: 481  VIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPLY 539

Query: 534  SGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISM----DLSHRTEVSKLALNGLF 589
            +G L+ +  + M + S + ++     +VADRV   I S+    D+ H  E S   LNGLF
Sbjct: 540  TGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS---LNGLF 596

Query: 590  QYQISNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSIN-L 648
            QY  +  + D+   K     +N+    +    VSL         IL   + G++  +   
Sbjct: 597  QYTPAGSSLDNGIQKY----INKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPK 652

Query: 649  NTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS------LFKDNFKNLNTTMD-G 701
             TD +  + TR     +     PYS GLV   G+ N+S      L  D   N  +  D  
Sbjct: 653  GTDWNDVDVTRQDVPGSLNGISPYSKGLV-FTGKFNLSSGPSSALHYDG--NFGSFFDLN 709

Query: 702  SLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGK 761
            S  + + N+T++G ELL+FNN +IYN ++ Q     SS+F L+  SA ANS ND +F G 
Sbjct: 710  SETSSIINMTIDGSELLLFNNKFIYNTSTSQML--TSSMFQLSALSAAANSNNDLLFTGS 767

Query: 762  VVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYIT 821
            +   ++  A+ +  ++A+ N         S     RG++LND +T Y Y   + +    T
Sbjct: 768  IADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVAT 827

Query: 822  ----------NSNSTSGLEWYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXV 871
                      N N ++ +    E   ++Y K    L++                      
Sbjct: 828  GGVVIETPGNNFNLSNNIATVRE---MIYVKKTNFLVISTNEVEGTPGALILYDLRTLQE 884

Query: 872  IKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSG 931
            +  E LN G  I+S++ F +++TLLV G FE     C DLCLYN+    W + A+  +SG
Sbjct: 885  VAREKLNPGERINSIVLFGEDNTLLVGGSFEKD--GCHDLCLYNFVKRSWSAFASGLISG 942

Query: 932  SVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVN---LHSMIV 988
             +  LQ   N  ++ +G++T+   +  N+ F+N   + V S ++++    N    +S++ 
Sbjct: 943  EIKQLQFVNNRNLIAVGSMTV--QSRPNILFLNF--DLVRSRVVEQHEQPNGRAFNSVLT 998

Query: 989  ---SNSRIVAWNDTVLFSFDGNSWTRVS-VPGTDSSATSISSVQFISMEGT-------DD 1037
               S    VA +   ++ + G+ W  V+ + G       IS +   +           ++
Sbjct: 999  IGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNE 1058

Query: 1038 ALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDG--------PRQGTGHLFMNRDISLH 1089
             +++ G+   SE+G+I ++ YNF +W PY   +          PR   G +F+N+DIS  
Sbjct: 1059 LVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPR---GQIFLNQDISRQ 1115

Query: 1090 NIAQIPLLNSTRVLTNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLA 1149
                +PL     V+ + S                       ++P R++  +G+VVLI L 
Sbjct: 1116 TTTSLPL----EVVVSDSPPT--------------------AEPKRKLA-KGYVVLIALG 1150

Query: 1150 LALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
            LALAT++++G+ GV+LAY F D+  ++YQ L PR++E+ M+ T+PPEKL
Sbjct: 1151 LALATIALLGIIGVILAYAFGDH--NAYQPLKPRINEDEMLKTVPPEKL 1197

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  522 bits (1344), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 385/1235 (31%), Positives = 605/1235 (48%), Gaps = 69/1235 (5%)

Query: 2    WCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDV-GNKNNQFQILDDINGISFYE 60
            W +  + +     +   ++L  +   L      VP+ D+ G+ N + Q+L +   +++Y 
Sbjct: 6    WLATSFLV--VAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYR 63

Query: 61   YLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQ--IQGIIPLGDDSFILSGQGM 118
            Y GQ NFT  ++    + LIY+SN T + LS    +     +  +IPL DDSFILSG G 
Sbjct: 64   YTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGA 123

Query: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF----MXXXXXXXXXXAIM 174
            I+   L  Q+VFN++DLS T IF+  L  +  +TV+G   YF                I+
Sbjct: 124  ISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIV 183

Query: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLL---LQSNVSEES 231
            WD     +  LPF G G  +N+NSIL L+D+NILFAG+FST+   S L   L  N + +S
Sbjct: 184  WDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDS 243

Query: 232  VRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDS-WSVSATTGDFTCELPFQIT 290
                    L+  +PL+ ++W ++G L    L+CP  S  S W  + TTG F   +   I 
Sbjct: 244  APE-----LSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIR 298

Query: 291  PSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQ 350
            PSK+R++N+   D +VSLFR +T P+  IMNLTYLDP SG + +CDA+CPL S   L + 
Sbjct: 299  PSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAA 358

Query: 351  WDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIY 410
                A  + V  +NN +T +QW+ +YQ+FA V+ V  TS+ F AL SYG+++G+ GF++Y
Sbjct: 359  KSKAASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELY 417

Query: 411  QASFSAFGXXXXXXXXXXXXXXXXXXXXXXXXLSPNNWT--SVGEYLTVGYTPNENPVPK 468
            +  FS +                         LS + W   S  E        N    P 
Sbjct: 418  EDDFSVYANDSFNVPDCSSTSNYSKAS-----LSASQWDQGSSDEDYVYTLVENSQEAPS 472

Query: 469  VTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIK 528
            VT+   I +SG Y+INV TPGC AD +C +R +VN +L+D+    +L++  IYQNND  K
Sbjct: 473  VTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEK 532

Query: 529  YDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLA-LNG 587
            YD LYSG L +  ++ + Y   +  +     +VA ++ +N    D S  T+  K   LNG
Sbjct: 533  YDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNG 592

Query: 588  LFQYQISNFTNDSIPMKIAN-TSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSI 646
            L  Y +SN ++     K  N T L Q++++NF  + +       N  I+L  + G +  +
Sbjct: 593  LLHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNY-IMLFASSGKVSKL 651

Query: 647  NLNTDLSVQNSTRLISTENFTTFQPYSNGLVML---DGQGNVSLFKDNFKNLNTTMDGSL 703
             ++    V+  T     +  +    +S GL ++   DG    + F  N    +  +  S 
Sbjct: 652  EIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKFY-NGSFFDIPLSHSN 710

Query: 704  ATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVV 763
             T   N TL+G EL+   N Y  N T+    R NSS   LT  SAG N++ +T+F G + 
Sbjct: 711  VTTFTNFTLDGAELVSLGNYYAINTTTDTLFR-NSSKMTLTARSAGLNNLGETVFYGSLT 769

Query: 764  QWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGY-FYKESNKSKLYITN 822
            + +Y   N S  ++++      ++      +     ++++ +TGY FY  S+ +  Y  +
Sbjct: 770  RNEYTDLNGSFFISSNSQS-SSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVS 828

Query: 823  SNSTSGLE------WYGEPETVVYDKNDTLLMVGYYXXXXXXXXXXXXXXXXXXVIK-EE 875
                   E      W     +++Y KN +LL +G                        E 
Sbjct: 829  IYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEW 888

Query: 876  NLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAA 935
              NV  SI+SL++F +N ++LV GDF  S  NCS LCL++Y+   W    +N ++GS+ +
Sbjct: 889  KTNV--SINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHS 946

Query: 936  LQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVA 995
            ++++   ++++ G   +     VN+A ++L++     L    +  ++   +      +VA
Sbjct: 947  MKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVA 1006

Query: 996  WNDTVLFSFDGNSWTRVSVPGTDSSATSISSV-------QFISMEGTDDALLLLGEFRHS 1048
             +   LF    N+W  +S    DSS     S        Q    E   ++LL+ G+  H 
Sbjct: 1007 VSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHK 1066

Query: 1049 EFGDIKSIVYNFRDWIPYL-----LYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVL 1103
             +G I + +Y+F DWIPY         DG   G   ++ N+DIS          N   VL
Sbjct: 1067 TYGKISAALYDFNDWIPYFSTTPATSTDG--LGQSRIYSNKDIS-------SAFNYQGVL 1117

Query: 1104 TNQSFAXXXXXXXXXXXXXXXXXXXXHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGV 1163
             +                         +K  +  + RGFVVLIGLALA+ T++VMGV G+
Sbjct: 1118 QSSRGGNSSSVPSGTSSPTSSSPSQLGAKKNK--IARGFVVLIGLALAMGTLAVMGVIGI 1175

Query: 1164 LLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198
             L + F  +  D YQ+L PR DE+ M++T+PPEKL
Sbjct: 1176 ALTFFFGKS-SDKYQSLEPRADESEMIDTVPPEKL 1209

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 19/85 (22%)

Query: 644 FSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMDGSL 703
           F+   N  +S +N    IS+E F            LD      L   +++ L TT+D S 
Sbjct: 106 FAKEKNKSISFKNLNEWISSETF-----------FLD------LISRSWRRLETTIDESS 148

Query: 704 ATDVANITLNGD--ELLVFNNGYIY 726
            TD  NI  NG     + FN G++Y
Sbjct: 149 TTDDTNIKTNGRLFHAMCFNEGFLY 173

>TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6.177
           YPL183C
          Length = 1004

 Score = 32.3 bits (72), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 638 GTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLF 688
           G E   FS+N   +LS+++  ++   E F  FQP+  GL+     G + +F
Sbjct: 310 GNELQSFSLN---ELSIKHGIKMEKGEMFKGFQPFKFGLIAATSLGKILMF 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,915,760
Number of extensions: 5726740
Number of successful extensions: 18311
Number of sequences better than 10.0: 118
Number of HSP's gapped: 18570
Number of HSP's successfully gapped: 132
Length of query: 1202
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1081
Effective length of database: 39,606,813
Effective search space: 42814964853
Effective search space used: 42814964853
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)