Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F029306.28ON38638620860.0
Kpol_1037.236.28ON37838610421e-140
NCAS0D021406.28ON37638410161e-136
TDEL0G044106.28ON38138610131e-136
NDAI0C026506.28ON38939310071e-135
ZYRO0C07546g6.28ON3773869931e-133
Suva_15.1726.28ON3983859941e-133
Smik_15.1676.28ON3783879741e-130
TPHA0J003906.28ON3803859671e-129
CAGL0E02497g6.28ON3763839541e-127
Skud_15.1596.28ON3793859521e-127
YOL003C (PFA4)6.28ON3783869471e-126
Ecym_30326.28ON3773859301e-123
SAKL0E01518g6.28ON3793889221e-122
KLLA0C06204g6.28ON3773868851e-116
Kwal_56.224596.28ON3833898831e-116
KAFR0A051306.28ON3964028721e-114
KLTH0C10978g6.28ON3773858631e-113
ACL003C6.28ON3753848491e-111
TBLA0B004806.28ON3774105016e-59
NCAS0E013003.12ON3271542044e-17
Ecym_20143.12ON3391202011e-16
KNAG0K025703.12ON3281402001e-16
TPHA0P015603.12ON331901965e-16
CAGL0D02508g3.12ON3321451931e-15
Kpol_1014.293.12ON326741912e-15
KAFR0A085903.12ON3312131912e-15
TBLA0H001503.12ON3451631904e-15
TPHA0C010708.286ON3331621894e-15
SAKL0C13596g3.12ON3332311861e-14
NDAI0G013403.12ON3351391851e-14
SAKL0H16434g8.286ON5551501862e-14
Suva_14.153.12ON3301381823e-14
KLTH0F19580g3.12ON342611824e-14
KLLA0E02069g3.12ON3251151814e-14
Skud_14.153.12ON3361381806e-14
TDEL0F041308.286ON328991806e-14
SAKL0H13860g8.389ON3521411806e-14
Skud_4.3878.286ON336831807e-14
ZYRO0C03410g3.12ON3271861781e-13
YNL326C (PFA3)3.12ON3361381781e-13
TDEL0A003103.12ON329551771e-13
NCAS0B035908.286ON3291231771e-13
KAFR0B053708.286ON329691753e-13
Kwal_55.221263.12ON3601561744e-13
Smik_14.63.12ON3341371735e-13
YDR126W (SWF1)8.286ON336671726e-13
NCAS0C029208.389ON3741121736e-13
TBLA0H009208.389ON3601001727e-13
ZYRO0C04092g8.389ON3661211701e-12
ADL197C3.12ON390671702e-12
KLTH0F08668g8.389ON358941692e-12
Smik_4.3728.286ON335851673e-12
Suva_2.2898.286ON335591655e-12
NDAI0J010008.286ON3391511656e-12
KNAG0A027108.389ON3541271648e-12
Smik_12.3068.389ON359851631e-11
ZYRO0D06600g8.286ON330591621e-11
KLLA0D18370g8.389ON3551281621e-11
CAGL0B01991g8.286ON3301571611e-11
YLR246W (ERF2)8.389ON359691612e-11
NDAI0G022508.389ON389791622e-11
TBLA0D040408.286ON3291851602e-11
Suva_10.3428.389ON356841603e-11
Skud_12.3218.389ON356801585e-11
KLLA0F19690g8.286ON324951566e-11
TDEL0F051308.389ON359561567e-11
Kpol_1033.168.286ON321871531e-10
Ecym_41788.389ON3681171541e-10
CAGL0G08217g8.389ON326821532e-10
KAFR0H019808.389ON361961532e-10
Ecym_42828.286ON3401441522e-10
TPHA0C023608.389ON404561505e-10
Kwal_23.33028.389ON353691495e-10
KLTH0G13112g8.286ON349641452e-09
AGL125C8.389ON367571442e-09
Kwal_56.236978.286ON3381901391e-08
AGR065W8.286ON326441362e-08
KNAG0H031108.286ON331931353e-08
ZYRO0D13860g5.579ON3652101311e-07
KAFR0I011105.579ON370761265e-07
Ecym_41145.579ON3721171248e-07
NCAS0F013905.579ON3741271231e-06
KNAG0C028305.579ON354761212e-06
TBLA0E028305.579ON386741194e-06
TDEL0A044405.579ON365601141e-05
Skud_4.7345.579ON3801201132e-05
NCAS0C052805.626ON7571461133e-05
Suva_2.6345.579ON3881081088e-05
Kpol_526.325.626ON7771181099e-05
KLLA0D06149g5.579ON3491031071e-04
Kpol_1004.575.579ON362581071e-04
KLTH0G04972g5.579ON367671061e-04
NDAI0H018905.579ON406831052e-04
YDR459C (PFA5)5.579ON374481042e-04
KLTH0E02420g5.626ON734641053e-04
SAKL0G06160g5.579ON364511033e-04
TBLA0J008305.626ON7391051044e-04
Smik_4.7375.579ON378481015e-04
Kwal_47.183665.579ON356511007e-04
TPHA0C003705.626ON759113990.001
KNAG0B031405.626ON682102990.001
CAGL0K06347g5.579ON35254960.002
ZYRO0C11132g5.626ON759240960.003
CAGL0M08712g5.626ON763101940.005
Suva_2.4325.626ON76353940.005
Suva_8.875.626ON73056920.009
NDAI0H008505.626ON78666920.009
Ecym_13305.626ON739243920.009
Smik_4.5155.626ON76453920.010
KNAG0C062305.626ON752104920.010
KAFR0H005705.626ON75758890.019
ABR203W5.579ON35960880.019
YDR264C (AKR1)5.626ON76469890.023
Skud_4.5275.626ON76453880.027
YOR034C (AKR2)5.626ON74956870.037
AER388C5.626ON72452860.051
TDEL0A049205.626ON75060850.062
SAKL0G07326g5.626ON73754840.078
Smik_15.2135.626ON74456810.18
KAFR0C059605.626ON727262800.26
KLLA0E16721g5.626ON75267780.49
Skud_15.1995.626ON74145722.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F02930
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   808   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   405   e-140
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   395   e-136
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   394   e-136
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     392   e-135
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   387   e-133
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   387   e-133
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   379   e-130
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   377   e-129
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   372   e-127
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   371   e-127
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   369   e-126
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   362   e-123
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   359   e-122
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   345   e-116
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   344   e-116
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   340   e-114
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   337   e-113
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   331   e-111
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   197   6e-59
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    83   4e-17
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    82   1e-16
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    82   1e-16
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    80   5e-16
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    79   1e-15
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    78   2e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    78   2e-15
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    78   4e-15
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    77   4e-15
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    76   1e-14
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      76   1e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    76   2e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    75   3e-14
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    75   4e-14
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    74   4e-14
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    74   6e-14
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    74   6e-14
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    74   6e-14
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    74   7e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    73   1e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    73   1e-13
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    73   1e-13
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      73   1e-13
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    72   3e-13
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    72   4e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    71   5e-13
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    71   6e-13
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     71   6e-13
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    71   7e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    70   1e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    70   2e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    70   2e-12
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    69   3e-12
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    68   5e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    68   6e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    68   8e-12
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    67   1e-11
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    67   1e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    67   1e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    67   1e-11
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    67   2e-11
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   2e-11
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    66   2e-11
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    66   3e-11
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    65   5e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    65   6e-11
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    65   7e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    64   1e-10
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    64   1e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   2e-10
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    64   2e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    63   2e-10
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    62   5e-10
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    62   5e-10
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    60   2e-09
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    60   2e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    58   1e-08
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    57   2e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    57   3e-08
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    55   1e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    53   5e-07
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    52   8e-07
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    52   1e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    51   2e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    50   4e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    49   1e-05
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    48   2e-05
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    48   3e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   8e-05
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    47   9e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    46   1e-04
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    46   1e-04
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    45   1e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    45   2e-04
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    45   2e-04
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    45   3e-04
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    44   3e-04
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    45   4e-04
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    44   5e-04
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    43   7e-04
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    43   0.001
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    43   0.001
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    42   0.002
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    42   0.003
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    41   0.005
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    41   0.005
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    40   0.009
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    40   0.009
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    40   0.009
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    40   0.010
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    40   0.010
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    39   0.019
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    39   0.019
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    39   0.023
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    39   0.027
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    38   0.037
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    38   0.051
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    37   0.062
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    37   0.078
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    36   0.18 
KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa] ...    35   0.26 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.49 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   2.3  

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
           LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
           PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 361 PIESRTTWENQWGETLEGFGVDPMNE 386
           PIESRTTWENQWGETLEGFGVDPMNE
Sbjct: 361 PIESRTTWENQWGETLEGFGVDPMNE 386

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 265/386 (68%), Gaps = 16/386 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIAIPC LI FI Y AH+FIL N LS  +QI F+  +TMIWISYY+AIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKP  GS           YC KCN +KPER+HHCKTCQQCVLMMDHHCPWTMNC+G+ 
Sbjct: 61  NPGKP--GSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYK 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP F+RFL WVI+TT+ L ++L+ RI  +W++RN+P           E++ L + TPMD
Sbjct: 119 NFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLP----SYLFNKSEIIFLTITTPMD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TI+ LF+RC  NQ++ G TQIE+WE ERL+++FY ++L P +I  +WE  P  +T
Sbjct: 175 GFVLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKT 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
           P++E +AEK++       ++F  +V+FPYD+ L+ NI   LGSP+  LW +    G+G+ 
Sbjct: 235 PDNEAKAEKIVSKR----IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGML 290

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           F+KN+ S +E++  + D +L L WPPDGG+   + +     + I+ + +DGE +IRKR S
Sbjct: 291 FKKNEYSLFEEDSILEDQILSLPWPPDGGKHGFNIEN-SSTNSIETSTKDGEHVIRKR-S 348

Query: 361 PI----ESRTTWENQWGETLEGFGVD 382
           P+    ESRT W N WGE LE FGVD
Sbjct: 349 PVSKLLESRTQWYNDWGENLEDFGVD 374

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  395 bits (1016), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 261/384 (67%), Gaps = 14/384 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW G+ IPC L  FIGY AH F+L N +S K Q+ FQ  LTM+WISY +AI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG+P    + +    +   +C KC  FKPER+HHCKTC QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGRP--AKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFK 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP F+RFL WV++TT  L + LL R   +W  +++P           E+  L++L PMD
Sbjct: 119 NFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLP----SYLFEKTEITFLIILIPMD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL T+  LF+RC++NQ+IGG TQIESWE+ERL+N++Y KKLLP ++  +WE +P+E+T
Sbjct: 175 GFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKT 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
           PE+++ A+KL E   +  ++F ++V FPYD+D+ +N    LGSP+  LW F     +G+ 
Sbjct: 235 PENKVLAKKLQERGRK--VRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMH 292

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           F+KN+++ YE+  +I DLLL L WPPDGGR     +  +    ++   E+GE +IR+RN 
Sbjct: 293 FKKNELALYEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN----VESITENGEQVIRQRNF 348

Query: 361 PIES--RTTWENQWGETLEGFGVD 382
             ++  R TW N WGE LE FGVD
Sbjct: 349 ENDNSYRKTWNNDWGENLEDFGVD 372

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 257/386 (66%), Gaps = 16/386 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIAIPC L+ FIGY  H+FIL N LS  +Q+ FQ  L +IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKP-PHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGF 119
           NPG+P P+    ++   +   YC KC  +KPER+HHCKTC QCVLMMDHHCPWTMNC+G 
Sbjct: 61  NPGRPRPNFEVPKY---EWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117

Query: 120 GNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPM 179
            NFP F+RFL+WVI+ T+ L + L+ RI  +W+ RN+P           ELV L +LTP+
Sbjct: 118 NNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLP----DYMFHRSELVFLTILTPL 173

Query: 180 DLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQ 239
           D FVL TIT L  RC+ NQ+  GM+QIE+WE+ERLQ +F SK+L+P++IE  W+ FP  +
Sbjct: 174 DAFVLLTITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTR 233

Query: 240 TPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGV 299
              +E  A + L MN++  L+   VVNFPYD+D  +N  Q LG+P+L LWPF   +G+G+
Sbjct: 234 EQINESTAAE-LSMNKE--LRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGM 290

Query: 300 TFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR- 358
           +F KN+IS Y    S  DLLL L WPPDGGR    P     +  I+   + GE +IR+R 
Sbjct: 291 SFVKNEISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSS--IESITKQGEQLIRRRP 348

Query: 359 --NSPIESRTTWENQWGETLEGFGVD 382
              S +  R  W+N WGE LE FGVD
Sbjct: 349 NDTSDLIGRRQWQNDWGENLEDFGVD 374

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  392 bits (1007), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 259/393 (65%), Gaps = 21/393 (5%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M ++LK PW G+AIP  +I FIGY +H+FIL N LS K+QI FQF L+MIW+SY +AI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPPHGSA--QQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLG 118
           NPGKPP        +     N +C KCN +KPERSHHCKTC QCVLMMDHHCPWTMNC+G
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 119 FGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTP 178
           + NFP F+RFL+W+IITT  L  +LL R   +W  R++P           E++ L +L P
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLP----SYIFDRNEIIFLTILIP 176

Query: 179 MDLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHE 238
           MD F+L TI+ LF+RC  NQ++ GMTQIE WE+ERL+N+FY+KKLLP++I  +WE +P+E
Sbjct: 177 MDAFILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNE 236

Query: 239 QTPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNG 298
           +T   +  A+ LL   ++  ++F ++VNFPYD+D+ TN++  +GS    +W F     NG
Sbjct: 237 RTKVADNYADDLLSRRKK--VRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNG 294

Query: 299 VTFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR 358
           + F+KN+IS YE   S+ DLLL L WPPD GR       +D +  ++  V DGE ++R R
Sbjct: 295 LKFEKNEISLYEPGSSVEDLLLSLPWPPDKGRNF--ISNKDTS--VESLVYDGEQVVRNR 350

Query: 359 NSPIE---------SRTTWENQWGETLEGFGVD 382
            S            SR  W N WGE+L  FGVD
Sbjct: 351 ASNDTNISTINKDISREEWNNDWGESLVDFGVD 383

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  387 bits (993), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 252/386 (65%), Gaps = 17/386 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPVQLK P+ GIAIPC LI FIGY AH+FIL N LS ++QI F+F LTMIW SYY+AIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
            PG+P      Q +      YC KC  +KPER+HHCKTC QCVL MDHHCPWT NC+G+ 
Sbjct: 61  LPGQPLPNF--QPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYY 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP FMRFL WVI TT  L + L LR   I    N P           EL+ L +L PMD
Sbjct: 119 NFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSP----TYLWNKSELIFLTILIPMD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            F+L TI+ LF+RC++NQ+  G TQIE+WE ERL+ ++YSK+LLP ++   WE +P  +T
Sbjct: 175 GFILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRT 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            E E EA +L      GL     +VNFPYD+D  +N  + LGSP+  LWPF   +G+G+ 
Sbjct: 235 RELEDEASRLSTRRRIGL---DHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMF 291

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358
           F KNDIS +E+  +++D+LL L WPPDGG+        DG + ++ TV DGE +IRKR  
Sbjct: 292 FPKNDISEFEET-NLTDMLLALPWPPDGGKD--KVISIDGPNAVETTVRDGEQVIRKRLV 348

Query: 359 --NSPIESRTTWENQWGETLEGFGVD 382
               P  SRT W+N WGE LE FGVD
Sbjct: 349 DPRDP-SSRTQWQNTWGENLEDFGVD 373

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  387 bits (994), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/385 (51%), Positives = 254/385 (65%), Gaps = 14/385 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M V+LK PW GIAIP  LI FIGY AH+FIL N LS  +QI F+  L+MIW+SYY+AIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKP      Q        YC KC  +KPERSHHCK C QCVLMMDHHCPWTMNC+GF 
Sbjct: 81  NPGKP--SPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFK 138

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           N+P F+RF+ WVI TT  LF   L R++ IWQ R++P  G +   +  ELV L +LTP++
Sbjct: 139 NYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLP--GYLFKKS--ELVFLTILTPLN 194

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TI  LF+RC+ NQ+I G +QIESW+M+RL+++F S++L+  +IE  W  +P  ++
Sbjct: 195 FFVLLTIVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARS 254

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
           P+ E +AEKLL    Q  ++F  VVNFPY++DL TN    LG   L LWP     G+G +
Sbjct: 255 PQLERDAEKLL---TQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNS 311

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358
           FQKNDIS YE N S+ D++L L WPPDGG+        + A  I+   E GE ++R R  
Sbjct: 312 FQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLA--IETCNEGGEQVVRSRIA 369

Query: 359 -NSPIESRTTWENQWGETLEGFGVD 382
            +    +R  W N WGE+L+ FGVD
Sbjct: 370 QHGRSATREKWYNDWGESLDDFGVD 394

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  379 bits (974), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 196/387 (50%), Positives = 251/387 (64%), Gaps = 18/387 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M V+L+ PW GIAIP  LI FIGY AH+FIL N L   +QI F+F L+MIW SYY+AIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG+P      Q T G    +C KC  +KPERSHHCKTC QCVLMMDHHCPWTMNC+GFG
Sbjct: 61  NPGRPL--PNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFG 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           N+P F+RFL W+IITTS LF   + RI  IWQ RN P  G +   +  EL  L +L+P++
Sbjct: 119 NYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFP--GYLFKKS--ELTFLTILSPLN 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TIT LF+RC+ NQ++ G +QIESW+M+RL+++F S++L+  +I   W  +P  +T
Sbjct: 175 FFVLLTITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKT 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            +HE +AE LL+        F  +VNFPY+ DL TN    LG   L LWP+    GNG  
Sbjct: 235 LQHERDAEGLLKQQRS---SFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNN 291

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGR--RIPHPQREDGAHMIDQTVEDGEFMIRKR 358
           F KNDIS YE +  + D++L L WPPDGG    + +P+       I+   E GE ++R R
Sbjct: 292 FPKNDISNYEVDSPLEDIILSLPWPPDGGETTTVSNPK----TSTIETCNEGGEQVVRSR 347

Query: 359 ---NSPIESRTTWENQWGETLEGFGVD 382
              N    SR  W N WGE+L+ FGVD
Sbjct: 348 VAQNGRSASREKWFNDWGESLDDFGVD 374

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  377 bits (967), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 259/385 (67%), Gaps = 13/385 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+ K PW GIAIPC LI FIGY +H++ILR  LS  +Q  F+F LTMIW+SYYMAI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKP  G   +    +   +C KCN +KPERSHHCKTC QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKP--GKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFN 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP FMRFL+W++ TT  L +Y + RI  +W  RN+P           E+++L V TP++
Sbjct: 119 NFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLP----SYLFERSEVIALFVCTPLN 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
           LF+L TIT LF RC+ NQ+I G TQIE WEM+RL+N FY KKLLP +I  +WE +P  ++
Sbjct: 175 LFILLTITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKS 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            +H+ EAE+L+E  ++G +++ S+VNFPYD+ +  NI   +G P+  LWPF    GNG+ 
Sbjct: 235 AKHDEEAERLIE--KKG-IRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMN 291

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358
           F+KN+I+ ++ + S+    L L WPPD GR   + +  +    ++    DGE ++R R  
Sbjct: 292 FEKNEIALFDPDSSLPVFTLALPWPPDKGRH-NNSKTLNTDSNVEFITTDGEQVVRNRTH 350

Query: 359 -NSPIESRTTWENQWGETLEGFGVD 382
             +PI SR  W N+WGE LE FGVD
Sbjct: 351 AKNPILSREEWFNEWGENLEDFGVD 375

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  372 bits (954), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 251/383 (65%), Gaps = 12/383 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIAIP  LI  IGY AH+FIL N LS ++Q+ +QFC TMIW+SYY+AIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
            PGKPP  +  + +  +   YC KC  +KPERSHHCKTC QCVLMMDHHCPWTMNC+G+ 
Sbjct: 61  PPGKPP--TNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYN 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP F+RFL WVI+ T+ L  +L  RI +IW  R+ P      S    EL+ L +LTP++
Sbjct: 119 NFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKS----ELIFLTILTPLN 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            F+L TI+ L +RC+ NQ+  G +QIESWEM+RL+ +    KLLPI+IE VW  FP+ + 
Sbjct: 175 AFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRN 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
              E +AE LL    +  L    +VNFPYD+    N  Q LG+P L L+PFS  Q +G+ 
Sbjct: 235 EHVESQAEALL---NKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLH 291

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           FQKN+ S  ED  S++D++LCL WPPD  + +      +    +    E+GE +IR R  
Sbjct: 292 FQKNEESMIEDPNSLNDIILCLPWPPDSTKHL--NSTSEHTSNVQIISEEGEQVIRIRTP 349

Query: 361 PIE-SRTTWENQWGETLEGFGVD 382
             + SR+ W N WGE+LE FGVD
Sbjct: 350 EKKLSRSEWLNDWGESLEDFGVD 372

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  371 bits (952), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 254/385 (65%), Gaps = 13/385 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M V+LK PW GIAIP  LI FIGY AH+FIL N LS  +Q++F+  L+MIW+SYY+AIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           N G+P      + +      +C KC  +KPERSHHCK C QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NAGRPLPN--YRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFR 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           N+P F+RFL WVI+TTS LF   + RI  IWQ R++P  G +   +  EL+ L +L+P+D
Sbjct: 119 NYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLP--GYLFEKS--ELIFLTILSPLD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TI  LF+RC++NQ+I G +QIESW+M+RL+++  S KL+P +I+  W  +P  ++
Sbjct: 175 FFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARS 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            +HE +A+KLL   ++G  +F  +V+FPY+ +  TN    LG   L LWP+ T  G+G +
Sbjct: 235 SQHERDADKLL--TQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNS 292

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           F KNDIS YE N  + D++L L WPPDG +        +    I+   E GE ++R RN+
Sbjct: 293 FPKNDISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNA 350

Query: 361 PIES---RTTWENQWGETLEGFGVD 382
              S   R  W N WGE+L+ FGVD
Sbjct: 351 QHGSDAIREKWYNDWGESLDDFGVD 375

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  369 bits (947), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 250/386 (64%), Gaps = 16/386 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+L+ PW GIAIP  LI FIGY AH+FIL N LS  +QI F+FCL+MIW+SYY+AI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPPHGSAQQHTDGDMNR-YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGF 119
           NPG+P           D+ R +C KC  +KPERSHHCKTC QCVLMMDHHCPWTMNC+GF
Sbjct: 61  NPGRP---LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGF 117

Query: 120 GNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPM 179
            N+P F+RFL W+I+TTS LF     RI  IWQ R++P  G     +  EL+ L + +P+
Sbjct: 118 ANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLP--GYFFKKS--ELIFLTISSPL 173

Query: 180 DLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQ 239
           + FVL TIT LF+RC+ NQ++ G +QIESW+M+RL+++F S +L   +I+  W  +P  +
Sbjct: 174 NSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESR 233

Query: 240 TPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGV 299
           + +++ +AE+ L        +F  +VNFPYD DL TN    LG   L LWP+    G+G 
Sbjct: 234 SFQNKKDAEEHLTKKRP---RFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGN 290

Query: 300 TFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR- 358
            F KN IS YE N S+ D +L L WPPDGG+   +     G+  I+   E GE +IR R 
Sbjct: 291 NFPKNGISKYEANSSLEDHILSLPWPPDGGKT--NTVFNHGSSTIEMRNESGEQLIRTRL 348

Query: 359 --NSPIESRTTWENQWGETLEGFGVD 382
             N    SR  W N WGE+L+ FGVD
Sbjct: 349 PQNGRHASREKWYNDWGESLDDFGVD 374

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 245/385 (63%), Gaps = 16/385 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIAIPC LI FIGY A  F+L+  LS K+QI FQF LTMIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG P  G   Q    +   YC KC  FKPER+HHCKTC QCVL+MDHHCP+TMNC+G+ 
Sbjct: 61  NPGSPVPGF--QPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYN 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP FMRFL W+I TT+ L      R   +W  R+          T KE++ L +LTP +
Sbjct: 119 NFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRH----STAQLVTKKEIIFLTILTPAN 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TI+ LF RC+ NQV+ GMTQIE+WEM+R+++MFY+++L+P ++  + E +P+   
Sbjct: 175 AFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNS-L 233

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
             H+ E +++L   +   + F  +VNFPYD D   N+   +G  +  L PF    GNG+ 
Sbjct: 234 DGHKGEIDRILNNRK---ISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMV 290

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           F+KN++S YE   +++D LL L WPPDG R    P   +    ++ +  +GE +IRKR+ 
Sbjct: 291 FEKNELSAYEHGSTLTDKLLSLPWPPDGERA---PNSSNSRLKVESSTRNGEHIIRKRSP 347

Query: 361 PIE---SRTTWENQWGETLEGFGVD 382
                 SRT W N WGE L  FGVD
Sbjct: 348 EPRLNLSRTEWYNDWGENLAHFGVD 372

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 252/388 (64%), Gaps = 19/388 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M V+LK PW GIAIP  LI FIGY AH+FIL N L  K+Q+ F+F L MIWISYY+AIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKP  G   + +  +   +C KCN +KPER+HHCK C QCVL MDHHCPWTMNC+G  
Sbjct: 61  NPGKPTPGF--RPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHR 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NF  F+RFL WVI TTS L  YL+ RI  +W  R+MP           EL+ L +LTPMD
Sbjct: 119 NFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMP----NYFVHRSELIFLTILTPMD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL TI+ L +RC  NQ++ GMTQIESWEM+R++NMF+S +L+P M+E + E  P   +
Sbjct: 175 AFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            + + +  KLL  N    L    +VNFPYD++   N   SLG     + P+ TA+GNG+ 
Sbjct: 235 NQDD-DIRKLLSQNR---LSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMI 290

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGR-RIPHPQREDGAHMIDQTVEDGEFMIRKRN 359
           F+KN++S YE  + I D LL L WPPDGGR ++P     D  ++++ +  DGE ++RKR 
Sbjct: 291 FEKNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGAND-VNIVESSTRDGERVVRKR- 348

Query: 360 SPIESRTT-----WENQWGETLEGFGVD 382
             ++ RTT     W N WGE L  FGVD
Sbjct: 349 -WVDPRTTMPRKKWYNDWGENLADFGVD 375

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  345 bits (885), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 242/386 (62%), Gaps = 17/386 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M ++LK  W G+AIP  L+  IGY +H+FIL N LS   QI +Q C TMIW+SYY+AIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG PP     + +  + + YC KC  +KPER+HHCKTC QCVL MDHHCPWT+NC+G  
Sbjct: 61  NPGIPPKDF--KPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHS 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP FMRFL WVI +T+ L + L+ RI  +W  R+          +T E++ + ++TPMD
Sbjct: 119 NFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFH----HRSTSEIIFICIMTPMD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FVL T+++L  RC+ NQ + GMTQIESWEM+R+Q++ Y  +LL  +I+R+ E+ P E  
Sbjct: 175 AFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRP-EIL 233

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
           P  + E  KLL         F+   NFPYDV+  TNI+ ++G   L LWP+S     G +
Sbjct: 234 PAKQHEINKLLSKRYVNQEDFT---NFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTS 290

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGA-HMIDQTVEDGEFMIRKRN 359
           F KN++  Y+ N SI D+L+ L WPPDG   + H  R  G+   I+  V  GE +IR ++
Sbjct: 291 FAKNELFFYDPNSSIEDMLMSLPWPPDG---LTHHSRALGSGSSIETIVSGGEQVIRDKS 347

Query: 360 SPIES---RTTWENQWGETLEGFGVD 382
             +     R +W N WGE L  FGVD
Sbjct: 348 VDLRDRLGRNSWYNDWGEDLSDFGVD 373

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  344 bits (883), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 246/389 (63%), Gaps = 16/389 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIAIP SLI FIGY +H+FIL N LS  +Q+ FQ CL+MIWISY +AI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPGKPP G   Q         C KC  +KPER+HHCKTC QCVL+MDHHCPWTMNC+G  
Sbjct: 61  NPGKPPTGF--QPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHN 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP F+RFL+WVIITTS L + L  RI   WQ R+  I    +     ELV + + TP++
Sbjct: 119 NFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKI-----ELVFIFINTPLN 173

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            FV  TI  L +RC  NQ + GMTQIE WE ER++N F + +L+P ++E + E +  +  
Sbjct: 174 AFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDIL 233

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
             +   A+KL+   +   L+   +VNFPYD++++ N   ++G+ +  + P+S+  GNG+ 
Sbjct: 234 --NSPNAKKLINARD---LQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLK 288

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           F KND+S+Y+   +I D LL L WPPDGGR+ P    +  +  I+     GE ++RKR  
Sbjct: 289 FTKNDLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSR-IEMHSSRGEPVLRKRLR 347

Query: 361 PIE---SRTTWENQWGETLEGFGVDPMNE 386
                  RT W N WGE L  FGVD  +E
Sbjct: 348 DPRINMQRTEWYNDWGENLSDFGVDVESE 376

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  340 bits (872), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/402 (45%), Positives = 246/402 (61%), Gaps = 22/402 (5%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M +QLK PW GIAIP  LI FIGY AH+FIL + LS K Q+ FQF L+MIW+SYY+AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           +PG P      +     +  YC KC+ +KP R+HHCKTC +C+LMMDHHCPWTMNC+GF 
Sbjct: 61  DPGSPSIADKNEDIK-TIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFK 119

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           N+P F+RFL WVI+TT+ L   L  RI  IW   N      +V    +E+V L +LTPMD
Sbjct: 120 NYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWT--NWYSSSALVQ--RQEIVMLTILTPMD 175

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKK-----LLPIMIERVWEKF 235
            F+L TIT L +RC  NQ+  GM+QIE WEMERL++ FYS+K      L I+I  V+  F
Sbjct: 176 AFILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIF 235

Query: 236 PHEQTPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQ 295
             E   +++ E   LL  +++  L F S++NFPYD+D+LTN    LG     L PF   +
Sbjct: 236 SIESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPE 295

Query: 296 GNGVTFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMI 355
           G+G+ F+ N+I++ E   +++DLLL L WPPD          ++G   ++  +E GE ++
Sbjct: 296 GDGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVL 354

Query: 356 RKR-----------NSPIESRTTWENQWGETLEGFGVDPMNE 386
           R R           N    SR +W N+WGE L+ FGVD   E
Sbjct: 355 RNRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 235/385 (61%), Gaps = 16/385 (4%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           MPV+LK PW GIA+P  LI +IGY +H+FIL+N  S  +Q+ F+F LT+IW+SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG+PP     +        YC KC+ +KPER+HHCKTC+QCVL MDHHCPWTMNC+G  
Sbjct: 61  NPGRPPPNF--EPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHN 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           NFP F+RFL WV++TTS L   L  R    W +RN           T EL  L V  P++
Sbjct: 119 NFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNT-----RKFVHTSELCFLFVNAPLN 173

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            F+L T++ L  RCV NQ + GMTQIESWE +R++N+F++++L+P +I+ + E FP +  
Sbjct: 174 AFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF 233

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            E    A+KLL   +   L+   ++NFPYDVD+L N+  S+G       P    +  G  
Sbjct: 234 DEG--AAQKLLSSKQ---LELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTR 288

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358
           F  ND+S Y+   SI D LL L WPPDGGR+    +  D A  ++     GE  +R R  
Sbjct: 289 FVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQ-RSADIASTLETFSSGGEATLRNRSF 347

Query: 359 NSPIE-SRTTWENQWGETLEGFGVD 382
           +S I   RT W N WGE L  FGVD
Sbjct: 348 DSRISVPRTEWHNDWGENLSDFGVD 372

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/384 (45%), Positives = 232/384 (60%), Gaps = 15/384 (3%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M V +K PW G+AIPC LI F GY AH+F+L N LS K  + FQ  L+MIWISY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           NPG+P  G   +    +   YC KC  +KPER+HHCK C QCVL+MDHHCPWTMNCLG  
Sbjct: 61  NPGRPTKGF--RPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
                     W+I TT  L  Y + RI   W  R       +VS   +EL+ L +LTP+D
Sbjct: 119 YLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYA--TANLVS--KQELIFLTILTPLD 174

Query: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240
            F+L TI+ LFVRCV NQ++ G TQIE+WEM+R++N+FY ++LLP ++  + E +P    
Sbjct: 175 AFILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLE 234

Query: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300
            + E E E+ L         F  V+NFPYD++   N+   +GSP+  L PF   + +G+ 
Sbjct: 235 GQ-EKEVEEFL---SSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMV 290

Query: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360
           FQKN+IS Y++  SI D LL L WPPD  R   H         +++  + GE ++R+R+ 
Sbjct: 291 FQKNEISDYDEATSIQDKLLALPWPPDDTR---HGIAFPSVSHVEKDTQGGEQVVRRRHV 347

Query: 361 PIE--SRTTWENQWGETLEGFGVD 382
           PI    R  W N WGE+LE FGVD
Sbjct: 348 PIAVPPRNEWYNDWGESLEHFGVD 371

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  197 bits (501), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 130/410 (31%), Positives = 207/410 (50%), Gaps = 64/410 (15%)

Query: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60
           M ++  +PW+G+AIP  +IF +   +++ IL++ L+  + I +     MI  SYY+AI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPE------------RSHHCKTCQQCVLMMDH 108
            P   P    Q      MN      N   P             R+HHCKTC  CV+MMDH
Sbjct: 61  PPTPAPSTLTQSFISDVMNNE----NDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDH 116

Query: 109 HCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTK 168
           HCPWTMNC+G+ N+P F+RFL WVII+T+ L   L+ +   ++  RN P    +      
Sbjct: 117 HCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFH--LYQNVKY 174

Query: 169 ELVSLVVLTPMDLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMI 228
           +++ L +L P  +FV  T+  L ++ + NQ+  GMTQIE W+ E ++N ++  K   + +
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 229 ERVWEK-----FPHEQTPEHELEAEKLLEMNEQGL---LKFSSVVNFPYDVDLLTNIHQS 280
           +    +     +  + + +   + +KL+   + G      F S++NFPYD+ L  NI  +
Sbjct: 235 QLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294

Query: 281 LGSPMLLLW--PFS---TAQGNGVTFQKNDISTYEDNLS---ISDLLLCLSWPPDGGRRI 332
           +GS   L W  P+    TA  N +    N+ + ++DN +   I D+LLCL WP +     
Sbjct: 295 MGSLNPLSWFNPWYTPLTASYNKI----NEFAIWDDNETHDNIKDMLLCLPWPLNYSN-- 348

Query: 333 PHPQREDGAHMIDQTVEDGEFMIRKRNSPIESRTTWENQWGETLEGFGVD 382
                       + T +DGE +++             N +GETL+ FGVD
Sbjct: 349 ------------NSTFQDGELVVK------------SNDYGETLQDFGVD 374

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 77/154 (50%), Gaps = 16/154 (10%)

Query: 65  PPHGSAQQ----HTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           PP   A++      DG   R C  C  +KP+R HHC TC +C+L MDHHCPW   C+GF 
Sbjct: 81  PPEYIAKRSFTLKKDGRY-RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFE 139

Query: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180
           N   F++FLI+    +  + ++    +   +  +              EL+ L++LT   
Sbjct: 140 NQKYFVQFLIYCTAYSIVVLFFTSCELHYWFSGKQYE----------DELIDLMLLTVWI 189

Query: 181 LFVLFTITALFVRCVT-NQVIGGMTQIESWEMER 213
           L ++ T++ +F    +  Q++   T IE + M+R
Sbjct: 190 LAIVITVSLIFFSSFSIYQLLKNQTTIEMYGMKR 223

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           RYCA C  +KP+RSHHC +C +C L  DHHCPW  +C+GF N   F++FL++  + +  +
Sbjct: 108 RYCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISI 167

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQV 199
           F    L+I + ++ +N   +   ++     L+S      +  F  F+I  L     TN++
Sbjct: 168 FIAATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQTTNEL 227

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 74/140 (52%), Gaps = 15/140 (10%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C  +KP+R HHC +C +C+L MDHHCPW   C+GF N   F++FL++   TT+  
Sbjct: 101 RVCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYA 157

Query: 140 FWYLLLRIAAIWQ-ARNMPIKGGVVSTTTKEL--VSLVVLTPMDLFVLFTITALFVRCVT 196
            + L +    +++   N   +  ++S     L   SLVV   M LF  F+++        
Sbjct: 158 IFVLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVS-------- 209

Query: 197 NQVIGGMTQIESWEMERLQN 216
            QV+   T IE + ++R +N
Sbjct: 210 -QVLKNQTTIEMYGVQRWRN 228

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (57%), Gaps = 12/90 (13%)

Query: 65  PPHGSAQQHTDGDMN---RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121
           PP   +Q       N   R C  CN +KP+RSHHC TC +CVL MDHHCPW   C+GF N
Sbjct: 90  PPQFLSQNSLTIKNNGRPRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKN 149

Query: 122 FPQFMRFLIW--------VIITTSQLF-WY 142
              F++FLI+         I+T+ Q++ W+
Sbjct: 150 QKFFIQFLIYNTTYAYVIAILTSKQMYNWF 179

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 10/145 (6%)

Query: 69  SAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRF 128
           S  Q  +G   R C  C+ +KP+R HHC TC  CVL MDHHCPW   C+G+ N   F++F
Sbjct: 94  SYTQKRNGRF-RVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQF 152

Query: 129 LIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTIT 188
           LI+  + +  +     + I   ++     ++    +  +  L++LVV   + +F +F+I+
Sbjct: 153 LIYCTVYSILVLILSSMEIYTWFKGEFFEVELINFTLLSLWLLALVVSISITIFTVFSIS 212

Query: 189 ALFVRCVTNQVIGGMTQIESWEMER 213
                    QV    T IE + + R
Sbjct: 213 ---------QVCQNQTTIELYSLRR 228

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 44/74 (59%), Gaps = 5/74 (6%)

Query: 65  PPHGSAQQ----HTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           PP   AQ+      DG   R C  CN +KP+R HHC  C +C+L MDHHCPW   C+GF 
Sbjct: 86  PPDFLAQRSFTLKHDGRF-RVCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFK 144

Query: 121 NFPQFMRFLIWVII 134
           N   F++FLI+  +
Sbjct: 145 NQKYFVQFLIYTTV 158

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 40/213 (18%)

Query: 34  SLSNKRQIIFQFCLTMIWISYYMAIYT-------NPGKP---PHGSAQQHTDGDMN---- 79
           S++  + + F+  L +I  +  + IYT        PG P   P  + +   D +M     
Sbjct: 27  SITRVKVVPFELLLVLIICTVSLGIYTYSEVISVGPGSPIDFPDLAIKNLHDVEMGAELP 86

Query: 80  -----------------RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNF 122
                            R C  C  +KP+R HHC +C +C+L MDHHCPW   C+GF N 
Sbjct: 87  PEYLTSRSLTMKHDGRFRICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQ 146

Query: 123 PQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLF 182
             F++FL +    +  + +   ++I   +++ +   +       T  L+++V+   + LF
Sbjct: 147 KYFIQFLFYCTSYSIIVLFVTSIQIYHWFRSTSYEYEFIDFKLLTVWLLAIVIFISLVLF 206

Query: 183 VLFTITALFVRCVTNQVIGGMTQIESWEMERLQ 215
             F++          Q++G  T IE +   R +
Sbjct: 207 TGFSVF---------QLLGNQTTIELYAYRRYK 230

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 77/163 (47%), Gaps = 21/163 (12%)

Query: 65  PPHGSAQQHT----DGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120
           PP   +Q+      DG   R C  C  +KP+R HHC +C +C+L MDHHCPW   C+GF 
Sbjct: 86  PPEYLSQKSITLKHDGRA-RVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFK 144

Query: 121 NFPQFMRFLIW-------VIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSL 173
           N   F+ FLI+       V + +S+  W    +   + +  N+ +    +       VSL
Sbjct: 145 NHKYFINFLIYNSLYATFVCLISSKELWNWFSQEKYVTELINIHLLLLFI-------VSL 197

Query: 174 VVLTPMDLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQN 216
           +    M LF  ++I  + +   T ++       E  E+E LQ+
Sbjct: 198 ITSVSMTLFTAYSIYQVLINRTTIELYAYRRYKE--ELEILQD 238

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 75/162 (46%), Gaps = 18/162 (11%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C+ CN  KP RS HC  C  C+L+ DHHC W  NC+G GN+  F  FL+   I+ S    
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLS---- 194

Query: 142 YLLLRIAAIWQAR-NMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQVI 200
           Y  LR+  I  ++ ++P         +K +++L +LT         I  +F      QV 
Sbjct: 195 YAFLRLLHITLSKPDVP--------KSKNILALCILTGS----FSVICGVFFYLQMKQVN 242

Query: 201 GGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQTPE 242
            GMT  E+ +   +Q +    KL+    +  W     E  P+
Sbjct: 243 NGMTTNETDKWYAVQELMREGKLIKSE-DNNWFALSTEDAPD 283

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 100/231 (43%), Gaps = 24/231 (10%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIW-------V 132
           R C  C  +KP+RSHHC +C +C L MDHHCPW  +C+GF N   F++FL++       V
Sbjct: 103 RICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFV 162

Query: 133 IITTSQLFWYLLLRIAAIWQARNMPIKGGV-VSTTTKELVSLVVLTPMDLFVLFTITALF 191
            +TT    W         W    M  K  + +S  T  L+S++    M  F  ++I  + 
Sbjct: 163 FMTTGLQLWK--------WLDNKMYEKELIDLSLMTVWLLSIISCISMFAFTSYSIYLVT 214

Query: 192 VRCVTNQVIG---GMTQIESWEMERLQNMFYSKKLLPIMIERV-WEKFPHEQTPEHELEA 247
               T ++ G     +Q+E     R  +M  +  +  +   +  WE    +   E  L  
Sbjct: 215 KNTTTIEMYGWTHYKSQLEIVNDSRRTSMSATDNVFDLGTRKANWEAVMGKSWREWLLPV 274

Query: 248 EKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLG---SPMLLLWPFSTAQ 295
               E+  +  L    +  F    D   +IH+S+      M  L P S+A+
Sbjct: 275 RTDAELKSRNTLDEKGLY-FKIRNDFYQDIHESMDLQQQLMKRLTPRSSAE 324

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (46%), Gaps = 9/139 (6%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C  +KP+R HHC TC +C+L MDHHCPW   C+GF N   F++FLI+  I     
Sbjct: 107 RLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTIYAFVA 166

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQV 199
              +  +    ++ +N   +    +     L++ V+   +  F  F+I          QV
Sbjct: 167 LGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIY---------QV 217

Query: 200 IGGMTQIESWEMERLQNMF 218
           +   T IE + + R    F
Sbjct: 218 LKNRTTIEMYGIRRYNRDF 236

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 68/150 (45%), Gaps = 26/150 (17%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C  C+  KP RS HC  C +C+LM+DHHC W  NC+G GN+  F  FL    ++   L  
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187

Query: 142 YLLLRIAAIW---QARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQ 198
           Y  LR+ +I    Q  N+          TK ++ L +LT         I A+F     N 
Sbjct: 188 YSFLRLTSIQLMSQTENI---------KTKPMLVLTILTG----CFDIIVAVFGYTQFNL 234

Query: 199 VIGGMTQIE--SW----EMERLQNMFYSKK 222
           V  GMT  E   W    E  R  N+   KK
Sbjct: 235 VHDGMTTNEQDKWFTVQEFMRDGNLVRDKK 264

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C+ +KP+R HHC +C  C+L MDHHCPW   C GF N   F++FL++        
Sbjct: 104 RVCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTT------ 157

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITAL-FVRCVTNQ 198
           F+  L+ I + ++       G       +EL+   +L    L +   I+ L F      Q
Sbjct: 158 FYAFLVLIYSCYELGTWFHSGSF----NQELIDFHLLGVALLAIAIFISVLAFTAFSIYQ 213

Query: 199 VIGGMTQIESWEMERLQN 216
           V    T IE + M R + 
Sbjct: 214 VCNNQTTIELYGMRRYRR 231

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R+C  C  +KP+R HHC  C++C L MDHHCPW  +C+G+ N   F++FLI+  + +  +
Sbjct: 104 RFCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILI 163

Query: 140 F 140
           F
Sbjct: 164 F 164

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 59/115 (51%), Gaps = 5/115 (4%)

Query: 75  DGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
           DG   R+C  C  +KP+R HHC  C +C L MDHHCPW  +C+GF N   F++FL +   
Sbjct: 99  DGSF-RFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAY--- 154

Query: 135 TTSQLFWYLLLRIAAIWQ-ARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTIT 188
           TT    + LL+  A ++   R M  K  ++      +  L V+  +  F   T T
Sbjct: 155 TTVYSLYVLLMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYT 209

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C+ +KP+R HHC +C  C+L MDHHCPW   C GF N   F++FL++        
Sbjct: 104 RVCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTT------ 157

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITAL-FVRCVTNQ 198
           F+  L+ I   ++       G      ++EL+ L +L    L +   I+ L F      Q
Sbjct: 158 FYAFLVLIDTCYELGTWFNSGSF----SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQ 213

Query: 199 VIGGMTQIESWEMERLQN 216
           V    T IE   M R + 
Sbjct: 214 VCNNQTTIELHSMRRYRR 231

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 7/99 (7%)

Query: 51  WISYYMAIYTNPGKPPHGSAQQHTDGDMNRY-----CAKCNGFKPERSHHCKTCQQCVLM 105
           W+S  +   T+ G  P GSAQ++ D D   Y     C  C+  KP RS HC  C++CVL+
Sbjct: 104 WLSMTVKAKTSRGCQP-GSAQEY-DYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLV 161

Query: 106 MDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLL 144
            DHHC W  NC+G GN+  F  FL+  +I+ S  F  +L
Sbjct: 162 ADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVL 200

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 62/141 (43%), Gaps = 23/141 (16%)

Query: 41  IIFQFCLTMIWISYYMAIYTNPGKPPHGSAQQHTDGDMN--------------------- 79
           + F +  T+ ++S+     T+PG  P        + D                       
Sbjct: 108 VFFYYFWTLCFVSFIKTATTDPGVLPRNVHVPSVENDYEIPQEYYNMITLPTGNPLIANI 167

Query: 80  --RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTS 137
             +YC  C  ++P R+ HC TC+ C++  DHHC W  NC+G  N+  F  FL+  +I T+
Sbjct: 168 EVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATA 227

Query: 138 QLFWYLLLRIAAIWQARNMPI 158
            +     +R++    A++ P+
Sbjct: 228 FIIANCAIRVSRSVHAKDAPV 248

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C+ C   KP RS HC  C +C+L+ DHHC W  NC+G GN+ QF  FLI  I++ S    
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMS---- 191

Query: 142 YLLLRIAAIWQARNMPIKGGVVS 164
           Y  LR+ +I    +  +   V++
Sbjct: 192 YAFLRLCSISLKSSTALPRAVLT 214

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 33/186 (17%)

Query: 34  SLSNKRQIIFQFCLT----MIWI---SYYMAIYTNPGKP--------------------- 65
           SL+   QI ++F ++    ++ I   +YY  I T PG P                     
Sbjct: 28  SLTRINQIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELP 87

Query: 66  ----PHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121
                  S     DG   R C  C+ +KP+R HHC  C +C+L MDHHCPW   C+GF N
Sbjct: 88  PEFLSRRSITTKRDGRF-RVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNN 146

Query: 122 FPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDL 181
              F+++L++    +  +F +  +++   +  +   ++       +  L+ + V   +  
Sbjct: 147 QRFFIQYLLYATTYSIVIFLFSSIQLLHWFNTKQYEVELIDFHLLSVWLLGVAVSVSLSF 206

Query: 182 FVLFTI 187
           F  F+I
Sbjct: 207 FTGFSI 212

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 63/138 (45%), Gaps = 11/138 (7%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C+ +KP+R HHC +C  C+L MDHHCPW   C GF N   F++FL++  +    +
Sbjct: 104 RVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLV 163

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVT-NQ 198
             Y    +   + +           +  +EL+   +L    L V   I+ L   C +  Q
Sbjct: 164 LIYTCYELGTWFNS----------GSFNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQ 213

Query: 199 VIGGMTQIESWEMERLQN 216
           V    T IE   M R + 
Sbjct: 214 VCKNQTTIEVHGMRRYRR 231

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
           R C  C+ +KP+R HHC  C +C+L MDHHCPW  +C+GF N   F++FL++  +
Sbjct: 106 RLCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 58/123 (47%), Gaps = 18/123 (14%)

Query: 56  MAIYTNPGKPPHGSAQQHTDGDMNRY------------CAKCNGFKPERSHHCKTCQQCV 103
             ++T   KP +   ++++D   N Y            C  C  +KP RS HC  C +CV
Sbjct: 101 FGVFTMFTKPTY--TKKYSDEIDNEYAFDNLIFYPQILCRTCQSYKPARSKHCSICDRCV 158

Query: 104 LMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVV 163
           L+ DHHC W  NC+G GN+  F  FL    IT +    Y  +R+  I+   N+ +    +
Sbjct: 159 LVADHHCIWVNNCVGKGNYTYFYMFL----ITNTFSLTYAFIRLLTIFYTTNVYLPKNTL 214

Query: 164 STT 166
           + T
Sbjct: 215 TLT 217

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 79  NRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQ 138
           N +C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GN+  F  FL    ++ + 
Sbjct: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTL 189

Query: 139 LFWYLLLRI 147
           L  Y  LRI
Sbjct: 190 LLGYAFLRI 198

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 73/156 (46%), Gaps = 14/156 (8%)

Query: 65  PPHGSAQQHTDGDMN---RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121
           PP    Q+      N   R+C  C  +KP+R HHC  C +C L MDHHCPW  +C+G+ N
Sbjct: 113 PPRFLTQRCVTLKRNGRFRFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRN 172

Query: 122 FPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDL 181
              F+ FL++    +  +F+     +   ++++             +EL++L +L    L
Sbjct: 173 QKYFIHFLLYTTAYSILVFFLTGADLLMWFRSQGY----------NQELINLPLLIVWIL 222

Query: 182 FVLFTITAL-FVRCVTNQVIGGMTQIESWEMERLQN 216
            ++ TI+ L F       V    T IE +E    +N
Sbjct: 223 SLVITISMLAFTSYTIYLVAKNQTTIEMYEWTNYRN 258

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 61/137 (44%), Gaps = 11/137 (8%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           R C  C+ +KP+R HHC +C  CVL MDHHCPW   C GF N   F++FL++       +
Sbjct: 104 RVCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLV 163

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITAL-FVRCVTNQ 198
             Y    +   + +           +  +EL+   +L    L V   IT L F      Q
Sbjct: 164 LIYTCYELGTWFNS----------GSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQ 213

Query: 199 VIGGMTQIESWEMERLQ 215
           V    T IE   M R +
Sbjct: 214 VCKNQTTIEVHGMRRYR 230

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF- 140
           C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GN+ QF  FLI  I +    F 
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 141 --WYLLL 145
             WY+ L
Sbjct: 196 RLWYISL 202

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 57/112 (50%), Gaps = 6/112 (5%)

Query: 73  HTDGDMN-RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIW 131
           HTD ++  +YC  C  ++P RS HC  C+ CVLM DHHC W  NC+G  N+  F+ FL  
Sbjct: 174 HTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFL-- 231

Query: 132 VIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFV 183
              T+S L    L+  AAI  AR   +    V+        L +  PM L +
Sbjct: 232 ---TSSTLTSIFLIVNAAIDVARTPDVTDTPVAVLLIVYGFLTIWYPMILLM 280

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 59  YTNPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLG 118
           YTN  + P  +     +    +YC+ C+ ++P R+ HC  CQ C+ + DHHC W  NC+G
Sbjct: 170 YTNTIRLPVANKNHSIEL---KYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVG 226

Query: 119 FGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPI 158
             N+  F+ FL+  I+++  +     + +A I +A N P+
Sbjct: 227 NRNYRYFIIFLVGAILSSIFIIINCSIHVARIRRASNAPV 266

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 61/121 (50%), Gaps = 13/121 (10%)

Query: 70  AQQHTDGDMN-----RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQ 124
           A Q   GD+      +YC  C  ++P R+ HC TC+ C+L  DHHC W  NC+G  N+  
Sbjct: 164 APQTIRGDIQAKIELKYCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRY 223

Query: 125 FMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELV--SLVVLTPMDLF 182
           F+ FL   I+++  L     +    I+  RN+P K   V  T   L+   L ++ PM L 
Sbjct: 224 FILFLASAILSSIFLIANCSIH---IYHHRNLPSK---VPVTILLLIYGGLAIIYPMLLL 277

Query: 183 V 183
           +
Sbjct: 278 I 278

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 79  NRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQ 138
           +RYC KC  +KP+R HHC  C +C L  DHHC W   C+G+ N   F+ FL++  +    
Sbjct: 168 HRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYA-- 225

Query: 139 LFWYLLL 145
            FW  ++
Sbjct: 226 -FWICII 231

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 55  YMAIYTNPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTM 114
           Y  I T P   P G           +YCA C  ++P R+ HC TC+ CVL  DHHC W  
Sbjct: 157 YYNIITLPSAHPEGKTVD------VKYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVN 210

Query: 115 NCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIA 148
           NC+G  N+  F+ FL    + T+       +R+A
Sbjct: 211 NCIGQRNYRYFLTFLASCCLATTLCIVGCGIRVA 244

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C+ C+  KP RS HC  C +C+L+ DHHC W  NC+G GN+ QF  FLI  I +      
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFS----LL 191

Query: 142 YLLLRIAAIWQARNMPIKGGVVSTT 166
           Y  LR+  I       +   V++ T
Sbjct: 192 YAFLRLWCISLNSKTALPRAVLTLT 216

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 34/59 (57%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           C+ C   K  RS HC  C +CVL+ DHHC W  NC+G GN+ QF  FL   I + S  F
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF 194

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 67/151 (44%), Gaps = 16/151 (10%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C  C   KP RS HC+ C  C+L+ DHHC W  NC+G GN+  F  FL+   IT +    
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMT---- 194

Query: 142 YLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIG 201
           Y  +R+  ++   + P        +++ +++L++L          I A F       V  
Sbjct: 195 YSFIRLFLMYCQGHAP--------SSRNILTLLILCGS----FAVICAGFTFLQLQLVKD 242

Query: 202 GMTQIESWEMERLQNMFYSKKLLPIMIERVW 232
           GMT  E  +   LQ      KL+    E  W
Sbjct: 243 GMTTNEQDKWFTLQEYMRDGKLIRTKDENKW 273

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 27/127 (21%)

Query: 41  IIFQFCLTMIWISYYMAIYTNPG------------KPPHGSAQQHTDGDMN--------- 79
           ++F +C  M  +++  +  T PG             PP  +  Q      N         
Sbjct: 118 VVFYYCWAMAAVNFVQSSTTGPGVLPRNIHVPKVGGPPGQTPVQSPQEYYNIVTLPTAQR 177

Query: 80  ------RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVI 133
                 +YC  C  ++P R+ HC+ CQ CV   DHHC W  NC+G  N+  F+ FL    
Sbjct: 178 SAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATC 237

Query: 134 ITTSQLF 140
            T + LF
Sbjct: 238 ATCTVLF 244

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 65  PPHGSAQQHTDGDMN-RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFP 123
           P H S  +    D+  +YC  C  ++P RS HC TC  CV++ DHHC W  NC+G  N+ 
Sbjct: 161 PTHSSVSK----DITIKYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYR 216

Query: 124 QFMRFLIWVIITTSQLFWYLLLRIA 148
            F+ FL+  +I++  L     + IA
Sbjct: 217 FFLVFLLSAVISSIILLANCAIHIA 241

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 34/59 (57%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           C  C   KP RS HC  C QCVL +DHHC W  NC+G GN+  F  FL+   ++ S  F
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAF 193

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 56/128 (43%), Gaps = 12/128 (9%)

Query: 62  PGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121
           P K P+ S          +YC  C  ++P RS HC  C  CVL  DHHC W  NC+G  N
Sbjct: 161 PTKNPNASVSM-------KYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRN 213

Query: 122 FPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDL 181
           +  F+ FL+   I+   L      R++   Q R  P+   ++         L +  P+ L
Sbjct: 214 YRFFLEFLMASTISCILLILLSSFRLSYSPQVRYTPVSLLIIC-----YCGLGIWYPLIL 268

Query: 182 FVLFTITA 189
           F+     A
Sbjct: 269 FIYHIFLA 276

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 65/157 (41%), Gaps = 25/157 (15%)

Query: 69  SAQQHTDGDMNRY------------CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNC 116
           S+  H  G   RY            C  C   KP RS HC  C  C+ + DHHC W  NC
Sbjct: 111 SSNAHQIGSEKRYPYDNLLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNC 170

Query: 117 LGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVL 176
           +G GN+  F  FL   ++  S  F      I  I+   N   K    +T T E   L++ 
Sbjct: 171 VGMGNYMYFYSFLCSNLLLLSYSF------IRLIFIQFN---KSAYNTTPTGEKSLLILS 221

Query: 177 TPMDLFVLFTITALFVRCVTNQVIGGMT--QIESWEM 211
                F +  I A++   V   V  GMT  + + W+M
Sbjct: 222 ILCGSFTV--ILAVYCYFVFELVNSGMTTNEKDKWQM 256

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           +YC  C  ++P RS HC TC  CV++ DHHC W  NC+G  N+  F+ FL+  I+++  L
Sbjct: 173 KYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

Query: 140 FWYLLLRIA 148
                + IA
Sbjct: 233 LTNCAIHIA 241

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           +YC  C  ++P RS HC  C+ C++  DHHC W  NC+G  N+  F+ FL+    T+  L
Sbjct: 215 KYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFL 274

Query: 140 FWYLLLRIAAIWQARNMPI 158
                + IA   + R+ P+
Sbjct: 275 IINASIDIARTPKVRDTPV 293

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 81/185 (43%), Gaps = 14/185 (7%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C  C   KP RS HC  C QC+L+ DHHC W  NC+G GNF  F  FL       +    
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFL----FDNTLFMS 192

Query: 142 YLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIG 201
           Y  +R+  I    N    G       +++++L +L    LF+  T + + +  V +    
Sbjct: 193 YASMRLLEI--TLNFRRAG---ENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKD---- 243

Query: 202 GMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQTPEHELEAEKLLEMNEQGLLKF 261
           GMT  E  +   +Q +   KKL+       +  F ++Q  E E  +    +  +  L ++
Sbjct: 244 GMTTNEKDKWYTIQCLMEDKKLVKSSDNNWYISFVNDQ-GETEFYSTNAYDHKKYQLTEY 302

Query: 262 SSVVN 266
             + N
Sbjct: 303 KVIDN 307

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 65  PPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQ 124
           P H S   H D  + +YC  C  ++P RS HC TC  CV++ DHHC W  NC+G  N+  
Sbjct: 161 PTHPSV--HNDITI-KYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRF 217

Query: 125 FMRFLIWVIITTSQLFWYLLLRIA 148
           F+ FL+  I ++  L     + IA
Sbjct: 218 FLIFLLSAIFSSILLLVNCAVHIA 241

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           +YC  C  ++P R+ HC TC  CV++ DHHC W  NC+G  N+  F+ FL+  I ++  L
Sbjct: 173 KYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

Query: 140 FWYLLLRIAAIWQA-RNMPI 158
                + IA      RN P+
Sbjct: 233 LTNCAIHIARESDGPRNYPV 252

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI--WVIITTSQL 139
           C  C   K  RS HC  C++C+ + DHHC W  NC+G+GN+  F  FL+   +++T + L
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASL 188

Query: 140 FWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLV 174
               L RI A    ++       + TT   L+++V
Sbjct: 189 RLLTLFRITAF--KKDKFFLSLFLLTTAFSLIAIV 221

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIIT 135
           RYC  C  ++P R+ HC TC  CV+  DHHC W  NC+G  N+  F+ FLI  ++ 
Sbjct: 179 RYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLA 234

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 55  YMAIYTNPGKPPHGSAQQHTDGDMNRY------------CAKCNGFKPERSHHCKTCQQC 102
           Y  + T   KP   ++ +H     NRY            C  C   KP RS HC  C +C
Sbjct: 98  YFGVMTMITKPE--NSIEHGINSNNRYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKC 155

Query: 103 VLMMDHHCPWTMNCLGFGNFPQFMRFL 129
           +L+ DHHC W  NC+G GN+  F  F+
Sbjct: 156 ILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 41  IIFQFCLTMIWISYYMAIYTNPGKPPHGSAQQHTDGDMN--------------------- 79
           I+F +  T+ ++S+     T+PG  P          D                       
Sbjct: 126 ILFYYSWTLCFLSFIKTATTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSSTNSPIQ 185

Query: 80  -RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIIT 135
            +YC  C  ++P R+ HC TC  C++  DHHC W  NC+G  N+  F+ F+   ++T
Sbjct: 186 LKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLT 242

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 59  YTNPGKPPHGSAQQHTDGDMN-RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCL 117
           Y N    P+G+     +  +  +YC  C  ++P R+ HC  C+ CVL  DHHC W  NC+
Sbjct: 136 YFNNVTLPYGAGGSAGNASVTLKYCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCV 195

Query: 118 GFGNFPQFMRFLIWVIITTSQL 139
           G  N+  F+ FL+   +  + L
Sbjct: 196 GQRNYRYFLAFLLSSTLACALL 217

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 5/96 (5%)

Query: 59  YTNPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLG 118
           Y N    P      + D  + +YC  C  ++P R+ HC  C+ CV+  DHHC W  NC+G
Sbjct: 155 YYNLINLPITRGNPNGDSILMKYCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVG 214

Query: 119 FGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQAR 154
             N+  F+ FLI     +  L    LL   AI  AR
Sbjct: 215 QRNYRYFVTFLI-----SGTLASIFLLANCAIHLAR 245

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 11  GIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYTNPGKP-PHGS 69
           GI I CS +F++        +R+ L           L +  +S Y  I T+P     +  
Sbjct: 61  GIYIYCSFVFYVHVYGE---IRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVG 117

Query: 70  AQQHTDGDM---NRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFM 126
            +   DG +   N  C  C   K  RS HC  C +C+L+ DHHC W  NC+G GN+  F 
Sbjct: 118 PEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFY 177

Query: 127 RFLIWVIITTSQLFWYLLLRIAAI 150
            FL    ++   +  Y  +R++++
Sbjct: 178 LFL----LSNCSMLSYATIRLSSV 197

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           YC  C  ++P RS HC  C  CV+ +DHHC W  NC+G  N+  F+ FL   I+T 
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTV 250

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQL 139
           +YC  C  ++P R+ HC  C  C+L  DHHC W  NC+G  N+  F+ FL+   +T    
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVIC 230

Query: 140 FWYLLLRIA 148
                +RIA
Sbjct: 231 IVSCAIRIA 239

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C  C   K  R+ HC  C QCV + DHHC W  NC+G GN+  F  FL+  +  T+  F 
Sbjct: 133 CRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFL 192

Query: 142 YLLL 145
            LL 
Sbjct: 193 RLLF 196

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 80  RYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           +YC  C  ++P R+ HC  C  C+L  DHHC W  NC+G  N   F+ FL   ++++
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSS 241

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 77/190 (40%), Gaps = 20/190 (10%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141
           C  C   K  RS HC  C +C  + DHHC W  NC+G GN+  F  FL   +  T   F 
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFT 190

Query: 142 YLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQVIG 201
            LL                  +  T K    L +   +  F L  +   + + V   +  
Sbjct: 191 RLLY-----------------LQPTVKSRTLLTLALLLGSFALILVIFSYFQVVL--IKD 231

Query: 202 GMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFP-HEQTPEHELEAEKLLEMNEQGLLK 260
           GMT  E  +   + +M  ++KL+     + + + P +E +   EL++ +  E+      +
Sbjct: 232 GMTTNEESKWLVVHDMMRARKLVVDNAGKFYYRIPENEDSLSPELKSNEGPELTTTSPSR 291

Query: 261 FSSVVNFPYD 270
           ++     PYD
Sbjct: 292 YTFYSTNPYD 301

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 26/44 (59%)

Query: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQF 125
           C  C   KP RS HC  C +CV + DHHC W  NC+G GN+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 45/93 (48%), Gaps = 10/93 (10%)

Query: 47  LTMIWISYYMAIYTNP---GKPPHGSA----QQHTDGDM---NRYCAKCNGFKPERSHHC 96
           L  I +S  + ++T P   G    G A    Q   DG +   N  C  C+  K  RS HC
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHC 153

Query: 97  KTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFL 129
             C++C+ + DHHC W   C+G GNF  F  FL
Sbjct: 154 SICRRCIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 96/210 (45%), Gaps = 41/210 (19%)

Query: 43  FQFCLTMIWISYYMAIYTNPGKPPH--------------GSAQQH----TDG-------D 77
            Q  L +IW  + +A+   PGK P               G+++++    +DG       D
Sbjct: 62  LQILLLLIW--FQIAVAVGPGKLPQVLPYLILSAQESDLGASEKYQNHGSDGSSICYQCD 119

Query: 78  MNRY---CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
            N Y   C  C   K ER+HH +    CV   DH C +  + +G  N+  F+++ +++ I
Sbjct: 120 PNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTI 179

Query: 135 TTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRC 194
             + ++  ++  I +I   R+    G   S     L+++++LT +      T+T+L +  
Sbjct: 180 WLAIIWTSIVAYIRSI--TRDYRGHG---SHLNGNLIAILILTTL---FWITVTSLLLTQ 231

Query: 195 VTNQVIGGMTQIESWEMERLQNMFYSKKLL 224
           + N ++   T IE   MER +  F ++K+ 
Sbjct: 232 L-NCIVKNKTSIEV--MERRRKAFSTRKMF 258

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 60  TNPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGF 119
           T P         Q       R+C+ C G K  RSHH      C+   DH+C W    +G 
Sbjct: 97  TQPTSTVPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGK 156

Query: 120 GNFPQFMRFLIWVIIT 135
            N+ QF+ FL +  ++
Sbjct: 157 DNYKQFVIFLFYCTVS 172

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV---IITTS 137
           +C+ C   K ERSHH +  + CV   DH+C W    +G  N+  FM+++++    ++T S
Sbjct: 126 WCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS 185

Query: 138 QLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVRC 194
                 + RI    +  ++ +   ++      L     +TP     LF + + ++ C
Sbjct: 186 LTIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTP-----LFAVFSFYMSC 237

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 56/127 (44%), Gaps = 26/127 (20%)

Query: 41  IIFQFCLTMI-WISYYMAIYTN-----PGKPPH-----GSAQ---------QHTDGDMNR 80
           II +  LT+I WI +   IY N     P  PP+     GS+          ++   D N 
Sbjct: 54  IIIECVLTIIIWIIWVRLIYFNKPMEQPIIPPYMLVPVGSSSNQVISTKPPKYYQCDKNG 113

Query: 81  Y---CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTS 137
           Y   C  C   K  RSHH K   +C+L  DH+C W    +   N+  F++++ W  +   
Sbjct: 114 YPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGWFNLL-- 171

Query: 138 QLFWYLL 144
            L WY L
Sbjct: 172 -LLWYWL 177

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 59  YTNP--GKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNC 116
           +T+P   KPP     Q  +     +CA C   K  R+HH      CV   DH+C W    
Sbjct: 103 FTSPQVNKPP--LIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTL 160

Query: 117 LGFGNFPQFMRFLIWV 132
           +G GN+  F++FL+++
Sbjct: 161 IGAGNYLLFIQFLVYM 176

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C++C   K ER+HH      CV   DH+C W    +G  N+  F++F+ +  I  S ++
Sbjct: 122 WCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIW 181

Query: 141 WYLLLRIAAIWQAR 154
             ++  I  I + R
Sbjct: 182 VSIVSYIHMIIRKR 195

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C+ C+  K ER+HH    + CV   DH C W    +G  N+  F++F++++ I +  +F
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 46/120 (38%), Gaps = 32/120 (26%)

Query: 47  LTMIWISYYMAIYTNPGKPPH---------GSAQQHTDGDMNR----------------- 80
           + +I+I   M ++  PGK PH          S ++  DG                     
Sbjct: 65  VVVIFIWLQMVVWIGPGKQPHVAPFLILPVASKEETNDGGSQSTSAEYDAVIPPKCYQSD 124

Query: 81  ------YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
                 +C+ C   K ER+HH      CV   DH+C W    +G  N+  F++F+ +  I
Sbjct: 125 PHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSI 184

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 58/146 (39%), Gaps = 26/146 (17%)

Query: 43  FQFCLTM-IWISYYMAIYTNPGKPPHGSAQQHTDG-----------DMNRYCAKCNGFKP 90
           F F + M I+  +   I+++PG  P  +  ++  G           D+  +C +    KP
Sbjct: 406 FMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKP 465

Query: 91  ERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAI 150
            RSH        V   DH CPW  N +G  N   FM              W++LL    I
Sbjct: 466 LRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM--------------WFILLTEVGI 511

Query: 151 WQARNMPIKGGVVSTTTKELVSLVVL 176
           W   ++ +K   +   T E V+  +L
Sbjct: 512 WFFISLTMKYFDILEDTNEDVACFLL 537

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C+ C   K ER+HH      CV   DH+C W    +G  N+  F++F+ +       ++
Sbjct: 136 WCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTYFSSLLLLMW 195

Query: 141 WYLLLRIAAIWQ---ARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLF 185
             + + I  I Q     N P+   V+ T    L   ++ T M    +F
Sbjct: 196 LSICVYIRDITQRHRGHNPPLNVNVILTLALALFGWLMNTSMLAATVF 243

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 28  WFILRNSLSNKRQIIFQFCLTMIWISYYMAIYTNPGKPP----HGSAQQHTDG------- 76
           + I ++S  N   +     L+ ++++    + ++PG  P    H S ++           
Sbjct: 417 YTIAKHSFGNFVMLSIIISLSYLFVNL---VRSDPGTKPAEFNHDSIRETITNLMLIGKF 473

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
           D N +C + +  KP RS +       V   DH CPW  N +G  N   F+ F+I ++I
Sbjct: 474 DTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 8/103 (7%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C+ C   K  R+HH      CV   DH+C W    LG  N+  F++F  ++ +      
Sbjct: 127 WCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVV---- 182

Query: 141 WYLLLRIAAIWQARNM--PIKGGVVSTTTKELVSLVVLTPMDL 181
             L+L I+   Q R M     G V +       +L++  P+ L
Sbjct: 183 --LILMISIATQMRQMKGSANGNVYAVFALACCALLMAGPLFL 223

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 77  DMNRY---CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIW 131
           D+N Y   C  C   K  R+HH K    C+   DHHC W    +G  N+  F +F+ +
Sbjct: 116 DINGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFY 173

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMR-------FLIWVI 133
           +C  C   K  R+HH  T   C+   DH+C W    +G  N+  F++       F I+VI
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVI 190

Query: 134 ITTSQLF 140
           ++T+   
Sbjct: 191 VSTASFL 197

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C  C   K ER HH +    C+   DH+C W    +G  N+  F+++          +F
Sbjct: 116 WCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQY----------VF 165

Query: 141 WYLLLRIAAIWQARNMPIKGGVV 163
           +Y LL +A IW + +  I+  V 
Sbjct: 166 YYNLL-LAWIWLSISAFIRSIVT 187

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRF 128
           +C++C   K ER+HH      C+   DH+C W    +G  N+  F++F
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           D   +C      KP RS   +  +  ++  DH CPW  N +G  N  QF+ FL+ ++   
Sbjct: 449 DTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGV 508

Query: 137 SQLF 140
           S  F
Sbjct: 509 SCFF 512

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIW 131
           +C+ C   K ER+HH  T   CV   DH+C W    +G  N+  F++F ++
Sbjct: 126 WCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMY 176

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 11/105 (10%)

Query: 42  IFQFCLTMIWISYYMAIYTNPGKPPHGSAQQHTDG-----------DMNRYCAKCNGFKP 90
           IF   +  +   +Y  I +NPG+       +               D+  +C +    KP
Sbjct: 417 IFGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKP 476

Query: 91  ERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIIT 135
            RS      Q  V   DH+CPW  N +G  N  +F+ F+ +  +T
Sbjct: 477 LRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRF 128
           +C+ C   K ERSHH      C+   DH+C W    +G  N+  F++F
Sbjct: 130 WCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF 177

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIW 131
           +C  C   K  R+HH  T   C+   DH+C W    +G  N+  F++F  +
Sbjct: 124 WCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFY 174

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 11/113 (9%)

Query: 29  FILRNSLSNKRQIIFQFCLTMIWISYYMAIYTNPG----KPPHGSAQQHTDG-------D 77
           F+   +L   R +     +++I I +   I ++PG    +  HG  ++  +        D
Sbjct: 400 FLTTVTLKPFRNMSLLITISIICILFGKLITSDPGNIYEEKDHGLVREMVEELMKLGKYD 459

Query: 78  MNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI 130
            + +C +    KP RS +       V   DH+CPW  N +G  N   F+ F++
Sbjct: 460 TSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 42/102 (41%), Gaps = 11/102 (10%)

Query: 40  QIIFQFCLTMIWISYYMAIYTNPGKPPHGSAQQHTDGDMNR-----------YCAKCNGF 88
             +F    T++ + Y   I+++PG  P  +       D+ +           +C K    
Sbjct: 352 NFVFPVLSTLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIR 411

Query: 89  KPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI 130
           KP R    K  QQ V   DH+C W  N +G  N   ++ FLI
Sbjct: 412 KPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLI 453

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
           +C+ C   K  R+ H      CV   DH+C W    +GF N+  F++F+ +  +
Sbjct: 115 WCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAV 168

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 83/240 (34%), Gaps = 28/240 (11%)

Query: 43  FQFCLTMIWISYYMAIY--TNPGKPPHGSAQQ-----------HTDGDMNRYCAKCNGFK 89
           F   + ++ +SY + +   ++PG+ P     Q               D   +C +    K
Sbjct: 412 FLLMIIILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKK 471

Query: 90  PERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLR-IA 148
           P RS         V   DH+CPW  N +G  N   F+  ++ V I    LF YL +    
Sbjct: 472 PLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILM-LLFNYLCMEYFD 530

Query: 149 AIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTI---------TALFVRCVTNQV 199
            +         GG    T     +L +    D F   T            L V     QV
Sbjct: 531 ELEDVHKHADNGGEPKCTILRNENLCLGFTYDRFAFLTFVWVVFHSVWVGLLVIVQLFQV 590

Query: 200 IGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHE-QTPEHELEAEKLLEMNEQGL 258
             G+T   ++E  +L       +  P++    +   P E  T   E++   L   NE  L
Sbjct: 591 FQGVT---NYEFSKLMKESRINRTDPVLFNEFFGTAPEELLTVNGEIDNTNLERSNEASL 647

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 17/101 (16%)

Query: 45  FCLTMIWISY--YMAIYTNPGKPPHGSAQQH-----------TDG--DMNRYCAKCNGFK 89
           FC  + ++ Y  ++  +++PG    GS   H            +G  D   +C +    K
Sbjct: 406 FCAILCFVCYSLFLLAFSDPGHI--GSENDHEKIRETISNLLKEGKFDTRSFCLETWVRK 463

Query: 90  PERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI 130
           P RS +       +L  DH+CPW  N +G  N   F+ F++
Sbjct: 464 PLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFL 129
           D   +C +    KP RS         V   DH+CPW  N +G  N   FM F+
Sbjct: 466 DTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV 132
           D N +C +    KP RS +       V   +H+CPW  N +G  N   FM F   V
Sbjct: 426 DRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV 481

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV---I 133
           D   +C +    KP RS +       V   DH CPW  N +G  N   F+ F++ V   I
Sbjct: 469 DSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGI 528

Query: 134 ITTSQL 139
           IT + L
Sbjct: 529 ITFASL 534

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 96/243 (39%), Gaps = 29/243 (11%)

Query: 30  ILRNSLSNKRQIIFQFCLTMIWISY----YMAIYTNPGKPPHGSAQQHTDG--------- 76
           I RN+L   + +     L +++I+      + + ++PG  P  S  +             
Sbjct: 389 ITRNTLKYHKGVYANIILPVLFITVSSLLVILMQSDPGSIPASSDPKEIRATMSELLRIG 448

Query: 77  --DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
             D   +C       P RS +       +   DH+CPW  N +GF N   F+ F++++ I
Sbjct: 449 KFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQI 508

Query: 135 TTSQLFWYLLLRIAAI-WQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTITALFVR 193
               +F  L +R   + WQ  +  I+    S+   +L     L P   F+L  +      
Sbjct: 509 GVF-IFVRLSIRYFELEWQNLD-DIQMDCRSSFCPQLCKGYYLDPFHSFMLAWV------ 560

Query: 194 CVTNQVIGGMTQIESWEMER----LQNMFYSKKLLPIMI-ERVWEKFPHEQTPEHELEAE 248
           C     +  +T ++ +E  +     +   + +K   I I E  +   P E   E + EA 
Sbjct: 561 CFQTMWVVALTFVQIFEASKGVTDYEYRLWVRKRRGISISEETFSSVPEELIEEDDSEAS 620

Query: 249 KLL 251
           +++
Sbjct: 621 EVI 623

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFL 129
           D   +C +    KP RS +       V   DH+CPW  N +G  N   F+ F+
Sbjct: 467 DTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 11/104 (10%)

Query: 40  QIIFQFCLTMIWISYYMAIYTNPGK-PPHGSAQQHTDG----------DMNRYCAKCNGF 88
            I+F   L  + + ++  +Y++PG   P     +  +           D   +C +    
Sbjct: 407 SILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQR 466

Query: 89  KPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV 132
           KP R        + VL  DH+CPW  N +G  N  +FM +++ V
Sbjct: 467 KPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVII 134
           D   +C +    KP RS         V   DH+CPW  N +G  N   F+ F+I V I
Sbjct: 458 DTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEI 515

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 81  YCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF 140
           +C+ C   K  R+HH      CV  +DH+C W    +G  N+  F +FL+  ++    +F
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIF 180

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 3/69 (4%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           D   +C +    KP RS         V   DH+CPW  N +G  N   F+ F   + +  
Sbjct: 467 DTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFF---ITLME 523

Query: 137 SQLFWYLLL 145
           S +F +L L
Sbjct: 524 SGIFTFLAL 532

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 23/53 (43%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFL 129
           D   +C +    KP RS         V   DH+CPW  N +G  N   F+ F+
Sbjct: 467 DTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV 132
           D   +C +    KP RS +       V   DH+CPW  N +G  N   F+ F + V
Sbjct: 443 DRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRF 128
           D   +C       P R+ + +     +L  DH+CPW  N +GF N   F+ F
Sbjct: 443 DSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 26/60 (43%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           D   +C +    KP RS         +   DH+CPW  N +G  N  +F+ F+  + +  
Sbjct: 457 DTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAV 516

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 23/54 (42%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI 130
           D   +C      KP RS      +  V   DH CPW  N +G  N   F+ F++
Sbjct: 447 DAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 23/56 (41%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWV 132
           D   +C +    KP RS         V   DH CPW  N +G  N   F+ F + V
Sbjct: 440 DRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa]
           {ON} Anc_5.626 YOR034C
          Length = 727

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/262 (20%), Positives = 104/262 (39%), Gaps = 63/262 (24%)

Query: 45  FCLTMIWISYYM-AIYT-NPGKPP----HGSAQQHTDG-------DMNRYCAKCNGFKPE 91
           + L  ++++Y +  +YT +PG  P    H   +Q  +        D++ +C      +P 
Sbjct: 385 YLLGTLFVTYLLHYVYTSDPGNIPPEFSHDKIRQDMEDLLSLNNFDVSGFCLTTWVRRPF 444

Query: 92  RSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFM----------RFLIWVIITTSQLFW 141
           +SH     ++ V   DH+C W  N +   N   F            F I++ ++     +
Sbjct: 445 KSHISPLQKKRVAGFDHYCMWLYNDIALKNRKAFFYLLLALQILLYFHIFLCVS-----Y 499

Query: 142 YLLLRIAAIWQARNMPIKG--GVVSTTTKELVSLVVLTPMDLFVLFTITALFVRCVTNQV 199
           +  ++ AA   A  +P +    V++   K L+SL+V T    F L  +T  FV C    V
Sbjct: 500 FKSIQTAAWNSASILPFEALKQVLAENKKVLLSLIVAT----FQLLIVTNSFV-CQLLTV 554

Query: 200 IGGMTQIESWEMER----------------------------LQNMFYSKKLLPIMIERV 231
           + G+T  E+  ++                             + N+  + K+ P+ + ++
Sbjct: 555 LQGLTIQEAKMIKNFLYQETTDYQRYREYFNLRTESLIIYNTVNNLASATKIRPLKVIKL 614

Query: 232 WEKFPHEQTPEHELEAEKLLEM 253
            E+ P++      L    +L M
Sbjct: 615 RERLPNKNARRRFLSLYNILNM 636

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITT 136
           D   +C       P RS + +     +   DH CPW  N +G  N   F  F++ + I+ 
Sbjct: 463 DAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEIS- 521

Query: 137 SQLFWYL 143
             ++W+L
Sbjct: 522 --VWWFL 526

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 19/45 (42%)

Query: 77  DMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGN 121
           D   +C +    K  RS +       V   DH+CPW  N +G  N
Sbjct: 437 DKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN 481

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,687,543
Number of extensions: 1836296
Number of successful extensions: 5890
Number of sequences better than 10.0: 130
Number of HSP's gapped: 5864
Number of HSP's successfully gapped: 130
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)