Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0G019908.254ON66766732020.0
NDAI0B023708.254ON72266424620.0
KAFR0B026808.254ON66465024460.0
Smik_12.1428.254ON66364924300.0
NCAS0B049708.254ON66665124210.0
YLR083C (EMP70)8.254ON66766924080.0
Suva_10.1678.254ON68467723970.0
Skud_12.1518.254ON66466023660.0
Suva_2.2678.254ON67266723100.0
YDR107C (TMN2)8.254ON67267022840.0
Smik_4.3538.254ON69066722670.0
ZYRO0C01848g8.254ON64767022490.0
Skud_4.3688.254ON67266622450.0
Kpol_543.358.254ON65865322360.0
TBLA0E043708.254ON67665921460.0
CAGL0B01683g8.254ON69167521130.0
KLLA0F18931g8.254ON66565120960.0
SAKL0H17248g8.254ON66064920890.0
KLTH0G13882g8.254ON68768520880.0
TPHA0A018408.254ON68567420710.0
Kwal_56.235778.254ON68366920310.0
NCAS0B038908.254ON66366020230.0
TBLA0H014508.254ON67365420000.0
TDEL0F038108.254ON65666519770.0
AGR097W8.254ON65365218330.0
NDAI0J014208.254ON61962117850.0
Ecym_43178.254ON60565714830.0
YER113C (TMN3)7.411ON7066523421e-32
NDAI0A015107.411ON6796373402e-32
Skud_5.2667.411ON7077253341e-31
Smik_5.2587.411ON7066543322e-31
TDEL0C027107.411ON6786353312e-31
SAKL0F12914g7.411ON7077343277e-31
NCAS0A145207.411ON6706333214e-30
ZYRO0B03784g7.411ON6586293171e-29
Suva_5.2347.411ON7067193101e-28
KLLA0E20835g7.411ON6766293082e-28
CAGL0G03487g7.411ON7046512983e-27
KNAG0C034307.411ON6802462377e-20
KAFR0K019507.411ON6642262111e-16
Kwal_27.107467.411ON6902251682e-11
KLTH0C06226g7.411ON6943061582e-10
TBLA0I003307.411ON7134661441e-08
TPHA0K007307.411ON7334951351e-07
AGL295C7.411ON6572061342e-07
Ecym_71437.411ON6762241128e-05
Kpol_1045.287.411ON6817041092e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0G01990
         (667 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...  1238   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   952   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   946   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   940   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   937   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   932   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   927   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   915   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   894   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   884   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   877   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   870   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   869   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   865   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   831   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   818   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   811   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   809   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   808   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   802   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   786   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    783   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   775   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   766   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   710   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   692   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   575   0.0  
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   136   1e-32
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   135   2e-32
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   133   1e-31
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   132   2e-31
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   132   2e-31
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   130   7e-31
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   128   4e-30
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   126   1e-29
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   124   1e-28
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   123   2e-28
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   119   3e-27
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    96   7e-20
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    86   1e-16
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    69   2e-11
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    65   2e-10
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    60   1e-08
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    57   1e-07
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    56   2e-07
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    48   8e-05
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    47   2e-04

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/667 (91%), Positives = 609/667 (91%)

Query: 1   MISHTVHLGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGEN 60
           MISHTVHLGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGEN
Sbjct: 1   MISHTVHLGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGEN 60

Query: 61  MKGDKXXXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVP 120
           MKGDK             FHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVP
Sbjct: 61  MKGDKSRYLYSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVP 120

Query: 121 LCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQ 180
           LCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQ
Sbjct: 121 LCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQ 180

Query: 181 AVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVG 240
           AVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVG
Sbjct: 181 AVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVG 240

Query: 241 VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD 300
           VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD
Sbjct: 241 VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD 300

Query: 301 PTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF 360
           PTIQW                  HMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF
Sbjct: 301 PTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF 360

Query: 361 RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY 420
           RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY
Sbjct: 361 RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY 420

Query: 421 TSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLL 480
           TSMGVYKFFRGPYWKANMI            SIVGLNMFLLGAHSSGTIPAKTLFFIVLL
Sbjct: 421 TSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLL 480

Query: 481 WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI 540
           WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI
Sbjct: 481 WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI 540

Query: 541 AVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIV 600
           AVELYFIYTSLWYNKIFYMFGFLFVSF               YHSLSLENWQWQWRSFIV
Sbjct: 541 AVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIV 600

Query: 601 GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI 660
           GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI
Sbjct: 601 GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI 660

Query: 661 YSSIKVE 667
           YSSIKVE
Sbjct: 661 YSSIKVE 667

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/664 (70%), Positives = 523/664 (78%), Gaps = 6/664 (0%)

Query: 10  LALLWA--CGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXX 67
           L LL+A       AFYLPGVAPTTY  +DEIPLLVNHL+PSMY+QH+ EDG+ MK DK  
Sbjct: 59  LVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKER 118

Query: 68  XXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIP 127
                      FHFCQPE I K+PESLGSIIFGDRIYNSP+QI ML++KTCV LC T IP
Sbjct: 119 FLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIP 178

Query: 128 GKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA---Q 184
           GKDA+FINKLIKNGFFQNWLIDGLPAAR V+D  T ++FYG GFELG V+VVQ       
Sbjct: 179 GKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDN 238

Query: 185 AKTHPKEDDSGSA-KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTV 243
           A T  K+  +    +L TRDAKNVQMLKN ELPYFANH DI VEYHDRGE N RVVGV V
Sbjct: 239 ANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIV 298

Query: 244 DPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTI 303
           +P+SIKRS+PGTC+TSG PLML E  DN+VYFTYSV+F+ S+T+WATRWDKYLH YDP I
Sbjct: 299 NPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAI 358

Query: 304 QWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIP 363
           QW                  H LLKAL+SDFARYNELNLD++FQE++GWKL HGDVFRIP
Sbjct: 359 QWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIP 418

Query: 364 SKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSM 423
            +S+LLS+LVGSG+QLFLMI  SIFFAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM
Sbjct: 419 HRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 478

Query: 424 GVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFV 483
           GVYKFF GPYWK NM+             IV LN+FLL  HSSG IPA TLFF++LLWFV
Sbjct: 479 GVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFV 538

Query: 484 ISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVE 543
            S+P ALAGSLIAHKKC+WDEHPTKTNQ+ARQ+PFQPWYLKT  AT IAGIFPFGSIAVE
Sbjct: 539 FSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVE 598

Query: 544 LYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGV 603
           LYFIY+SLW+NKIFYMFGFL  SF               YHSL LENW WQWR FI+GGV
Sbjct: 599 LYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGV 658

Query: 604 GCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSS 663
           GCAIY+F+HSILFTK KLGGF TIVLYVGYS +ISLL C+VTG+IGFLSSMFF+R+IYSS
Sbjct: 659 GCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSS 718

Query: 664 IKVE 667
           IKVE
Sbjct: 719 IKVE 722

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/650 (70%), Positives = 522/650 (80%), Gaps = 3/650 (0%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
            AFYLPGVAPTTY   DEIPLLVNHLSPSMYWQH+ ++G+++  DK             F
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFCQPEKI K+PESLGSI+FGDRIYNSP+Q+ MLEEK C  LC + IPG DA+FINKLIK
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV--AQAKTHPKEDDSGSA 197
           NGFFQNWLIDGLPAA   HD  T +DFYG+GFELG V+VVQAV   +A+T     + G A
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG-A 194

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ 257
           +L  RDAKNV+ +KNVEL YF NH+DI +EYHDRG G+ RVVGV V+P+SI+RSSPG+C+
Sbjct: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254

Query: 258 TSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXXX 317
           ++G PL L E  DN+VYFTYSV FV S+T WATRWDKYLH YDPTIQW            
Sbjct: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLL 314

Query: 318 XXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGI 377
                 H LLKAL++DFARYNE NLD+EFQED+GWKL HGDVFRIP KSMLLS+LVGSG+
Sbjct: 315 LSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGV 374

Query: 378 QLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 437
           QLF+MIS +IFFAALGFLSPSSRG LGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN
Sbjct: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434

Query: 438 MIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAH 497
           M+            +I+ +N FL+  HSSG IPAKTLFF+VLLWFV S+PSA AGSL+A+
Sbjct: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494

Query: 498 KKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIF 557
           KKC+W+EHPTKT Q+ARQ+PFQPWYLKT+ ATFIAGIFPFGSIAVE+YFIYTSLWYNKIF
Sbjct: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554

Query: 558 YMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFT 617
           YMFGFLFVS                YHSL LENW WQWRSFIVGGVGCAIY+F+HSILFT
Sbjct: 555 YMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614

Query: 618 KLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           K KLGGF T+VLY+GYS++ISLLCC+VTGSIGFLSSMFFVR+I+SSIKV+
Sbjct: 615 KFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/649 (69%), Positives = 512/649 (78%), Gaps = 3/649 (0%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
            AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QH+ E+G N+ GDK             F
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PEK+ K+PESLGSIIFGDRIYNSP+Q+KMLEEK CV LC   IPG DA+FINKLIK
Sbjct: 77  HFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIK 136

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA-QAKTHPKEDDSGSAK 198
           NGFFQNWLIDGLPAAR V DK T + FYG GFELG VEV Q  A +A  +  E  +   +
Sbjct: 137 NGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVE 196

Query: 199 LSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQT 258
           L TRD  N  M++  E PYF NH+DI +EYHDRGEGN RVVGV V+P+SIKRS P TC+T
Sbjct: 197 LDTRDGHN--MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCET 254

Query: 259 SGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXXXX 318
            G PLMLDE+NDNEVYFTYSV+FV S+T WATRWDKYLH YDP+IQW             
Sbjct: 255 DGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVLL 314

Query: 319 XXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQ 378
                H LL+AL+SDFARYNELNLD++FQEDSGWKL+HGDVFR PS+S+ LSILVGSG+Q
Sbjct: 315 SSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQ 374

Query: 379 LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 438
           LF M++ SIFFAALGFLSPSSRGSL TVMFMLYALFGFVGSYTSMG+YKFF GPYWKAN+
Sbjct: 375 LFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANL 434

Query: 439 IXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK 498
           I             I+ LN FL+  HSSG IPA TLFF+V LWF+ S+P + AGSL+A K
Sbjct: 435 ILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK 494

Query: 499 KCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFY 558
           KC WDEHPTKTNQ+ARQ+PFQPWYLKTV AT IAG+FPFGSIAVELYFIYTSLW+NKIFY
Sbjct: 495 KCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFY 554

Query: 559 MFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTK 618
           MFGFLF SF               YHSL LENW+WQWR FIVGG GCA+Y+F+HSILFTK
Sbjct: 555 MFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTK 614

Query: 619 LKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
            KLGGF TIVLYVGYS+VISLLCCLVTGSIGF+SSMFF+R+IYSSIKV+
Sbjct: 615 FKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/651 (69%), Positives = 519/651 (79%), Gaps = 5/651 (0%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
            AFYLPGVAPTTY   DEIPLLVNHL+PS+Y+Q    +G++   +K              
Sbjct: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDRL 75

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PE I K+PESLGSIIFGDRIYNSP+++KMLEEKTCV LC + IPGKDA+FINKLIK
Sbjct: 76  HFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIK 135

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV---AQAKTHPKEDDSGS 196
           NGFFQNWLIDGLPAA  V+D+ T S+FYG GFELG VE  QA+   A A T PK+  +  
Sbjct: 136 NGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEG 195

Query: 197 AKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTC 256
            +L TR+AKNVQM+KN+E+ YF NH+DI VEYHDRGEG  RVVGV V+P+SIKRS+PGTC
Sbjct: 196 LELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTC 255

Query: 257 QTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXX 316
           +T+GDPL+L E  DN+VYFTYSV+FV S+TVWATRWDKYLHTYDPTIQW           
Sbjct: 256 ETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVL 315

Query: 317 XXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSG 376
                  H L+KAL+SDFARYNE NL+++FQED+GWKL HGDVFRIP KSMLLS+LVGSG
Sbjct: 316 LLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSG 375

Query: 377 IQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 436
           +QLFLMIS SIFFAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM VYKFF+GPYWK 
Sbjct: 376 VQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKV 435

Query: 437 NMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIA 496
           NM+            +IVGLN FL+ AHSSG +PA TLFF++LLWF+ S+P A AGSLIA
Sbjct: 436 NMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIA 495

Query: 497 HKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKI 556
           HKKC+WDEHPTKTNQ+ARQ+PFQPWYLKT  AT IAGIFPFGSIAVELYFIYTSLW+NKI
Sbjct: 496 HKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKI 555

Query: 557 FYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILF 616
           FYMFGFL  SF               YHSL LENWQWQWR FIVGGVGCAIY+FVHSILF
Sbjct: 556 FYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILF 615

Query: 617 TKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           TK KLGGF TIVLYVGYS +ISLL C+VTG+IGFLSS+ FVR+IYS+IKV+
Sbjct: 616 TKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/669 (67%), Positives = 516/669 (77%), Gaps = 4/669 (0%)

Query: 1   MISHTVHLGLALLWA-CGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGE 59
           MI    H+ L LL+     V AFYLPGVAPTTY+ ND IPLLVNHL+PSM +QH+ EDG 
Sbjct: 1   MIYKMAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGN 60

Query: 60  NMKGDKXXXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCV 119
           N+ GDK             FHFCQPEK+ K+PESLGS+IFGDRIYNSP+Q+ ML+EK C 
Sbjct: 61  NVSGDKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECE 120

Query: 120 PLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVV 179
            LC T+IPG DA+FINKLIKNGFFQNWLIDGLPAAR V+D  T + FYG GF LG V+V 
Sbjct: 121 SLCKTVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVT 180

Query: 180 QAV-AQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRV 238
           Q    +A     E      +L TR+ +N  M+K  ELPYFANH DI +EYHDRGEGN RV
Sbjct: 181 QGTDIEATPKGAETTDKDVELETRNDRN--MVKTYELPYFANHFDIMIEYHDRGEGNYRV 238

Query: 239 VGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHT 298
           VGV V+P+SIKRSSPGTC+T+G PLMLDE NDNEVYFTYSV+F  S T WATRWDKYLH 
Sbjct: 239 VGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHV 298

Query: 299 YDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGD 358
           YDP+IQW                  H LL+AL+SDFARYNELNLD++FQEDSGWKL HGD
Sbjct: 299 YDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGD 358

Query: 359 VFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVG 418
           VFR PS+S+ LSILVGSG+QLFLM++ SIFFAALGFLSPSSRGSL TVMF+LYALFGFVG
Sbjct: 359 VFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 418

Query: 419 SYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIV 478
           SYTSMG+YKFF GPYWKAN+I             I+ LN FL+  HSSG IPA TLFF+V
Sbjct: 419 SYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMV 478

Query: 479 LLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFG 538
            LWF+ S+P + AGSLIA K+C WDEHPTKTNQ+ARQ+PFQPWYLKT+ AT IAGIFPFG
Sbjct: 479 FLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFG 538

Query: 539 SIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSF 598
           SIAVELYFIYTSLW+NKIFYMFGFLF SF               YHSL LENW+WQWR F
Sbjct: 539 SIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGF 598

Query: 599 IVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVR 658
           I+GG GCA+Y+F+HSILFTK KLGGF TIVLYVGYS+VISLLCCLVTGSIGF+SSM FVR
Sbjct: 599 IIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVR 658

Query: 659 RIYSSIKVE 667
           +IYSSIKV+
Sbjct: 659 KIYSSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/677 (66%), Positives = 517/677 (76%), Gaps = 22/677 (3%)

Query: 12  LLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXX 71
           L +      AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QH+ EDG N+ GDK      
Sbjct: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYS 68

Query: 72  XXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDA 131
                  FHFC+PE + K+PESLGSIIFGDRIYNSP+++ ML+EK CV LC T+IPG DA
Sbjct: 69  YDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128

Query: 132 EFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV--------- 182
           +FINKLIKNGFFQNWLIDGLPAAR VHD  T +DFYG GF LG VEV Q V         
Sbjct: 129 KFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188

Query: 183 ----------AQAKTHPKEDDSGSA--KLSTRDAKNVQMLKNVELPYFANHHDITVEYHD 230
                     A  KT P++  S +   +L  RD +   M+K  E PYFANH DI +EYHD
Sbjct: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARD-QGKNMVKTREFPYFANHFDIKIEYHD 247

Query: 231 RGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWAT 290
           RGEGN RVVGV V+P+SIKRSSPGTC+T+G PL+LDE NDNEVYFTYSV+F  S T WAT
Sbjct: 248 RGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWAT 307

Query: 291 RWDKYLHTYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDS 350
           RWDKYLH YDP+IQW                  H LL+AL+SDFARYNELNLD++FQEDS
Sbjct: 308 RWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDS 367

Query: 351 GWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFML 410
           GWKL HGDVFR PS+S++LSILVGSG+Q+FLM++ SIFFAALGFLSPSSRGSL TVMF+L
Sbjct: 368 GWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFIL 427

Query: 411 YALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIP 470
           YALFGFVGSYTSMG+YKFF GPYWKAN+I             I+ LN FL+  HSSG IP
Sbjct: 428 YALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIP 487

Query: 471 AKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATF 530
           A TLFF+V LWF+ S+P + AGSL+A KKC WDEHPTKTNQ+ARQ+PFQPWYLKT+ AT 
Sbjct: 488 ASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATL 547

Query: 531 IAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLEN 590
           IAGIFPFGSIAVELYFIYTSLW+NKIFYMFGFLF SF               YHSL LEN
Sbjct: 548 IAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLEN 607

Query: 591 WQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGF 650
           W+WQWR F VGGVGCA+Y+F+HSILFTK KLGGF TIVLY+GYS+VISLLCCLVTGSIGF
Sbjct: 608 WKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGF 667

Query: 651 LSSMFFVRRIYSSIKVE 667
           +SSMFF+R+IYSSIKV+
Sbjct: 668 ISSMFFIRKIYSSIKVD 684

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/660 (67%), Positives = 516/660 (78%), Gaps = 4/660 (0%)

Query: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXX 69
           L L +      AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QHE E G ++ GDK    
Sbjct: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66

Query: 70  XXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129
                    FHFC+P+ + K+PESLGS+IFGDRIYNSP+++ ML+EK CVPLCNT IPG 
Sbjct: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126

Query: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189
           DA+FINKLIKNGFFQNWLIDGLPAAR V+D  T ++FYG GFELG VEV Q   ++KT P
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQG-TRSKTAP 185

Query: 190 KEDDSGSA--KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPIS 247
           K+ ++ +   +L TR A++  +++  E PYFANH DI +EYHDRG G+ RVVGV V+P+S
Sbjct: 186 KQAETTNEGLELGTR-AEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLS 244

Query: 248 IKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXX 307
           IKRS  GTC+T   PL+LDE+ DNEV FTYSV+F  S T WATRWDKYLH YDP+IQW  
Sbjct: 245 IKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFS 304

Query: 308 XXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSM 367
                           H LL+AL+SDFARYNELNL+++FQEDSGWKL HGDVFR PS S+
Sbjct: 305 LINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSL 364

Query: 368 LLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYK 427
           LLSILVGSG+QLFLM++ SIFFAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 365 LLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYK 424

Query: 428 FFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVP 487
           FF GPYWKAN++             IV LN FL+  HSSG IPA+TLFF+V LWF+ S+P
Sbjct: 425 FFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIP 484

Query: 488 SALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFI 547
            +  GSLIA KKC WDEHPTKTNQ+ARQ+PFQPWYLKT+ AT IAGIFPFGSIAVELYFI
Sbjct: 485 LSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFI 544

Query: 548 YTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAI 607
           YTSLW+NKIFYMFGFLF SF               YHSL LENW+WQWR FIVGGVGCA+
Sbjct: 545 YTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCAL 604

Query: 608 YMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           Y+F+HSILFTK KLGGFVTIVLYVGYS VISLLCCLVTGSIGF+SSMFF+RRIYSSIKV+
Sbjct: 605 YVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/667 (64%), Positives = 508/667 (76%), Gaps = 10/667 (1%)

Query: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXX 69
           LAL        AF LPGV+PTTY+ANDEIPLLVN L+PS+Y+QH+ E+G+++  DK    
Sbjct: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66

Query: 70  XXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129
                    FHFC+PE + K+PESLGS+IFGDRIYNSP+Q+KMLE+K CV LC + IPGK
Sbjct: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126

Query: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189
           DA+FIN LIKNGFFQNWL+DGLPAAR V+D  T +++YG GFELG  +V Q V   KT P
Sbjct: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG-GKTIP 185

Query: 190 K-------EDDSGSAKLSTRDAKNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLRVVG 240
                   ED    A L  RD KN++  +++ +EL +F NH +I VEYHDRG GN RVVG
Sbjct: 186 STMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVG 245

Query: 241 VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD 300
           VTV+P+SI+RSSPG C T+G+PL L E  DN+VYFTYSV+F+ASDTVWATRWDKYLH YD
Sbjct: 246 VTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYD 305

Query: 301 PTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF 360
           P IQW                  H +L+A+RSDFARYNELNLDNEF ED+GWKL HGDVF
Sbjct: 306 PQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVF 365

Query: 361 RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY 420
           RIP KSM+LS+LVGSGIQLFLMI  SIFFAALG +SP+SRGSL TVMF+LYALFGFVGSY
Sbjct: 366 RIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSY 425

Query: 421 TSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLL 480
           TSMGVYKFF GPYWKAN+I             IV +N FLL AHSSG IPA+TLFFI+ L
Sbjct: 426 TSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFL 485

Query: 481 WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI 540
           WF +S+P + AGS IAHK+C WDEHPTKTNQ+ARQ P QPWYL+T+ AT IAGIF FGSI
Sbjct: 486 WFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSI 545

Query: 541 AVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIV 600
           AVELYFIY+SLW+NKIFYMFGFL  SF               YHSL LENW WQWRSFI+
Sbjct: 546 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFII 605

Query: 601 GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI 660
           GG+GC++YMF+H+ILFTK KLGGFVT+VLYVGYS +IS LCC+VTG+IGF SSM F+R+I
Sbjct: 606 GGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKI 665

Query: 661 YSSIKVE 667
           YS IKVE
Sbjct: 666 YSRIKVE 672

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/670 (64%), Positives = 507/670 (75%), Gaps = 12/670 (1%)

Query: 9   GLALLWAC--GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKX 66
           G+ LL  C       F LPG++PTTY + DEIPLLVN L+PS+Y+QH+ E+G ++ GDK 
Sbjct: 4   GVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKE 63

Query: 67  XXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTII 126
                       FHFC+PE + K+PESLGS+IFGDRIYNSP+Q+ MLEEK CV LC + I
Sbjct: 64  HFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTI 123

Query: 127 PGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAK 186
           PGKDA+FIN LIK+GFFQNWL+DGLPAAR  +D  T +++YG GFELG  +V Q V   K
Sbjct: 124 PGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTV-DGK 182

Query: 187 THPKEDDSGSAKLSTRDA-------KNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLR 237
             P   +  +++ S  D        KNV+  ++K VELPYF NH DI VE+HDRG  N R
Sbjct: 183 AVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYR 242

Query: 238 VVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLH 297
           VVGV V+P+SI+RSSPG C T+G PL+LDE  DNEVYFTYSV+FVASDTVWATRWDKYLH
Sbjct: 243 VVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLH 302

Query: 298 TYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHG 357
            YDP IQW                  H LL+AL+SD ARYNELNLDNEF EDSGWKL HG
Sbjct: 303 IYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHG 362

Query: 358 DVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFV 417
           DVFR PSKSMLLSILVGSG+QLFLM+  SIFFAA+G +SP SRGSL TVMF+LYALFGFV
Sbjct: 363 DVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFV 422

Query: 418 GSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFI 477
           GSY SMGVYKFFRGPYWKANMI             IV +N FLL AHSSG IPA++LFFI
Sbjct: 423 GSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFI 482

Query: 478 VLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPF 537
           +LLWF++SVP + AGS++AHK+C+WDEHPTKTNQ+ARQ+P+QPWYL+T  AT IAGIF F
Sbjct: 483 ILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSF 542

Query: 538 GSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRS 597
           GSIAVELYFIY+SLW+NKIFYMFGFL  SF               Y+SL LENW WQWRS
Sbjct: 543 GSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRS 602

Query: 598 FIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFV 657
           FI+GG+GC+IY F+HSILFTK KLGG +T+VLY+GYS +IS LCC+VTG+IGF SSMFF+
Sbjct: 603 FIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFI 662

Query: 658 RRIYSSIKVE 667
           R+IYS+IKVE
Sbjct: 663 RKIYSAIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/667 (63%), Positives = 501/667 (75%), Gaps = 10/667 (1%)

Query: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXX 69
           L L +  G   AF LPG++PTTY  NDEIPLLVN L+PS+Y+QH+ E+G+++  DK    
Sbjct: 25  LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL 84

Query: 70  XXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129
                    FHFC+PE + ++PESLGSIIFGDRIYNSP+Q++MLE K CV LC   IPGK
Sbjct: 85  YSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGK 144

Query: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189
           DA+FINKLIK+GFFQNWL+DGLPAAR V D  T +++YG GFELG +  V+     K  P
Sbjct: 145 DAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELG-ITAVKNTIDGKVIP 203

Query: 190 K-------EDDSGSAKLSTRDAKNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLRVVG 240
                   E  +  A L  R+ KN++  ++K VELPYF NH DI VE+HDRG+ N RVVG
Sbjct: 204 STMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVG 263

Query: 241 VTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYD 300
           VTV+P+SI+RSSP +C  +  PL+LDE+ DNE+YFTYSV+FVASDTVWATRWDKYLH YD
Sbjct: 264 VTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYD 323

Query: 301 PTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVF 360
           P IQW                  H LL+AL SD +RYNELNLDNEF EDSGWKL HGDVF
Sbjct: 324 PQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVF 383

Query: 361 RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSY 420
           R P+KSMLLS+LVGSG+QLFLMI  SIF AALG +SP SRGSL TVMF+ YALFGFVGSY
Sbjct: 384 RTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSY 443

Query: 421 TSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLL 480
           TSMGVYKFF GPYWKAN+I             IV +N FLL AHSSG IPA TLFFI+ L
Sbjct: 444 TSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFL 503

Query: 481 WFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSI 540
           WF +S+P + AGS+IAHK C+WDEHPTKTNQ+ARQVP+QPWYL+T+ AT IAGIF FGSI
Sbjct: 504 WFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSI 563

Query: 541 AVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIV 600
           AVELYFIY+SLW+NKIFYMFGFL  SF               YHSL LENWQWQWRSFI+
Sbjct: 564 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFII 623

Query: 601 GGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRI 660
           GG+GC++YMF+HSILFTK KLGGF+TIVLY GYS +IS LCC+VTG+IGF S M F+R+I
Sbjct: 624 GGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKI 683

Query: 661 YSSIKVE 667
           YS++K+E
Sbjct: 684 YSAVKIE 690

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/670 (62%), Positives = 502/670 (74%), Gaps = 26/670 (3%)

Query: 1   MISHTVHLGLALLWAC---GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETED 57
           M+SH      +LL+ C     V AFYLPGVAPTTY +NDEI LLVNHL+PSM +QHE ED
Sbjct: 1   MLSH------SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDED 54

Query: 58  GENMKGDKXXXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKT 117
           G  +KGDK             FHFC+PE +V++P SLGS+IFGDRI+NSP+++ MLEEK 
Sbjct: 55  GNMVKGDKEHYLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKE 114

Query: 118 CVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVE 177
           CVPLC++ IPG+DA+F+NKLIKNGF QNWLIDGLPA R +HD  TNS+FYG GF+LG V+
Sbjct: 115 CVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVD 174

Query: 178 VVQAVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLR 237
           V +  + +    K                 +++K +E+PY ANH+DI +EYHDRG  N R
Sbjct: 175 VTEGFSDSNDEEK-----------------KIMKTLEVPYLANHYDINIEYHDRGNDNYR 217

Query: 238 VVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLH 297
           VVGVTVDP+SIKRSS  +CQ +   L L E  +NEV+FTYSV+F+ SDTVWATRWDKYLH
Sbjct: 218 VVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLH 277

Query: 298 TYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHG 357
            YDPTIQW                  HMLL+AL++D +RYNE NLDNEF EDSGWKL+HG
Sbjct: 278 VYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHG 337

Query: 358 DVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFV 417
           DVFRIP +S+LLSILVGSG+QLFLMI+ SI FAALGFLSPSSRGSL TVMF+LYALFGFV
Sbjct: 338 DVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFV 397

Query: 418 GSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFI 477
           GSYTSM +YKFF+GP WK N++            +I+ LN FL+   SSG IPA TLF I
Sbjct: 398 GSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTI 457

Query: 478 VLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPF 537
           +LLWFV S+P + AGSLIAHK+C  D HPTKTNQ+ARQ+P QPWYLKT+  + IAG+FPF
Sbjct: 458 ILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPF 517

Query: 538 GSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRS 597
            SIAVELYFIYTSLW+NKIFYMFGFL  SF               YHSL LENW+WQWRS
Sbjct: 518 ASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRS 577

Query: 598 FIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFV 657
           FI+GG GCAIY+F+HSILFTK KLGGF T+VLY+GYS +IS+LCC+VTGSIGF+SSMFF+
Sbjct: 578 FIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFI 637

Query: 658 RRIYSSIKVE 667
           R+IYSS+KV+
Sbjct: 638 RKIYSSVKVD 647

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/666 (62%), Positives = 501/666 (75%), Gaps = 8/666 (1%)

Query: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXX 69
           LALL       AF LPG++PTTY +NDEIPLLVN L+PS+Y+QH+ E+G ++  DK    
Sbjct: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66

Query: 70  XXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129
                    FHFC+PE + K+PESLGS+IFGDRIYNSP+Q++MLEEK CV LC   IPG+
Sbjct: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126

Query: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQA---K 186
           DAEFIN+LI +GFFQNWL+DGLPAAR V+D  T +++YG GFELG  +V+Q V       
Sbjct: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186

Query: 187 THPKEDDSGS---AKLSTRDAKNVQM--LKNVELPYFANHHDITVEYHDRGEGNLRVVGV 241
           T  + D   S   A L  R  KN++   +K VELPYF NH +I VE+H+RG  + R+VGV
Sbjct: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246

Query: 242 TVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDP 301
           TV+P+SI+RSSPG+C  +  PL L E  DNEVYFTYSV+FVAS TVWATRWDKYLH YDP
Sbjct: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306

Query: 302 TIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFR 361
            IQW                  H LL+AL+SD  RYNELNL+NEF ED+GWKL+HGDVFR
Sbjct: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366

Query: 362 IPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYT 421
            P KSMLLS+LVGSGIQLFLMI  SIFFAA G +SP SRGSL TVMF+LYALFGFVGSYT
Sbjct: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426

Query: 422 SMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLW 481
           SMGVYKFF GPYWKAN+I             IV +N+FLL AHSSG IPAK+LFFI+ LW
Sbjct: 427 SMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486

Query: 482 FVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIA 541
           FV+S+P +  GS++AHK+CSW+EHPTKTNQ+ARQ+P QPWYL+T  AT +AGIF FGSIA
Sbjct: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546

Query: 542 VELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVG 601
           VELYFIY+SLW+NKIFYMFGFL  SF               YHSL LENW WQWRSFI+G
Sbjct: 547 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIG 606

Query: 602 GVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
           G+GC+IYMF+HSILFTK KLGGF+T+VLY+GYS ++S+LCC+VTG+IGF SSM F+R+IY
Sbjct: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666

Query: 662 SSIKVE 667
            ++KVE
Sbjct: 667 YAVKVE 672

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/653 (64%), Positives = 492/653 (75%), Gaps = 17/653 (2%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
           +AFYLPGVAPTTY   DEIPLLVNHL+PS+ +QH+ + G ++KG+K              
Sbjct: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PE + K+PESLGSI+FGDRIYNSP+ IKMLE + C  LC   IP  DA+FINKLIK
Sbjct: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKL 199
           NGFFQNWLIDGLPAAR +HD  T SDFYG GF LG+V V QAV             S+KL
Sbjct: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGL---------ASSKL 188

Query: 200 S----TRDAKNVQ-MLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPG 254
           +     R+AKNV  M+ NVE+P+  NH+DI VEYHDRGEGN RVVGVTVDP   K S+  
Sbjct: 189 NLENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGD 245

Query: 255 TCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXX 314
            C      L+L E  DNEV F+YSVRF+ S+TVWATRWDKYLH YDPTIQW         
Sbjct: 246 ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVV 305

Query: 315 XXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVG 374
                    H L++AL+SDFARY E NLD+ FQ+DSGWKL HGDVFRIP KSMLLSILVG
Sbjct: 306 VILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVG 365

Query: 375 SGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYW 434
           SG QLFLM++VSIFFAA+G LSPSSRGSL + MF+LYALFGF GSY SMGVYKFF GPYW
Sbjct: 366 SGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYW 425

Query: 435 KANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSL 494
           KANMI            SIVGLN FLL + SSGTIP   L F+++LWF+IS+P +LAGSL
Sbjct: 426 KANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSL 485

Query: 495 IAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYN 554
           IA+KKC+W EHPTKTN++ARQ+PFQPWYLKTV AT IAG+FPFGSIAVELYFIY+SLW+N
Sbjct: 486 IANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFN 545

Query: 555 KIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSI 614
           KIFYMFGFLFVSF               Y+SL+LENW+WQWRSFIVGGVGCA Y+FVHSI
Sbjct: 546 KIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSI 605

Query: 615 LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           +FTK KLGGF TIVLYVGYS +IS LC +VTG+IGF+SSM FV++IYSS+KV+
Sbjct: 606 IFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/659 (61%), Positives = 488/659 (74%), Gaps = 12/659 (1%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
           N FYLPGVAPTTY   D IPLLVNHL+PSM+++H+  DG  +  DK              
Sbjct: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78

Query: 80  HFCQP--EKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKL 137
           HFC+P   +I K+PESLGSI+FGDRIYNSP+++KML ++ C  LC+T IPG DA+FIN L
Sbjct: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138

Query: 138 IKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTH--PKE---D 192
           IK+GF QNWLIDGLPAAR ++D++T S FYG+GFELGSVE++Q V +A +H  PK+   +
Sbjct: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVE 198

Query: 193 DSGSAKL----STRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISI 248
           D  S +L    +T    N  ++ +VE  YFANH DI +EYHDRG    R+VGVTV+PIS+
Sbjct: 199 DVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISM 258

Query: 249 KRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXX 308
           KR S   C T+   L L E +D +V FTYSV F  SDTVWATRWDKYLH YDPTIQW   
Sbjct: 259 KRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFSL 317

Query: 309 XXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSML 368
                          H L KAL++DF RYNE NL++ F EDSGWKL HGDVFRIP+KSML
Sbjct: 318 INFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSML 377

Query: 369 LSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKF 428
           LSI VGSG QLF MIS  +  AALGFLSPS+RGSL T+MF+LYA+FGFVGSYTSMGVY+F
Sbjct: 378 LSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRF 437

Query: 429 FRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPS 488
           F GPYWKANMI             I+ +N+FL+  HSS  +P  TL  +VLLW V+S+P 
Sbjct: 438 FNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPL 497

Query: 489 ALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIY 548
           + AGSLI+ K+C+W +HPTKTN+V RQ+PFQPWYLKTV AT I GIFPFGSIAVELYFIY
Sbjct: 498 SFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIY 557

Query: 549 TSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIY 608
           +SLW+NKIFYMFGFL VSF               YHSL LENW+WQWRSFI+GG+GC+IY
Sbjct: 558 SSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSIY 617

Query: 609 MFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           +F+HSILFT+ KLGGF+TIVLYVGYSA+I++LC +VTG+IGF+S+MFFV++IYSSIKVE
Sbjct: 618 IFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/675 (58%), Positives = 475/675 (70%), Gaps = 28/675 (4%)

Query: 21  AFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXFH 80
            FYLPG AP TYK  D IPLLVNHL+PS+ +QH  +DG  +KGDK              H
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 81  FCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKN 140
           FCQPEKI K+PESLGS+IFG++IYNSP+ +KMLE+  CV LC+T IPGKDA+FINKLIKN
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 141 GFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV-------AQAKTHPKEDD 193
           GF QNWLIDGLPAAR +HD  TN++FYG GFELG VEV QAV       ++ +    E D
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 194 SGS------------------AKLSTRDAKNV--QMLKNVELPYFANHHDITVEYHDRGE 233
           + +                  + L  R+AKNV   ++ NVE+P FANH DI VEYHDRG 
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256

Query: 234 GNLRVVGVTVDPISIKRSSPGTCQTSGD-PLMLDEKNDNEVYFTYSVRFVASDTVWATRW 292
           G+ RVVGV V+P+S+      +C  +    L LDE  DNEV FTYSV+F  SDT WATRW
Sbjct: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316

Query: 293 DKYLHTYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGW 352
           DKYLH YDP IQW                  H LL+AL+SD +RYNE NL +EF+EDSGW
Sbjct: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376

Query: 353 KLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYA 412
           KL HGDVFR P  SMLLS+LVGSGIQLFLMI +SI  +ALG LSPSSRGSL T MFM YA
Sbjct: 377 KLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMFYA 436

Query: 413 LFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAK 472
           +FGFVGSYTSMG+YKFF+GPYWKANMI            +++ +N+ L    SS  IP  
Sbjct: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496

Query: 473 TLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIA 532
           TL F+V LW + S+P A AGSLI++KKC+WDEHPTKTN++ RQ+PFQPW+LKTV AT I 
Sbjct: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556

Query: 533 GIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQ 592
           G+  FGSIAVELYFIY+SLW+NKIFYMFGFL  S                Y +L  ENW 
Sbjct: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616

Query: 593 WQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLS 652
           WQWRSF +GG+GC+IY+F+HSILFT+ KLGGF TIVLYVGYS +IS L C+VTG+IGF+ 
Sbjct: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676

Query: 653 SMFFVRRIYSSIKVE 667
           SMFFVRRI++SIKV+
Sbjct: 677 SMFFVRRIFASIKVD 691

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/651 (59%), Positives = 474/651 (72%), Gaps = 7/651 (1%)

Query: 19  VNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXX 78
           V AFYLPGVAPTTY   D++PLLVNHL+PS +++H   D  +  GDK             
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYKK 78

Query: 79  FHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           FHFCQP ++ K+PESLGSIIFGDRIYNSP+++++L+   C  LC ++IPGKDA+FINKLI
Sbjct: 79  FHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLI 138

Query: 139 KNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAK 198
            NGFFQNW+IDGLPAAR + D  TN  FYGNGFELG V+V+    +  T    D+    +
Sbjct: 139 LNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDY-EPDTRSLHDE---LE 194

Query: 199 LSTRDAKNVQML--KNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTC 256
           L     KNV     K  E+PYF NH+DI +EYHDRGE N R+VGVTV+P SIKR SP +C
Sbjct: 195 LQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSC 254

Query: 257 QTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXX 316
           +++G  L+L E  DNEVYFTYSV+F+ SDTVWATRWDKYLH YDP IQW           
Sbjct: 255 ESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVV 314

Query: 317 XXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSG 376
                  H L  AL++D ARYNELNLD +F+E++GWKL HGDVFR P+K++LLS+LVGSG
Sbjct: 315 LLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSG 374

Query: 377 IQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 436
            QL LM++ +I FA LGFLSPSSRGSL TVMF+LYA+FG  GS+TSM  YKFF G  W+ 
Sbjct: 375 GQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRL 434

Query: 437 NMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIA 496
           N++             ++GLN FL+  HSSG IP +T+  +VLLWFVIS+P +  GS+IA
Sbjct: 435 NLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIA 494

Query: 497 HKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKI 556
            KKC+W+EHPTKTNQ+ARQ+PFQPWYLKT+    +AGIFPFGSIAVELYFIY+SLW+NKI
Sbjct: 495 WKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKI 554

Query: 557 FYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILF 616
           +YMFGFLF SF               YHSL +ENW+WQWRSF++GG GCA Y+F HSILF
Sbjct: 555 YYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILF 614

Query: 617 TKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           TK +LGG  TIVLY+GYS +IS LCCLVTG+IGFLSS+  VR+IYS +KV+
Sbjct: 615 TKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/649 (61%), Positives = 471/649 (72%), Gaps = 3/649 (0%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
           +AFYLPGVAPTTY   DEIPLLVNHL+PS Y+QH  ++G  M GDK             F
Sbjct: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PE ++K+PESLGSIIFGDRIYNSP+++ MLE KTCVPLC + IP  DA+FINKLI+
Sbjct: 74  HFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIR 133

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKL 199
           NGFF NWL+DGLPAAR +HD  TNS FYGNGFELG V+VV  +    T  K  +S   ++
Sbjct: 134 NGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTK-KVSESDYIEI 192

Query: 200 STRDAK-NVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQT 258
           +  D +   +  K  EL YF NH DI +EYHDRGE N RVVGV+V P SIKR S  +C T
Sbjct: 193 ADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDT 252

Query: 259 SGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXXXX 318
            G+PL+L E  DN V+FTYSV FV S T+WATRWDKYLH YDP IQW             
Sbjct: 253 EGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILL 312

Query: 319 XXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQ 378
                H L +AL++D +RYNELNLD+EFQE++GWKL HGDVFR P ++MLLS+LVGSG Q
Sbjct: 313 SSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQ 372

Query: 379 LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 438
           LFLM   +I FA LG LSPSSRGSL TVMF+LYALFG  GSYTSM VYKFF G  WK NM
Sbjct: 373 LFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNM 432

Query: 439 IXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK 498
           I            S++GLN FL+  HSSG IP  T+  IV+LWFV S+P ++AGS+I+ K
Sbjct: 433 ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK 492

Query: 499 KCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFY 558
           K  WD  PT TNQ+ARQ+PFQPWYLKTV A+ IAG FPFGSI VELYFIY+SLW+NKIFY
Sbjct: 493 KSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFY 551

Query: 559 MFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTK 618
           MFGFLF SF               Y+SL +ENW+WQWR F +GG GCA Y+FVH+ILFTK
Sbjct: 552 MFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTK 611

Query: 619 LKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
            KLGG  T+VLY+GYS VIS LCCL+TG++GFLSS++FVR+IY SIKV+
Sbjct: 612 FKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/685 (58%), Positives = 481/685 (70%), Gaps = 28/685 (4%)

Query: 8   LGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXX 67
           L L++LWA  QV+ FYLPGVAPTTY   D IPLLVNHL+P+MY+QH  EDG ++ GDK  
Sbjct: 6   LLLSILWA-SQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKES 63

Query: 68  XXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIP 127
                      FHFC+PEK+ K+ ESLGSIIFGDRIYNSP+QI+ML+ K C  LC+  IP
Sbjct: 64  LLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIP 123

Query: 128 GKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV----VQAVA 183
             DA+FINKLI NGFFQNWL+DGLPAAR   D  T S+FY  GFELG V +    ++   
Sbjct: 124 ADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNG 183

Query: 184 QAKTHPKEDDSGS-----------------AKLSTRDAKNV----QMLKNVELPYFANHH 222
           Q  +    DDSGS                 AK S    K V    +++K +E PYFANH 
Sbjct: 184 QGGSQ-DGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHF 242

Query: 223 DITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFV 282
           +I V+YHDRG GN RVVGV V+P SIKR SP TC  +G+ L L E    EV+F+YSV+F 
Sbjct: 243 EIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFT 302

Query: 283 ASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNL 342
            S+TVWATRWDKYLH YDP IQW                  H L   L  D +RYN++NL
Sbjct: 303 PSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINL 362

Query: 343 DNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGS 402
           D++FQE++GWKL HGDVFR P +S++LS+LVGSG QLFLM + +I FA LG LSPSSRGS
Sbjct: 363 DDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGS 422

Query: 403 LGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLG 462
           L TVMF+LYALFG  GSYTSM  YKFF GPYWK NM+             ++ LN FL+ 
Sbjct: 423 LTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVV 482

Query: 463 AHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWY 522
             S+G IP  T+  IVLLWF+ S+P ++AGSLIA KKC WDEHPTKT Q+ RQ+PFQPWY
Sbjct: 483 VESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWY 542

Query: 523 LKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXX 582
           LKTV A+ IAGIFPFGSIAVELYFIY+SLW+NKIFYMFGFLFVSF               
Sbjct: 543 LKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLT 602

Query: 583 YHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCC 642
           Y+SL LENW+WQWR F +GG GCA+YMF+H+ILFTK +LGGF TIVLYVGYS V+SLL C
Sbjct: 603 YYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSC 662

Query: 643 LVTGSIGFLSSMFFVRRIYSSIKVE 667
           L+TG++GFLSS++FVRRIYSS+KV+
Sbjct: 663 LITGTVGFLSSLWFVRRIYSSVKVD 687

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/674 (58%), Positives = 480/674 (71%), Gaps = 30/674 (4%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
           NAFYLPGVAP+TY   DE+PLLVNHL+PS+ +Q + + G+ ++  +              
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYYFPKL 74

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PEKIVK+P+SLGSI+FGDRIYNSP+ IKML+ +  V LC+  IPG DA+FINKLIK
Sbjct: 75  HFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIK 134

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQ--AKTHPKEDDSG-- 195
           NGFFQNWLIDGLPAAR ++D +T+++FY  GF LG VE+ + V         K  DSG  
Sbjct: 135 NGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKK 194

Query: 196 ---------------------SAKLSTRDAKNV-QMLKNVELPYFANHHDITVEYHDRGE 233
                                S K   R+ K + +++ NVE PY ANH+ I VE HDRGE
Sbjct: 195 NSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVHDRGE 254

Query: 234 GNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWD 293
           GN RVVGVTVDP S   S+       G+ L LDEK DNEV F+YSV F+ S+TVWATRWD
Sbjct: 255 GNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWD 311

Query: 294 KYLHTYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWK 353
           KYLHTY+PTIQW                  + LLKAL+SDFARY E NLDN F EDSGWK
Sbjct: 312 KYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSGWK 371

Query: 354 LTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYAL 413
           L HGDVFRIPS+SMLLSILVGSG QLFLMI  SIF AA+G +SPSSRGSL + MF  YAL
Sbjct: 372 LGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYAL 431

Query: 414 FGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKT 473
           FGF GSY SM VYKFF+GPYWKANMI            SI+GLN FLL  HSSGTIP   
Sbjct: 432 FGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTA 491

Query: 474 LFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAG 533
           L  IV++WFVIS+P +  GSL+A+K+ +W EHPTKTNQ+ARQ+PFQ WYLKT+ A  IAG
Sbjct: 492 LLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAG 551

Query: 534 IFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQW 593
           IFPFG+IAVELYFIYTSLW+NKIFYMFGFLFVSF               Y SL +ENW W
Sbjct: 552 IFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENWNW 611

Query: 594 QWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSS 653
           QWRSF +GGVGC++Y+F+HSILFTK KLGGF T++LY+GY+ ++S+L C+VTG++GF+SS
Sbjct: 612 QWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISS 671

Query: 654 MFFVRRIYSSIKVE 667
           M FVR+IYS+++V+
Sbjct: 672 MIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/669 (57%), Positives = 477/669 (71%), Gaps = 20/669 (2%)

Query: 18  QVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXX 77
           +V  FYLPGVAPTTY   D IPLLVNHL+PSMY++H  +DG++  GD+            
Sbjct: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYD 74

Query: 78  XFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKL 137
            FHFC+PEK+ K+ ESLGSIIFGDRIYNSP++++ML++K C  LC++ IP  DA+FINKL
Sbjct: 75  KFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKL 134

Query: 138 IKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV------VQAVAQAKTHPK- 190
           I NGFFQNWL+DGLPAAR   D+ T S+FY  GFELG ++V      +    +   HPK 
Sbjct: 135 IANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKG 194

Query: 191 ------EDDSGSAKLSTRDAKNV------QMLKNVELPYFANHHDITVEYHDRGEGNLRV 238
                 +DD       +++ K        +++K +E  YFANH +I V+YHDRG G+ RV
Sbjct: 195 ATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRV 254

Query: 239 VGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHT 298
           VGV V+P SIKR S  +C  +G+ L L E+ +  V+F+YSV+F  SDTVWATRWDKYLH 
Sbjct: 255 VGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHV 314

Query: 299 YDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGD 358
           YDP IQW                  H L + LR D +RYN+LNLD++FQE++GWKL HGD
Sbjct: 315 YDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGD 374

Query: 359 VFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVG 418
           VFR P+KS+LLS+LVGSG QLF+M + +I FA LG LSPSSRGSL TVMF+LYALFG +G
Sbjct: 375 VFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLG 434

Query: 419 SYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIV 478
           SYTSM  YKFF G YWK NMI             ++GLN FL+   S+G IP  T+  IV
Sbjct: 435 SYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIV 494

Query: 479 LLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFG 538
           LLWFV S+P +LAGSLIA KKC W+EHPTKT Q+ RQ+PFQPWYLKT  A  IAGIFPFG
Sbjct: 495 LLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFG 554

Query: 539 SIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSF 598
           SIAVELYF+Y+SLW+NKIFYMFGFLFVSF               Y+SL LENW+WQWR F
Sbjct: 555 SIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGF 614

Query: 599 IVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVR 658
            +GG GCA+Y+F+H+ILFTK KLGGFVTIVLYVGYS VISLL CL+TG++GF+SS++FVR
Sbjct: 615 WIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVR 674

Query: 659 RIYSSIKVE 667
           RIYSSIKV+
Sbjct: 675 RIYSSIKVD 683

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/660 (56%), Positives = 466/660 (70%), Gaps = 4/660 (0%)

Query: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXX 69
           L+LL+    V AF LPG+ P TY+  D+IPLLVNHL+PSM++ H+ E+G+++   K    
Sbjct: 6   LSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVV 65

Query: 70  XXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129
                    FHFCQP  I K   S+GSI+FGDRIYNSP+Q+ MLE KTCVPLC +IIPGK
Sbjct: 66  HSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGK 125

Query: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189
           DAEFINKLIKNG++QNW IDGLPAAR V+DK T S FYGNGFELG VE+ Q         
Sbjct: 126 DAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPD 185

Query: 190 KEDDSGSAKLSTRDAKNV--QMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPIS 247
              D   + L+ RDAKN+   ++K VE+PYF NH DI +EYH+RG GN RVVG TV+P+S
Sbjct: 186 SVHDI--SDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVS 243

Query: 248 IKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXX 307
           I R S G C  +G  L L+E+ DN V+ TYSV FV S T W TRWDKYLH YDP IQW  
Sbjct: 244 IARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFS 303

Query: 308 XXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSM 367
                           + LLKAL+SDFARYN +NLD++ +E+SGWKL HG VFRIP   M
Sbjct: 304 LINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPM 363

Query: 368 LLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYK 427
           +LSILVGSG QLFL+I  ++F AA+  LSP  RG+L T M +LY LFGF+ SY SMGVYK
Sbjct: 364 ILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYK 423

Query: 428 FFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVP 487
           FF+GPYWK NM+            + + LN+FL+ + SS  +PAKT+  ++LLWF +S+P
Sbjct: 424 FFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIP 483

Query: 488 SALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFI 547
            ++AGSL+A KKC WDEHPT TNQ+A+ +P Q WYLKT+ A+ I G+F FGSI+V+LYFI
Sbjct: 484 LSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFI 543

Query: 548 YTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAI 607
           YTSLW+N IFYM+GFL  S                YHSL  ENW+WQWR F +GG+GC+I
Sbjct: 544 YTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSI 603

Query: 608 YMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           Y+ +HS+ F +LKLGGF  I+LY+GYS+V++ L  LVTGS+GFLSSMFF++RI+SS+KV+
Sbjct: 604 YVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/654 (55%), Positives = 465/654 (71%), Gaps = 6/654 (0%)

Query: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXF 79
           NAFY+PG++  TY   D I L VN L+PSMY++H  E+G+++  DK             F
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           HFC+PEK+ ++ ESLGS++FGDRIYNSP+++ MLE K CVPLC T IP  DA+FINKLIK
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAK-THP---KEDDSG 195
           NGFF NWLIDGLP+AR ++D  T S FY +GF LGSV V      +K T P   K  +  
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199

Query: 196 SAKLSTRDAKNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSP 253
                 R+AKNV   ++   E+ YFANH +I +EYHDRG  N RVVGVTVDPISIKR   
Sbjct: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259

Query: 254 GTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXX 313
            +C  +G+ L L+E  +N+V FTYSV F+ S+T WATRWDKYLHTYDP+IQW        
Sbjct: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTI 319

Query: 314 XXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILV 373
                     H LL+AL+ D +RY +LNLDN F EDSGWKLTHGDVFR+P K+M+LSI V
Sbjct: 320 VVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379

Query: 374 GSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPY 433
           GSG+QLFLMI   +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTSMGVYKFF GPY
Sbjct: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439

Query: 434 WKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGS 493
           WKANMI             I+ LN FLLG HSSGTIPA T+  ++ LW ++SVP +  GS
Sbjct: 440 WKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499

Query: 494 LIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWY 553
            +A KKC+W+++PT  N++ R++P QPWY++++    ++GI PFG+IAVELYFIY+SLWY
Sbjct: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559

Query: 554 NKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHS 613
           NKIFYMFGFL VSF               YHSL LENW+WQWRSF+ GG+GCA Y+F++S
Sbjct: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619

Query: 614 ILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           I FT+ K  GFV+I+LY+GYS++I ++ CL+TG++ F+ +MFFV+RI++SIKV 
Sbjct: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKVH 673

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/665 (55%), Positives = 469/665 (70%), Gaps = 11/665 (1%)

Query: 4   HTVHLGLALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKG 63
           H     L+LLWA  +  A +LPG++PT Y A  EI L VNHL+PS ++QH+ +DG N+K 
Sbjct: 2   HFFFTALSLLWAVSR--ASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKS 59

Query: 64  DKXXXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCN 123
           DK              HFC+PE ++++ ESLGS++FGDR+YNSP+++ MLE+K+CV LC 
Sbjct: 60  DKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCK 119

Query: 124 TIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA 183
           ++IPG+DA FINKLIKNGF  NWL+DGLPA  +++++  +S    NGF LGSVE++Q V 
Sbjct: 120 SVIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVH 179

Query: 184 Q-AKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVT 242
             A   P+E+   SA  S        ++ N+ELP+  NH+DIT++YH+   G  R+VGV 
Sbjct: 180 NGAMATPREETGISAHGS-------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVE 232

Query: 243 VDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPT 302
           V+P SIK++S  +C+ +G+ + L E  DNEV +TYSVR+V     WATRWD Y  +YD T
Sbjct: 233 VEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTT 291

Query: 303 IQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRI 362
           +QW                  HMLL+AL+SDFARYNELNLD+EF E+SGWKL+HGDVFR+
Sbjct: 292 VQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRM 351

Query: 363 PSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTS 422
           P+KS+LLS+LVGSG+QL L+    I  AA+ F +  SR  L T+ F+LYALFGFVGSY S
Sbjct: 352 PNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYAS 411

Query: 423 MGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWF 482
           MGVY+FF+GPY K NMI            +I+ LN FLL AHSS  IP   LF +VLLW 
Sbjct: 412 MGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWL 471

Query: 483 VISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAV 542
           +ISVP +LAGSL A K CSWD+HPTKTNQ+ARQ+PFQPWYLKT+ A  +AGIFPF SIAV
Sbjct: 472 IISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAV 531

Query: 543 ELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGG 602
           ELYFIY SLW+++ FYMFGF  VS                YHSL LENWQWQWRSFIVGG
Sbjct: 532 ELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGG 591

Query: 603 VGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYS 662
           +G A+Y+F+HSI FT+ KL GF TIVLYVGYS +IS+LCCL TG++GF SSMF VR+I+S
Sbjct: 592 LGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFS 651

Query: 663 SIKVE 667
           S+KV+
Sbjct: 652 SVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/652 (53%), Positives = 453/652 (69%), Gaps = 11/652 (1%)

Query: 17  GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXX 76
           G    FYLPG APTTY+  D IPLLVNH++P+++   +   G + + DK           
Sbjct: 12  GLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYY 69

Query: 77  XXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINK 136
              H C+P+KI K  ESLGSIIFGDR++NSP+++KMLEEK+CV LC   +P +DA+FIN+
Sbjct: 70  PRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQ 129

Query: 137 LIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGS 196
           LI++GFF NWL+DGLPA R +HD  TN+ FYG GFELG V       +      +++ G 
Sbjct: 130 LIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV------IRGTEDRNQEEPGE 183

Query: 197 AKLSTRDAKNVQMLKNV-ELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGT 255
            +L TR  + +Q  ++V  +PYF NH +ITV+YH R E  LRVVGV+V P S++      
Sbjct: 184 IELQTR--RVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDK 241

Query: 256 CQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXXXXXXX 315
           C  SG+ L+L E  D +V FTYSVRF  SD  WATRW KYLH YDP +QW          
Sbjct: 242 CANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVV 301

Query: 316 XXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGS 375
                   H L +AL++D  RYN+ NLDNEFQED GWKL H DVFR PSK++LLS+ VGS
Sbjct: 302 LLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGS 361

Query: 376 GIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWK 435
           G QLFLM + ++F A LGFLSPSSRGSLGT+MF+LYA+FG  GSY SM  YK F G  WK
Sbjct: 362 GGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWK 421

Query: 436 ANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLI 495
            NM+            +++ +N FL+   SSG +P  T+  IV+LWFV+S+P ++ GSL 
Sbjct: 422 VNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLF 481

Query: 496 AHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNK 555
           A KK +WD+HPTKT+Q+A+Q+P QPWYL+T  A +IAG+FPFG+IAVELYFIYTS+W+N 
Sbjct: 482 ARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNT 541

Query: 556 IFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSIL 615
           +FYMFGFLF +F               Y+SL +ENW WQWRSFI+GG+GC+ Y+F++SIL
Sbjct: 542 MFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSIL 601

Query: 616 FTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           FTK +LGGFVTIVLYVGYS +IS L CLVTG+IGF+SS++FVR+IYSSIKV+
Sbjct: 602 FTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/621 (53%), Positives = 429/621 (69%), Gaps = 4/621 (0%)

Query: 49  MYWQHETEDGENMKGDKXXXXXXXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPY 108
           M++ H+ ++G+++  D               HFC+PE + K   S+GS++FGDR+YNSP+
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 109 QIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYG 168
           Q+ ML+ KTC  LCN+ I G+DA+FINKLIKNG++QNWLIDGLPAAR V+D  T S+FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 169 NGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDAKNV--QMLKNVELPYFANHHDITV 226
           NGFELG VE+ Q   + K  P   D+    L  RDAKN+   +++++E+PYF NH DI +
Sbjct: 121 NGFELGLVEIRQTTGE-KLLPNSADT-FRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRI 178

Query: 227 EYHDRGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDT 286
           EYHDRG  N RVVGVTV+P+SI RS  G C+ +G  L L E   N ++FTYSV F+ S+T
Sbjct: 179 EYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSET 238

Query: 287 VWATRWDKYLHTYDPTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEF 346
            W TRWDKYLH YDPTIQW                    LL+AL+SDF+RY ELNLD   
Sbjct: 239 AWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETI 298

Query: 347 QEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTV 406
           +ED+ WKL HGDVFR P   MLLSILVGSG+QLFLMI  +IF  A+G ++P SRG+L TV
Sbjct: 299 KEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTV 358

Query: 407 MFMLYALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSS 466
           MF+LY  F F+ S+ SMGVYKFF G  W  N I             I+GLN+FL+  HSS
Sbjct: 359 MFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSS 418

Query: 467 GTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTV 526
           G IP  T   ++LLWF I VP ++ GSL+A K C WD HPTKTN V++ +P Q WYL+T+
Sbjct: 419 GVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTI 478

Query: 527 AATFIAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSL 586
            A+ I G+F FGS++VELYF+YTSLW+NKIFYM+GFLF S                Y+SL
Sbjct: 479 PASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSL 538

Query: 587 SLENWQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTG 646
           S ENWQWQWRSF++ G+GC+ Y+F+HS+LFT++KLGGF   +LY+GYS VI+ L  +VTG
Sbjct: 539 SAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTG 598

Query: 647 SIGFLSSMFFVRRIYSSIKVE 667
           ++GFLSSM FVR IYS++KV+
Sbjct: 599 ALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/657 (45%), Positives = 394/657 (59%), Gaps = 57/657 (8%)

Query: 11  ALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXX 70
           + L   G    FY PGV+P TY   DEIPLLVN+LS    W  +                
Sbjct: 6   SFLLCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLSSDFLWNIDYYSDS----------- 54

Query: 71  XXXXXXXXFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKD 130
                      C+P  I ++ ESLGS+IFGDR+YNSP+++ ML+   CV LC+T I   D
Sbjct: 55  --------IGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---D 103

Query: 131 AEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPK 190
               N      +  NWL+DGLP   +  D +++++ Y N  EL                 
Sbjct: 104 TALWNTFFGYRYSYNWLVDGLPVLGI--DGTSDANGYHNNSEL----------------- 144

Query: 191 EDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR 250
                               +  E  Y  NH DI + Y+DRG+G  RVV     PIS+ R
Sbjct: 145 ----------------FMGYQADEQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPR 188

Query: 251 SSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWXXXXX 310
           +    C     P+ +   N   + FTYSV F  SD  W+TRWD+YLH YD  IQ      
Sbjct: 189 TGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELIS 248

Query: 311 XXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLS 370
                        H L + L+ D A Y+E NLD+EFQ+D  WK+ HG+VFR PSK++LLS
Sbjct: 249 FSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLS 308

Query: 371 ILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFR 430
           + VGSG QLF M   ++   + GFLSPS+RGSLGTVMF+LYALFG VGSYTSM +YKFF 
Sbjct: 309 VFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFG 368

Query: 431 GPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSAL 490
           G  WK N+I            + V LN FL+ A SSG +P  T+  I++LWF++SVP ++
Sbjct: 369 GQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSI 428

Query: 491 AGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTS 550
            GSL++ K   WDEHP KTNQ+ARQVP QPWY+KT  ATF+AG+FPFG++AVELY+IY S
Sbjct: 429 IGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYAS 488

Query: 551 LWYNKIFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSFIVGGVGCAIYMF 610
           +W   IF+M+GFLFV+F               Y+SL +ENW+WQWRSFI+GGVGC++Y+F
Sbjct: 489 IWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVF 548

Query: 611 VHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
           +HS+ F K K  GFV++VLY+GYSA++S++CCLVTGSIGFL++++FVR+IYS+IKV+
Sbjct: 549 LHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 149/652 (22%), Positives = 269/652 (41%), Gaps = 108/652 (16%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P  + K+P   SL  II GDR + S Y++K  E+  C  LC      +  + ++KL+
Sbjct: 86  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLV 145

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           + G+   WLID  LPAA      + +  +Y +GF LG ++           P  D +   
Sbjct: 146 REGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID-----------PDTDKT--- 191

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTC 256
                              Y  NH  + + +H        +VG  V P S+     PG  
Sbjct: 192 -------------------YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGAS 232

Query: 257 QTSGDPLMLDEKNDNEVY---FTYSVRFVASDTV-WATRWDKYLH----TYDPTIQ--WX 306
           +      ++  +++NE+    FTYSV +     V W  RWD +L+    + + +IQ  W 
Sbjct: 233 KNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWM 292

Query: 307 XXXXXXXXXXXXXXXXXHMLLKALRSDFARYNE----LNLDNEFQEDSGWKLTHG--DVF 360
                             + ++ + +D +        +N++    ED      +G   V+
Sbjct: 293 SLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVY 352

Query: 361 RIPSKSM-----------LLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFM 409
            +    +           +L +LV  G+Q    I  S+  +       + R S+ T+  +
Sbjct: 353 TVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAIL 412

Query: 410 LYALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXS-------------IVGL 456
            + L  F+ S+    +    +    KAN +            S             IV +
Sbjct: 413 FFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMV 472

Query: 457 NMFLLG----AH-SSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK---------KCSW 502
           + FLL     AH S+  +P KT+ F + ++F++ +P +L G ++A+            + 
Sbjct: 473 STFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITK 532

Query: 503 DEHPTKTNQV---ARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IF 557
           DE  +  N +     +  F P         ++ GIFP   I VE+ ++Y SLW  K   +
Sbjct: 533 DESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFY 589

Query: 558 YMFGFLFVSFXXXXXXXXXXXXXXXYHSL------SLENWQWQWRSFIVGGVGCAIYMFV 611
           Y +GFLF+S                Y  +       +    W+W+ F +G  G  +YM +
Sbjct: 590 YFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMEL 648

Query: 612 HSI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
           +S+  +F  L + GF +I++ + YS + +++C L  G++ +L++ +F+ +IY
Sbjct: 649 YSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 159/637 (24%), Positives = 261/637 (40%), Gaps = 97/637 (15%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P  + K+P   SL  II GDR + S Y +K  ++ TC  LC      +  +   KL+
Sbjct: 75  FTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLV 134

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           ++G+   WLID  LPAA           +Y +GF LG V+               D+G  
Sbjct: 135 EDGYVVQWLIDEELPAATTFISTIDQKKYYASGFPLGFVD--------------PDTGKV 180

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTC 256
            L+T                   H  + + Y+        +VG  V P S+     PG  
Sbjct: 181 YLNT-------------------HVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGAS 221

Query: 257 QTSGDPLMLDEKNDNE---VYFTYSVRFVASDTV-WATRWDKYLHT----YDPTIQ--WX 306
           +      ++  +ND++   + FTYSV +     V W  RWD YL++     + T Q  W 
Sbjct: 222 KNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWI 281

Query: 307 XXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKS 366
                             +LL++ +S      ++N   E +    +++    +  I  ++
Sbjct: 282 SLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWI--INERT 339

Query: 367 MLLSILVGSGIQLFLMISVSIFFAALGFLSPSSR--------GSLGTVMFMLYALFGFVG 418
            L ++L+     LF+ + V   F  LG L+ S           S+ T+  + + L  F+ 
Sbjct: 340 PLANLLI-----LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMS 394

Query: 419 SYTSMGVYKFFRGPYWKANMIXX-----XXXXXXXXXXSIVGLNMFLLG----AH-SSGT 468
           SY    + +       K   I                  IV +   LL     AH S+  
Sbjct: 395 SYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHA 454

Query: 469 IPAKTLFFIVLLWFVISVPSALAGSLIAHK---KCSWDEHPTKTNQVARQV------PFQ 519
           +P KT+   + ++F++ +P ++ G  +A+    K S  +    T++   ++      P +
Sbjct: 455 LPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKK 514

Query: 520 PWYL--------KTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXX 569
             +L        K      ++GIFPF  I VEL ++Y S+W  K   +Y +GFLF +   
Sbjct: 515 HIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILL 574

Query: 570 XXXXXXXXXXXXXY---HSLSLENWQWQWRSFIVGGVGCAIYMFVHSI--LFTKLKLGGF 624
                        Y   H     N  W+W SF +G   CA YM ++S+  +F  L + GF
Sbjct: 575 LCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGF 633

Query: 625 VTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
            +I + V Y A+ + LC    GSI  L+S FFV ++Y
Sbjct: 634 SSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  133 bits (334), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 165/725 (22%), Positives = 285/725 (39%), Gaps = 138/725 (19%)

Query: 13  LWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXX 72
           +++  Q N +Y   + P  YK ND + L+VN +   +                       
Sbjct: 39  VFSSSQNNLYYDGWITPNFYKKNDFLELIVNKVESDL--------------------TQL 78

Query: 73  XXXXXXFHFCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKD 130
                   F  P  + K+P   SL  II GDR + S Y+++  E+  C  LC      K 
Sbjct: 79  PYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKG 138

Query: 131 AEFINKLIKNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189
            + ++KL++ G+   WLID  LPAA      + +  +Y +GF LG V+           P
Sbjct: 139 MQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD-----------P 187

Query: 190 KEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIK 249
             D +                      Y  NH  + + +H  G+    VVG  V P S+ 
Sbjct: 188 DTDKT----------------------YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVS 225

Query: 250 R-SSPGTCQTSGDPLML---DEKNDNEVYFTYSVRFVASDTV-WATRWDKYLHTYD---- 300
               PG  +      ++   DE +   + FTYSV +     V W  RW+ +L+  +    
Sbjct: 226 DYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDE 285

Query: 301 --PTIQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYN-------------ELNLDNE 345
                 W                   + ++ +R+D    +             E +LD++
Sbjct: 286 QSAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDD 345

Query: 346 -FQEDSGWKLTHG-------DVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSP 397
            + ++S + +T         D+F +     +L +LV  G+Q    I  S+  +       
Sbjct: 346 KYGKNSVYMVTKDWIQNGKPDLFGLK----VLIVLVSFGVQFLFTIIGSLTISCSMNKLH 401

Query: 398 SSRGSLGTVMFMLYALFGFVGSY--TSMGVYKFFRG---PYWKANMIXXXXXXXXXXXXS 452
           + R S+ T+  + + L  F+ S+  T +G+    R     Y   N               
Sbjct: 402 NVRNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAV 461

Query: 453 IVG--------LNMFLL----GAH-SSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK- 498
           I G        +  FLL    GAH S+  +P +T+ F + ++FV+ +P +L G ++A+  
Sbjct: 462 ICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNI 521

Query: 499 -----------KCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFI 547
                      K   D + +K  +   +  F P         ++ GIFP   I VE+ ++
Sbjct: 522 PLPKYWLSGITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYV 578

Query: 548 YTSLWYNKIFYMFG---------FLFVSFXXXXXXXXXXXXXXXYHSLSLENWQWQWRSF 598
           Y SLW  K  + F           L V                 +    + N  W+WR F
Sbjct: 579 YKSLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRN-NWRWRCF 637

Query: 599 IVGGVGCAIYMFVHSI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFF 656
            +G  G  +YM ++S+  +F  L + GF +I++ + YS + ++LC L  G++  L++ +F
Sbjct: 638 EMGFSG-GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWF 696

Query: 657 VRRIY 661
           + RIY
Sbjct: 697 INRIY 701

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 150/654 (22%), Positives = 270/654 (41%), Gaps = 112/654 (17%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P  + K P   SL  II GDR + S Y++   E+  C  LC      +  + ++KLI
Sbjct: 86  FTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLI 145

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           + G+   WLID  LPAA      + +  +Y +GF LG ++               D+G  
Sbjct: 146 REGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD--------------PDTGKT 191

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTC 256
                              Y  NH  + + +H    G   +VG  V P S+     PG  
Sbjct: 192 -------------------YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGAS 232

Query: 257 QTSGDPLMLDEKNDNEVY---FTYSVRFVASDTV-WATRWDKYLHTYD------PTIQWX 306
           +T     +   +++NE+    FTYSV +     V W  RWD +L++ +          W 
Sbjct: 233 KTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWM 292

Query: 307 XXXXXXXXXXXXXXXXXHMLLKALRSDFARYNE----LNLDNEFQED--SGWKLTHGDVF 360
                             + +  + +D    +     +N++    ED  +  K +   V+
Sbjct: 293 SFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVY 352

Query: 361 RIPS------KSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSS--------RGSLGTV 406
            +        K  L S+    G+ + +   V   F  +G L+ S         R S+ T+
Sbjct: 353 MVAKDWIQNGKPDLFSL---KGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTM 409

Query: 407 MFMLYALFGFVGSY--TSMGVY---KFFRGPYWKANMIXXXXXXXXXXXXSIVG------ 455
             + + +  F+ S+  T + +    + F   Y+  N               I G      
Sbjct: 410 AILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGM 469

Query: 456 --LNMFLLG----AH-SSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK---------K 499
             ++ FLL     AH S+  +P KT+ F + ++F++ +P +L G ++A+           
Sbjct: 470 IMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSG 529

Query: 500 CSWDEHPTKTNQVARQVPFQPWYLKTV--AATFIAGIFPFGSIAVELYFIYTSLWYNK-- 555
            + DE  +K N++   +P  P     +     ++ G+FP   I VE+ ++Y SLW  K  
Sbjct: 530 ITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTT 587

Query: 556 IFYMFGFLFVSFXXXXXXXXXXXXXXXYHSL------SLENWQWQWRSFIVGGVGCAIYM 609
            +Y +GFLF+S                Y  +       +    W+W+ F +G  G  +YM
Sbjct: 588 FYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYM 646

Query: 610 FVHSI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
            ++S+  +F  L + GF +I++ + YS + +++C L  G++ +L++ +F+ +IY
Sbjct: 647 ELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY 700

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  132 bits (331), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 153/635 (24%), Positives = 251/635 (39%), Gaps = 88/635 (13%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P    K+P   SL  II GDR + S Y++K  ++ +C  LC             +L+
Sbjct: 75  FTCPPTEDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELV 134

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           + G+   WLID  LPAA        +  +Y +GF LG V+                    
Sbjct: 135 RQGYVVQWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD-------------------- 174

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTC 256
                         + E  Y   H  + + Y+        +VG  V P S+     PG  
Sbjct: 175 -------------PDTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGAS 221

Query: 257 QTSGDPLMLDEKNDNE---VYFTYSVRFVASDTV-WATRWDKYLHTYDPT------IQWX 306
           +      ++  +N++E   + FTYSV +     V W+ RW+ +L++ + +        W 
Sbjct: 222 KGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWM 281

Query: 307 XXXXXXXXXXXXXXXXXHMLLKALRSDFARYNE---LNLDNEFQEDSGWKLTHGDVFRIP 363
                              L + +R      +E      D   + DS + +    + +  
Sbjct: 282 TLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTD 341

Query: 364 SKSM---LLSILVGSGIQ-LFLMISVSIFFAALGFLSPSSRGSLGTVMFML----YALFG 415
           S S+   +L+I V  G+Q LF +I    F  +L  L       L    F L    Y    
Sbjct: 342 SSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHL 401

Query: 416 FVGSYTSMGVYKFFRGPYWKANM--IXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKT 473
           FVG++  +       G   +     I            S   LN  +    SS  +P +T
Sbjct: 402 FVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRT 461

Query: 474 LFFIVLLWFVISVPSALAGSLIAHK--KCSWDEHPTKTNQVARQVPFQPWYLKTVAA--- 528
           +   V ++FVI +P +L G  ++H+  +      P  ++  AR +  +P    T  A   
Sbjct: 462 IVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAPRK 519

Query: 529 ----------TF-IAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXXXXXXXX 575
                     TF I G  PF  I VEL +IY S+W  K   +Y++GFL  +         
Sbjct: 520 ISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVC 579

Query: 576 XXXXXXXY-----HSLSLENWQWQWRSFIVGGVGCAIYMFVHSI--LFTKLKLGGFVTIV 628
                  Y     H        W+W+ F++G   CA YM ++S+  +F  LK+ GF +I 
Sbjct: 580 EVSFLGCYVMMRKHKRVATFDSWRWKCFMMG-TSCAWYMELYSLYYIFHTLKMTGFPSIF 638

Query: 629 LYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSS 663
           + V YS + +++C    GS+G+L+S + V R++ +
Sbjct: 639 ISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  130 bits (327), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 162/734 (22%), Positives = 272/734 (37%), Gaps = 175/734 (23%)

Query: 27  VAPTTYKANDEIPLLVNHLS------PSMYWQHETEDGENMKGDKXXXXXXXXXXXXXFH 80
           + P  Y+ ND + ++VN +       P  Y++                            
Sbjct: 56  IRPNVYEENDPVEIIVNKIESDLTQFPYAYYE--------------------------LP 89

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P   VK+P   SL  II GDR + S Y +   +++ C+ LC+           ++LI
Sbjct: 90  FTCPPTNVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELI 149

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           K G+   WLID  LPAA        +  +Y +GF LG ++               D+G  
Sbjct: 150 KQGYVVQWLIDDELPAATTFISTKDHKKYYASGFPLGFMD--------------KDTGKT 195

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ 257
                              Y  NH  + + YH        +VG+ V P S+         
Sbjct: 196 -------------------YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGAS 236

Query: 258 TSGDPLMLDEKNDNEVY--FTYSVRFVASDTV-WATRWDKYLHTYDPT------IQWXXX 308
            + D   ++ +     Y  FTYS+ +     V W  RW+ ++++ + +        W   
Sbjct: 237 KNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISL 296

Query: 309 XXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSML 368
                           +L K++ +D     E    +  Q  S W + H  +         
Sbjct: 297 ANSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLN------H 345

Query: 369 LSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKF 428
           L++    G+Q    I  S+  +       + R S+ T+  M +      G+YTS      
Sbjct: 346 LNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTMALMCF----ISGAYTSS----- 396

Query: 429 FRGPYWKANM-------IXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLW 481
           F G    AN        I             ++ LN  +    S+  +P  T+  ++ ++
Sbjct: 397 FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVY 456

Query: 482 FVISVPSALAGSLIA---HKKC-----------------SWDEHPTKTNQV-------AR 514
           F++ +P ++ G + A    +KC                  +D+ P   N+V         
Sbjct: 457 FIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNS 516

Query: 515 QVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXXXXX 572
           ++P      + V  T I+GI PF  I VEL F+Y SLW  K   +Y++GFL  +      
Sbjct: 517 KLPLM--LRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCV 574

Query: 573 XXXXXXXXXXYHSL-------------------------------------SLENWQWQW 595
                     Y +L                                      L   QW+W
Sbjct: 575 VVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRW 634

Query: 596 RSFIVGGVGCAIYMFVHSILF--TKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSS 653
           +SF +GG   A Y+  +S+ +  T LK+  F +I+L+  YSA+ + LC    G++G+LS 
Sbjct: 635 KSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSC 693

Query: 654 MFFVRRIYSSIKVE 667
            +FV RI+++ K E
Sbjct: 694 CWFVNRIHTNSKKE 707

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  128 bits (321), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 148/633 (23%), Positives = 256/633 (40%), Gaps = 96/633 (15%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P  + K+P   SL  II GDR + S Y +   E+  C  LC      +  +   +L+
Sbjct: 76  FTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELV 135

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           KNG+   WLID  LPA       + +  +Y +GF LG V+               ++G  
Sbjct: 136 KNGYVVQWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD--------------PETGKT 181

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPIS-IKRSSPGTC 256
            L+T                   H  I + Y+        + G  + P S +    PG  
Sbjct: 182 YLNT-------------------HVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGAS 222

Query: 257 QTSGDPLMLDEKNDNE---VYFTYSVRFVASDTV-WATRWDKYLH----TYDPTIQ--WX 306
           +      ++  +ND++   + FTYSV +     V W  RWD YL+    + D + Q  W 
Sbjct: 223 KDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWI 282

Query: 307 XXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKS 366
                             +L +  +     +++++ +   ++D G        + +  ++
Sbjct: 283 SLANSFGIVFLISSITAVILYRTFKISRRSFSDISKE---EDDKGSIYVVARKWLLNEQT 339

Query: 367 MLLSILVGSGIQLFLMISVSIFFAALGFLSPSS--------RGSLGTVMFMLYALFGFVG 418
            L ++L+     +F+ + V   F  LG L  S         R S+ T+  + +    F+ 
Sbjct: 340 PLANVLI-----IFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMA 394

Query: 419 SYTSMGVYKFFR----------GPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGT 468
           S+T   + K               Y+    +              + LN  +    S+  
Sbjct: 395 SFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHA 454

Query: 469 IPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVA---------RQVPFQ 519
           +P  T+ F++ ++FV+ +P +L G  IA K  S +  P+ +  +          + +   
Sbjct: 455 LPFGTVLFLISVYFVVCIPLSLLGGYIAVK--STNSKPSFSFSIGNYSDRIFVYKTITMS 512

Query: 520 PWYL----KTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXXXXXX 573
           P  L     +  A    G+FPF  I VEL ++Y SLW  K   +Y +GFL  +       
Sbjct: 513 PSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIV 572

Query: 574 XXXXXXXXXY---HSLSLENWQWQWRSFIVGGVGCAIYMFVHSI--LFTKLKLGGFVTIV 628
                    +   +S    +  W+W SF +G   CA YM V+S+  +F  L + GF +I 
Sbjct: 573 ICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIF 631

Query: 629 LYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
           + V Y  + +++C   TGSI  L+S +FV++IY
Sbjct: 632 ISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 150/629 (23%), Positives = 255/629 (40%), Gaps = 96/629 (15%)

Query: 81  FCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P    K+P   SL  II GDR + S Y++ + ++  C  LC      +  +    LI
Sbjct: 75  FTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLI 134

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           K+G+   W+ID  LPAA      + N  +Y  GF LGSV                D  S+
Sbjct: 135 KSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSV----------------DPRSS 178

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTC 256
           ++                 +F NH  + + Y+      + +VG    P S+     PG  
Sbjct: 179 RV-----------------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGAS 221

Query: 257 QTSGDPLMLDEKNDNEVYF--TYSVRFVASDTV-WATRWDKYLH------TYDPTIQWXX 307
           +      + D   +  VY   TYSV +     + W+ RW  Y++      +   T  W  
Sbjct: 222 KDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMA 281

Query: 308 XXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSM 367
                             L+   R+     NE  L+++  EDS       D+F + +  +
Sbjct: 282 LANSVGIVLFVTFIVIVNLIMIFRNP----NE-QLESKENEDSS------DIFNVANNWL 330

Query: 368 L---------LSILVGSGIQLFLMI----SVSIFFAALGFLSPSSRGSLGTVMFMLYALF 414
                     L + V  GIQ+  MI    ++S+    L  +  +S  ++  + F+  A  
Sbjct: 331 RARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIK-NSVLTIAALCFVAGAFM 389

Query: 415 G-FVGSYTSM----GVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGAHSSGTI 469
             FVG++  M      Y F+   +     +              + LN  +    S+  +
Sbjct: 390 ASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKAL 445

Query: 470 PAKTLFFIVLLWFVISVPSALAGSLIA---HKKCSWDEHPTKT---NQVARQVPFQPWYL 523
           P  T+   V  +FV+ +  +L G  +A   H+    D  P  T    +V R+       L
Sbjct: 446 PFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKL 505

Query: 524 KTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXXXXXXXXXXXXXX 581
               A  I+G  PF  I VEL ++Y S+W  K  ++Y++ FLF +               
Sbjct: 506 VVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLG 565

Query: 582 XYHSLSLE-----NWQWQWRSFIVGGVGCAIYMFVHSI--LFTKLKLGGFVTIVLYVGYS 634
               + L      +  W+WR F++   GC+ YM ++S+  +F  + + G   + + V YS
Sbjct: 566 CLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYS 624

Query: 635 AVISLLCCLVTGSIGFLSSMFFVRRIYSS 663
            + ++LC L TGS+G+L+S +FV++I+ +
Sbjct: 625 FIFNVLCGLATGSLGYLTSSWFVKKIHRT 653

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  124 bits (310), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 152/719 (21%), Positives = 279/719 (38%), Gaps = 130/719 (18%)

Query: 17  GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXX 76
           GQ N +Y   + P  YK  D + L+VN +   +                           
Sbjct: 42  GQDNTYYDGWITPNFYKKGDPLELIVNKVESDL--------------------TQLPYAY 81

Query: 77  XXFHFCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFI 134
               F  P  + K+P   SL  II GDR + S Y +   E+  C  LC      +  + +
Sbjct: 82  YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSL 141

Query: 135 NKLIKNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDD 193
           +KL++ G+   WLID  LPAA      + +  +Y +GF LG V+               D
Sbjct: 142 DKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD--------------PD 187

Query: 194 SGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SS 252
           +G                     Y  NH  + + +H        +VG  V P S+     
Sbjct: 188 TGKT-------------------YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHC 228

Query: 253 PGTCQTSGDPLMLDEKNDNEVY---FTYSVRFVASDTV-WATRWDKYLHTYD------PT 302
           PG  +      ++  +++NE+    FTYSV +     V W  RWD +L++ +        
Sbjct: 229 PGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQ 288

Query: 303 IQWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYN-------------ELNLDNEFQED 349
             W                   + ++ +  D    +             E NLD++    
Sbjct: 289 FHWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGK 348

Query: 350 SGWKLTHGDVFRIPSKSM----LLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGT 405
           +   +   D  +    +M    +L +LV  G+Q    +  S+  +       + R S+ T
Sbjct: 349 NSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVIT 408

Query: 406 VMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXS------------- 452
           +  + + L  F+ S+    +    +    + N +            S             
Sbjct: 409 MAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPG 468

Query: 453 IVGLNMFLLG----AH-SSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK--------- 498
           +V ++ FLL     AH S+  +P +T+ F + ++F++ +P +L G  +A+          
Sbjct: 469 LVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLS 528

Query: 499 KCSWDEHPTKTNQV---ARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNK 555
             + DE    ++++     +  F P         ++ G+FPF  I VEL ++Y S+W  K
Sbjct: 529 GITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVWLEK 585

Query: 556 --IFYMFGFLFVSFXXXXXXXXXXXXXXXYHSL-------SLENWQWQWRSFIVGGVGCA 606
              +Y +GFL ++                Y  +        + N  W+W+ F +G  G  
Sbjct: 586 TTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRN-NWRWKCFEMGFSG-G 643

Query: 607 IYMFVHSI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSS 663
           +YM ++S+  +F  L + GF + ++ + YS + +++C L  G + +L++ +F+ +IY S
Sbjct: 644 VYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 142/629 (22%), Positives = 248/629 (39%), Gaps = 95/629 (15%)

Query: 79  FHF-CQPEKIVKE-PESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINK 136
            HF C P + +K  P +   I++G++ + S YQ+   +++ CV LC+    G+  +   +
Sbjct: 89  LHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYE 148

Query: 137 LIKNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSG 195
           LIK  +   WL D  LP A    +      +Y +GF LG  +           P+ D++ 
Sbjct: 149 LIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGFPLGQYD-----------PETDEA- 196

Query: 196 SAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGT 255
                                Y  NH  I + YH   +G   +VG  V P S+       
Sbjct: 197 ---------------------YINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPG 235

Query: 256 CQTSGDPLMLDEKNDNE--VYFTYSVRFVASDTV-WATRWDKYLHTYDPTIQWXXXXXXX 312
                 P  +D  N++   + FTY+V +     V W  RW+ +++  +  ++        
Sbjct: 236 ASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGE--LKESTSNQFH 293

Query: 313 XXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSIL 372
                        LL  + +   R  E +     Q  + W      +F        L++L
Sbjct: 294 WITFANGIIVTSCLLLIVIAILKR-QETDGSITTQLAAEWSKARVPLF------FQLNLL 346

Query: 373 VGSGIQ-LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRG 431
           V  GI  LF  +   I   +L          L   +F+  +     GS+TS  +     G
Sbjct: 347 VSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGALLEG 401

Query: 432 PYWKANMIXXXXXXXXXXXXSIV---GLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPS 488
              +  ++            ++V    LN  L   +++ T+P  T+  +   +F++ VP 
Sbjct: 402 QMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPI 461

Query: 489 ALAGSLIAHKKCSWDEHPTKTNQVA----RQVPFQPWYLKT-----------VAATFIAG 533
           ++ G   A +    +   T  N  A     +   +P Y+++           +A T   G
Sbjct: 462 SIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLTFG 521

Query: 534 IFPFGSIAVELYFIYTSLWYNK--IFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLEN- 590
           + PF  I VEL F Y SLW  K  ++Y++GFL  +                Y  L+  N 
Sbjct: 522 LIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGND 581

Query: 591 -----WQ------------WQWRSFIVGGVGCAIYMFVHSILFTKL--KLGGFVTIVLYV 631
                W             W+W++F +GG   A YM  +SIL+     +   F++  L+V
Sbjct: 582 SLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFV 640

Query: 632 GYSAVISLLCCLVTGSIGFLSSMFFVRRI 660
            YS + ++LC    GS+ +LSS++F+ ++
Sbjct: 641 CYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  119 bits (298), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 156/651 (23%), Positives = 257/651 (39%), Gaps = 110/651 (16%)

Query: 82  CQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139
           C P K  K+P   SL  I  GDR + S Y++    +  C  LC      +      +L++
Sbjct: 87  CPPTK-EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQ 145

Query: 140 NGFFQNWLID-GLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAK 198
            G+   WLID  LPAA      + ++ +Y  GF +G V+              D +G   
Sbjct: 146 QGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVD--------------DRTGKT- 190

Query: 199 LSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTCQ 257
                             +  NH  + + YH   E    +VG  V P S+     PG  +
Sbjct: 191 ------------------FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANK 232

Query: 258 TSGD-PLMLDEKNDNEVY--FTYSVRFVASDTV-WATRWDKYLHTYDPT------IQWXX 307
                 +++ EK+D   +  FTYSV +     V W  RW+ +L+  + +        W  
Sbjct: 233 NHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMS 292

Query: 308 XXXXXXXXXXXXXXXXHMLLKAL----RSDFARYNELNLDNEFQEDSGWKLTHGDVF--- 360
                            +LLK      R         NL  + ++D+  K++ G VF   
Sbjct: 293 FLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVFVNA 351

Query: 361 -------RIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLY-- 411
                  +IP    L+  L   GIQ    I  S+  +       + R ++ T+  + +  
Sbjct: 352 KTWITVGKIPYWKALIC-LTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFIC 410

Query: 412 --ALFGFVGS--YTSMGVYKFF------RGPYWKANMIXXXXXXXXXXXXSIVGLNMFLL 461
             A+ G++GS  Y    + K +      R   +K +++            S   LN  +L
Sbjct: 411 GAAISGYIGSRLYIEYQILKGYLRNEVNRTKVYKFSVVCGSSLPGLLMVISF-SLNCIIL 469

Query: 462 GAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPT-------KTNQVAR 514
              S+  +P KT  F+V ++FV  +P +L G ++A   C  D + T       + N ++R
Sbjct: 470 AHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRRNTISR 528

Query: 515 QVP---------FQPWYLK------TVAATFIAGIFPFGSIAVELYFIYTSLWYNK--IF 557
           +           +Q           T       G F F  I VEL ++Y S+W  K   +
Sbjct: 529 KSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFY 588

Query: 558 YMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQ-----WQWRSFIVGGVGCAIYMFVH 612
           Y +GFL  +                Y  L  +N +     W W+SF++G   CA YM ++
Sbjct: 589 YYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELY 647

Query: 613 SI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
           S+  +F  L + GF +I + V YS + + +C    GS+ +L+S   V +IY
Sbjct: 648 SLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 95.9 bits (237), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 118/246 (47%), Gaps = 39/246 (15%)

Query: 456 LNMFLLGAHSSGTIPAKTLFFIVLLWFVISVP-SALAGSLIAHKKCS------------- 501
           LN  +    S+  +P  T+  ++ ++F++ +P S L GS+ A+K                
Sbjct: 432 LNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRI 491

Query: 502 --------WDEHPTKTNQVARQVPFQ-PWYLK-------TVAATFIAGIFPFGSIAVELY 545
                    DE      +  R++ ++  W LK       TV +   +GIFPF  I VEL 
Sbjct: 492 SRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQ 551

Query: 546 FIYTSLWYNK--IFYMFGFLFVSFXXXXXXXXXXXXXXXYHSLSLENWQ----WQWRSFI 599
           F+Y S+WY K   +Y +GFL  +                Y  +++ +      W+W++F 
Sbjct: 552 FVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQ 611

Query: 600 VGGVGCAIYMFVHSI--LFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFV 657
           +    CA YM  +SI  +F  L +  F +I++ V YS + + LC L  GSIG+L+S++FV
Sbjct: 612 LSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFV 670

Query: 658 RRIYSS 663
           +R+Y S
Sbjct: 671 KRVYRS 676

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 106/282 (37%), Gaps = 65/282 (23%)

Query: 27  VAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXFHFCQPEK 86
           + PT Y+  D + ++VN +        E++  +   G                 F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNKI--------ESDATQLPYG------------YYDLPFTCPPT 72

Query: 87  IVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQ 144
           + K+P   SL  +I GDR + S Y+++  ++  C  LC           ++K IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 145 NWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRD 203
            W ID  LPAA           +YG+GF LG V              ++++G        
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFV--------------DEETGKV------ 172

Query: 204 AKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTCQTSGD- 261
                        Y  NH  + + YH   + N  +VG  + P S+     PG  +     
Sbjct: 173 -------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQY 219

Query: 262 ----PLMLDEKNDNEVYFTYSVRFVAS-DTVWATRWDKYLHT 298
               P + +E  D  + FTYSV +    D  W  R++ +  +
Sbjct: 220 EVVVPEIANE--DTFIPFTYSVYWREEFDVEWKDRYNLFFDS 259

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 110/226 (48%), Gaps = 22/226 (9%)

Query: 456 LNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQ 515
           LN  +    SS  +P KT+ F++ ++F++ +P +L G   A   C        ++   ++
Sbjct: 433 LNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQK 492

Query: 516 VPFQPWYL-KTVAATF----------IAGIFPFGSIAVELYFIYTSLWYNK--IFYMFGF 562
           +      L +T+ + F          I G+FPF  I VEL  +Y  +W  K   +Y+  F
Sbjct: 493 LAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWF 552

Query: 563 LFVSFXXXXXXXXXXXXXXXY---HSL--SLENWQWQWRSFIVGGVGCAIYMFVHSI--L 615
           LF +                Y   HS   SLEN  W+WRSF +    CA YM ++S+  +
Sbjct: 553 LFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYI 610

Query: 616 FTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661
           F  L   GF +I+L V  SA+ + LC    GSIG+L++ +FV R+Y
Sbjct: 611 FYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 92/257 (35%), Gaps = 42/257 (16%)

Query: 43  NHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXFHFCQPEKIVKEP--ESLGSIIFG 100
           N L+P++Y   + +D E +                   F  P    ++P   SL  I+ G
Sbjct: 35  NRLTPNIY--RKGDDVELIVNKIESDLTKLPYGYYDLPFICPPTNQRKPLHMSLTEILRG 92

Query: 101 DRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDG-LPAARVVHD 159
           DR + S Y +   ++  C  LC      +  +    L+K  +   W ID  LPA+     
Sbjct: 93  DRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAINLVKKDYIVQWSIDNDLPASTTFIS 152

Query: 160 KSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFA 219
            S N  +Y  GF LG V+                                  + E  Y  
Sbjct: 153 TSENRKYYIPGFSLGFVD---------------------------------PDTETAYLN 179

Query: 220 NHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVY---FT 276
           NH  + + YH   + +  +VG+ V P S+          + +   L   +D EV    FT
Sbjct: 180 NHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEVTYIPFT 239

Query: 277 YSVRFVAS-DTVWATRW 292
           YSV +    D  W  R+
Sbjct: 240 YSVYWREEFDVEWKDRY 256

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 86/225 (38%), Gaps = 39/225 (17%)

Query: 79  FHFCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINK 136
             F  P    K+P   SL  II GDR + S Y +   E   C+ LC+     +  +  + 
Sbjct: 72  LQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADA 131

Query: 137 LIKNGFFQNWLI-DGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSG 195
           LI+ G+  +WLI D LPAA       +   FY  GF LG V+ V              +G
Sbjct: 132 LIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAV--------------TG 177

Query: 196 SAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGT 255
             +L                    NH  + V Y         ++G  V P S+  +    
Sbjct: 178 KTRL-------------------YNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPG 218

Query: 256 CQTSGDPLMLDEKNDNEVY--FTYSVRFVASDTV-WATRWDKYLH 297
                 P  ++ +     Y  FTYS+ +     + W+ RW+ ++H
Sbjct: 219 ANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 107/286 (37%), Gaps = 72/286 (25%)

Query: 452 SIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK------------- 498
           +++ LN  +    SS  IP  T+   V  +F+IS P +L G   A K             
Sbjct: 407 TVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAKLAPANAI 466

Query: 499 ---------KCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYT 549
                      S+D        + +  PF       +  T +AGI PF  I VEL+++Y 
Sbjct: 467 SKSPFSFLLTLSYDTRSWPATALGK--PFPIALSNPILLTILAGIAPFVVICVELFYVYK 524

Query: 550 SLWYN--KIFYMFGFLFVSFXXXXXXXXXXXXXXXY------------------------ 583
           S+W      +Y++GFL V+F               Y                        
Sbjct: 525 SMWLQTTNFYYLYGFLLVNFMFLCIIVCEVSLLVCYVLMVHNHSGQAPEIESDPYTKLSN 584

Query: 584 ---------------------HSLSLENWQWQWRSFIVGG-VGCAIYMFVHSILFTKLKL 621
                                H L      W+W+SF+ GG V   + ++    L   L L
Sbjct: 585 SRRCSPITIVNKLKNVLASIAHHLKASFSSWRWKSFVAGGSVAWYLELYSLYYLIFVLHL 644

Query: 622 GGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667
               +I+L+V Y+A+ + +C    G++G+LS ++F+  I SS K  
Sbjct: 645 RDLSSILLFVCYTALFNFMCWCAFGALGYLSCLWFLSHISSSSKAH 690

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 109/306 (35%), Gaps = 71/306 (23%)

Query: 8   LGLALLWACGQVNAF-------YLPG-----VAPTTYKANDEIPLLVNHLSPSMYWQHET 55
           + + LLW+  Q  +        YLP      + P  YK  D++ L VN +        E+
Sbjct: 13  IAVVLLWSVWQSQSLRARRPREYLPPRETGWIKPNVYKRGDKVDLTVNKV--------ES 64

Query: 56  EDGENMKGDKXXXXXXXXXXXXXFHFCQPEKIVKEPE--SLGSIIFGDRIYNSPYQIKML 113
           E      G                 F  P    K+P   SL  +I GDR + S Y ++  
Sbjct: 65  EITNLPYG------------YYDLRFVCPPSETKKPLHLSLDEVIRGDRKWESDYNLEFG 112

Query: 114 EEKTCVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFE 172
             + C  LC+           ++LI+  +  +WLIDG LPAA       +   FY  GF 
Sbjct: 113 VGQDCERLCDRKTMPDGLRQADRLIRENYMVHWLIDGDLPAATTFASTRSGKKFYTAGFP 172

Query: 173 LGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRG 232
           LG V+        KTH                               NH  + + Y    
Sbjct: 173 LGRVD----HETDKTH-----------------------------LHNHLMLVIRYQAFD 199

Query: 233 EGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVY--FTYSVRFVASDTV-WA 289
                +VG  V P S+          S +P +++ +     Y  FTYSV +     + W+
Sbjct: 200 FNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWS 259

Query: 290 TRWDKY 295
            RW+ +
Sbjct: 260 HRWNLF 265

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 101/264 (38%), Gaps = 74/264 (28%)

Query: 465 SSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQ----- 519
           SS  +P  TL  ++  +FVI +P +  G   A K  S   +     Q   +VPF      
Sbjct: 424 SSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQ--SKVPFSFLLSI 481

Query: 520 ----------------PWYLKT-VAATFIAGIFPFGSIAVELYFIYTSLWYNK--IFYMF 560
                           P  L      T + G  PF     EL F+Y SLW  K  ++ ++
Sbjct: 482 EYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLY 541

Query: 561 GFLFVSFXXXXXXXXXXXXXXXYHSL--------------------------------SL 588
           GFL V+F               Y  +                                SL
Sbjct: 542 GFLLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSL 601

Query: 589 ENW-------------QWQWRSFIVGGVGCAIYMFVHSI--LFTKLKLGGFVTIVLYVGY 633
           +N+              W+W++F+ G    A Y  ++S+  L   L L  F +I+L+V Y
Sbjct: 602 KNYMASTARRWKASFSSWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCY 660

Query: 634 SAVISLLCCLVTGSIGFLSSMFFV 657
           +++ +L+C    G++G+L+ ++F+
Sbjct: 661 TSLFNLMCWCAFGALGYLTCLWFL 684

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 99/466 (21%), Positives = 162/466 (34%), Gaps = 100/466 (21%)

Query: 81  FCQPEKIVKEP--ESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138
           F  P    K P   SL  +  GD +  S Y ++  +++ C  LC+     K  +    LI
Sbjct: 97  FVCPPSDTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLI 156

Query: 139 KNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSA 197
           KN +   W +D  LP          N   Y  GF LG                ++ +G A
Sbjct: 157 KNDYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYF--------------DNQTGQA 202

Query: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISI-KRSSPGTC 256
            L+T                   H    V YH        +VG+ V P SI   + PG  
Sbjct: 203 YLNT-------------------HLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPG-- 241

Query: 257 QTSGDPLMLD----EKNDNEVY--FTYSVRFVAS-DTVWATRWDKY------LHTYDPTI 303
             S D + L+    E ND+  Y  F+YSV +    D  W  RWD +      L   D + 
Sbjct: 242 -ASKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSF 300

Query: 304 QWXXXXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIP 363
            W                    L   +  +  R     L N+  +     +T     R P
Sbjct: 301 HWYSLINSNSITVGVIT----FLCLVISMNRMRI----LYNKSWKKRQLSITTTTTTRYP 352

Query: 364 SKSMLLSILVGSGIQLFLM--------------------ISVSIFFAALGFLSPSSRGSL 403
           +   + +I + SGIQ F +                    I V++FF A G +     G+L
Sbjct: 353 N---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTL 409

Query: 404 GTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVGLNMFLLGA 463
               F+L                  F   Y+  N I            S+  +N  +  +
Sbjct: 410 IQRTFILTN----------------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLS 453

Query: 464 HSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKT 509
             +   P K   +    +F++S+P ++   +++ +  S+ ++P+++
Sbjct: 454 EKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 106/495 (21%), Positives = 180/495 (36%), Gaps = 70/495 (14%)

Query: 27  VAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXXFHFCQPEK 86
           V P TY   D + ++VN +        ++ +G + K                 + C P  
Sbjct: 46  VHPNTYTFGDPVEVIVNKMVQEKDMLGDSNEGVSYKYHDLP------------YICPPTN 93

Query: 87  IVKE-PESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQN 145
             K    SL  +  GD    S Y +K   +  C  LC             ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 146 WLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDA 204
           W ID  LPAA       T    Y  GF LG               K+ ++GS        
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGW--------------KDPETGSY------- 192

Query: 205 KNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPGTCQTSGDPL 263
                       Y  NH  + + Y+   +    +VG  V P SI     PG  +  G   
Sbjct: 193 ------------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYE 240

Query: 264 MLDEKNDNE---VYFTYSVRFVAS-DTVWATRWDKY-------LHTYDPTIQWXXXXXXX 312
           + D +N++E   + F+YSV +    +  W TRW  +       L   D ++Q        
Sbjct: 241 LKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLL 300

Query: 313 XXXXXXXXXXXHML----LKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSML 368
                        +    +  L  D   +  + + N  +    W  T   + +   K++L
Sbjct: 301 HWYSPYTTVIIFTILLFLVSLLVLDINSHKLVFMSNP-KTVIAWATTANKLNK-TWKNIL 358

Query: 369 LSILVGSGIQ-LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYA--LFG-FVGSYTSMG 424
           L+ILV  G Q LF+ + V +  ++L  L   S   +  ++  + A  L G FVG++  M 
Sbjct: 359 LNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMY 418

Query: 425 VYKFFRGPYWKANM-IXXXXXXXXXXXXSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFV 483
           +++    P +   M I             +   N        + + P + L +++ ++F+
Sbjct: 419 MFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFI 478

Query: 484 ISVPSALAGSLIAHK 498
            S+P +L G  +A K
Sbjct: 479 FSIPMSLIGGSLAVK 493

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 79/206 (38%), Gaps = 37/206 (17%)

Query: 93  SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLP 152
           SLG +   +  + S Y + +  E  C PLC   +       + ++I++G    W +DGLP
Sbjct: 83  SLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLDGLP 142

Query: 153 AARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDAKNVQMLKN 212
           AA    D+ + S  Y  GF+LG V+               ++G  +L             
Sbjct: 143 AATTYPDRQS-SYRYEAGFKLGEVDA--------------ETGHVRLH------------ 175

Query: 213 VELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLML--DEKND 270
                  NH  + V Y    +G   +VG    P S+        QT  +   L  D +  
Sbjct: 176 -------NHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNPDAQAM 228

Query: 271 NEVYFTYSVRFVASDTV-WATRWDKY 295
             V FTY+V +     V W  RW  Y
Sbjct: 229 IMVPFTYAVYWRYQSAVKWNERWRLY 254

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 82/224 (36%), Gaps = 38/224 (16%)

Query: 82  CQPEKIVKEPE-SLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKN 140
           C P K  +    SL  +  GDR + S Y++    E  C  LC            + LI+ 
Sbjct: 76  CTPTKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQ 135

Query: 141 GFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKL 199
            +    LID  +PA++       N  +Y  GF LG V+           P+ D       
Sbjct: 136 NYTVQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD-----------PETD------- 177

Query: 200 STRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRS-SPGTCQT 258
                          + Y  NH  + + Y+        +VG  V P S+     PG+ + 
Sbjct: 178 ---------------VTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKD 222

Query: 259 SGD-PLMLDEKNDNEVYFTYSVRFVASDTV-WATRWDKYLHTYD 300
             +  +   EK+   +  TYSV +     V W  RW+ YL   D
Sbjct: 223 YENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGD 266

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 100/245 (40%), Gaps = 57/245 (23%)

Query: 469 IPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEH----------------PTK---- 508
           +P + +  ++ L+F++S+P +L G   A  K   D+H                P+K    
Sbjct: 428 MPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFW 486

Query: 509 ---------TNQVA-RQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNK--I 556
                    T   A  Q+P   W  K    T I GI PF +I +++ FI+  LW +   +
Sbjct: 487 FNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSL 544

Query: 557 FYMFGFLFVSFXXXXXXXXXXXXXXXY-------------------HSLSLENWQWQWRS 597
           F ++  L +                 Y                     +S     W+W++
Sbjct: 545 FQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKA 604

Query: 598 FIVGGVGCAIYMFVHSILFTK--LKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMF 655
           F +GG   A Y   +S+ +    L+L  F +I+LY+ Y  ++++      GSIG+L+  +
Sbjct: 605 FYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCW 663

Query: 656 FVRRI 660
           F+ ++
Sbjct: 664 FLNKL 668

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 128/704 (18%), Positives = 247/704 (35%), Gaps = 138/704 (19%)

Query: 27  VAPTTYKANDEIPLLVNH--------LSPSMYWQHETEDGENMKGDKXXXXXXXXXXXXX 78
           + P  YK  D + LLVN         L P +Y  H+                        
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLNADLKPYIY--HD------------------------ 80

Query: 79  FHFCQPEKIVKEPESL--GSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINK 136
             F  P   V++P  L   S+  GD +  S Y++K  ++  C  LC              
Sbjct: 81  LPFVCPPTSVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAID 140

Query: 137 LIKNGFFQNWLIDG-LPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSG 195
           +IK  +   W ID  LP +       T    Y  GF LG  +                  
Sbjct: 141 MIKQDYQILWSIDDELPISMPYISTITQRKKYIPGFPLGRFD------------------ 182

Query: 196 SAKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKR-SSPG 254
                 +D   V         Y  NH  + + Y+   +    +VG  V   S+     PG
Sbjct: 183 ------KDKNKV---------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPG 227

Query: 255 TCQTSGDPLMLDEKNDNE---VYFTYSVRFVAS-DTVWATRW---DKYLHTYDPTIQWXX 307
             +   +  ++  +ND++   + FTYSV +    D  W +RW   D  +   DP +    
Sbjct: 228 ASKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKS 287

Query: 308 XXXXXXXXXXXXXXXXHMLLKALRSDFARYNELNLDNEFQEDSG-----WKLTHGDVFRI 362
                            +++ ++     +  E    N+F  ++      W  ++    + 
Sbjct: 288 MLSNIMQPTRTGLFLLPLIIFSII--IVKVVENGEKNKFTTEAQLASKCWIESNNINLKS 345

Query: 363 PSKSMLLSILVGSGIQ-LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYT 421
              + +L++++  G+Q +F +I + I   ++  L   S   L  +   ++ + G + S  
Sbjct: 346 SFSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIF--IWFIEGILASS- 402

Query: 422 SMGVYKFFRGPYWKANMIXXXXXXXXXXXXSIVG------LNMFLLGAHS-------SGT 468
                  F G + + N++             + G      L +F+   HS       S  
Sbjct: 403 -------FLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSR 455

Query: 469 IPAKTLFFIVLLWFVISVPSALAGSLIAHK----------KCSWDEHPTKTNQVAR-QVP 517
            P KTL  ++  +++I VP ++ G  +A K            + D      ++  R +  
Sbjct: 456 YPFKTLTMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQ 515

Query: 518 FQPW-----YLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFYM-------FGFLFV 565
            +P       L T+  + I  I PF  I  ELY+I+T+ W N   ++            +
Sbjct: 516 HRPSSINKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFII 575

Query: 566 SFXXXXXXXXXXXXXXXYHSLSLENWQ-----WQWRSFIVGGVGCAIY-MFVHSILFTKL 619
                                 +  W+      +W  F+     C +  ++    +   +
Sbjct: 576 IITVSSTSLVGLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSLYYIIEVI 635

Query: 620 KLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSS 663
           ++ GF   VL + Y+  ++++  +  G+I +++  + + ++Y +
Sbjct: 636 RIHGFSMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLYKN 679

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,965,313
Number of extensions: 2616848
Number of successful extensions: 7852
Number of sequences better than 10.0: 47
Number of HSP's gapped: 7828
Number of HSP's successfully gapped: 76
Length of query: 667
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 551
Effective length of database: 40,180,143
Effective search space: 22139258793
Effective search space used: 22139258793
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)