Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F029206.29ON1492149271800.0
KAFR0A051206.29ON1479126336550.0
YOL004W (SIN3)6.29ON1536128135960.0
NCAS0D021306.29ON1434127635540.0
CAGL0E02475g6.29ON1493141734170.0
ACL004W6.29ON1377125433950.0
KLTH0C10956g6.29ON1433128132740.0
TDEL0G044006.29ON1490114532500.0
ZYRO0C07524g6.29ON1670113332230.0
Kpol_1037.226.29ON1496108231860.0
Kwal_56.224626.29ON1541134831520.0
TPHA0J004006.29ON1512111030480.0
NDAI0C026606.29ON1657114029920.0
Ecym_30336.29ON1474109329340.0
KLLA0C06182g6.29ON1519112029340.0
SAKL0E01540g6.29ON1415107029300.0
Suva_15.1716.29ON156195829280.0
Smik_15.1666.29ON156695629230.0
Skud_15.1586.29ON1555102729030.0
TBLA0E031606.29ON173984127300.0
CAGL0J11594g6.29ON9377728132e-90
Kpol_543.344.194ON64987820.69
Kpol_1064.538.403ON48967810.90
Ecym_61344.194ON63862755.4
TPHA0G026102.389ON32270736.5
KLLA0F14234g1.274ON106461747.5
KLLA0C15125g8.455ON69366747.6
TPHA0C019708.450ON542130738.4
KLTH0E10582g8.455ON687114738.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F02920
         (1492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  2770   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1412   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1389   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1373   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1320   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1312   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1265   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1256   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1246   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1231   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1218   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1178   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1157   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1134   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1134   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1133   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1132   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1130   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1122   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1056   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   317   2e-90
Kpol_543.34 s543 (75894..77843) [1950 bp, 649 aa] {ON} (75894..7...    36   0.69 
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    36   0.90 
Ecym_6134 Chr6 complement(245146..247062) [1917 bp, 638 aa] {ON}...    33   5.4  
TPHA0G02610 Chr7 complement(545411..546379) [969 bp, 322 aa] {ON...    33   6.5  
KLLA0F14234g Chr6 (1317691..1320885) [3195 bp, 1064 aa] {ON} sim...    33   7.5  
KLLA0C15125g Chr3 (1316235..1318316) [2082 bp, 693 aa] {ON} high...    33   7.6  
TPHA0C01970 Chr3 complement(445831..447459) [1629 bp, 542 aa] {O...    33   8.4  
KLTH0E10582g Chr5 (953799..955862) [2064 bp, 687 aa] {ON} highly...    33   8.6  

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 2770 bits (7180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1362/1492 (91%), Positives = 1362/1492 (91%)

Query: 1    MSYHWNQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNISNSVSGSQH 60
            MSYHWNQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNISNSVSGSQH
Sbjct: 1    MSYHWNQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNISNSVSGSQH 60

Query: 61   DXXXXXXXXXXXXXXXXXXXXXSKHVTLPSLSALSHELRNSPGKQDMARTSGGDGQRRKS 120
            D                     SKHVTLPSLSALSHELRNSPGKQDMARTSGGDGQRRKS
Sbjct: 61   DTATKAAAAAVTETGTGTGTGTSKHVTLPSLSALSHELRNSPGKQDMARTSGGDGQRRKS 120

Query: 121  SNGFSLASLDNPLPASNDAENSSLRAPAARGLSIDEXXXXXXXXXXXXXXNQGKSAVTPP 180
            SNGFSLASLDNPLPASNDAENSSLRAPAARGLSIDE              NQGKSAVTPP
Sbjct: 121  SNGFSLASLDNPLPASNDAENSSLRAPAARGLSIDETTTPAVGVPPVVGTNQGKSAVTPP 180

Query: 181  SLHIPTHXXXXXXXXXXXXXXXMVASVSAMGGGIDSPYRPLNVKDALSYLEQVKLQFNSR 240
            SLHIPTH               MVASVSAMGGGIDSPYRPLNVKDALSYLEQVKLQFNSR
Sbjct: 181  SLHIPTHQQQQQQQQQQQQQQQMVASVSAMGGGIDSPYRPLNVKDALSYLEQVKLQFNSR 240

Query: 241  PYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNE 300
            PYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNE
Sbjct: 241  PYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNE 300

Query: 301  PIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQSPIQASLPPPQSAHLHLPXXXXXXXX 360
            PIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQSPIQASLPPPQSAHLHLP        
Sbjct: 301  PIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQSPIQASLPPPQSAHLHLPSTVAAATT 360

Query: 361  XXXXXNVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPIN 420
                 NVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPIN
Sbjct: 361  VQQSANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPIN 420

Query: 421  EVYAQVTVLFHNAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTG 480
            EVYAQVTVLFHNA             SSASNEQQPKQSPYSPQVYSGADMARGYMYNNTG
Sbjct: 421  EVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTG 480

Query: 481  VYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPS 540
            VYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPS
Sbjct: 481  VYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPS 540

Query: 541  MINNDGIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQ 600
            MINNDGIQISNMRGGGTVPALNQYGMISPHDYT                    SMMMDEQ
Sbjct: 541  MINNDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQ 600

Query: 601  YGSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLK 660
            YGSGDMQVRPEIDLD               NNLSLSEETSFFEKVKKNIGNRQIYIEFLK
Sbjct: 601  YGSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLK 660

Query: 661  VLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDL 720
            VLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDL
Sbjct: 661  VLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDL 720

Query: 721  CEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 780
            CEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL
Sbjct: 721  CEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 780

Query: 781  FKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKII 840
            FKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKII
Sbjct: 781  FKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKII 840

Query: 841  RKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 900
            RKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS
Sbjct: 841  RKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 900

Query: 901  LDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFD 960
            LDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFD
Sbjct: 901  LDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFD 960

Query: 961  IVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKF 1020
            IVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKF
Sbjct: 961  IVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKF 1020

Query: 1021 EKADDSKKRPRPDVELSLSDILHRAKYQKLKNGEGLGMXXXXXXXXXXXXXXXXXXXNAS 1080
            EKADDSKKRPRPDVELSLSDILHRAKYQKLKNGEGLGM                   NAS
Sbjct: 1021 EKADDSKKRPRPDVELSLSDILHRAKYQKLKNGEGLGMSEDDDEEKLAKEAEEMSEKNAS 1080

Query: 1081 KPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEI 1140
            KPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEI
Sbjct: 1081 KPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEI 1140

Query: 1141 NNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAY 1200
            NNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAY
Sbjct: 1141 NNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAY 1200

Query: 1201 NNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRS 1260
            NNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRS
Sbjct: 1201 NNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRS 1260

Query: 1261 HMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQ 1320
            HMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQ
Sbjct: 1261 HMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQ 1320

Query: 1321 DKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFS 1380
            DKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFS
Sbjct: 1321 DKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFS 1380

Query: 1381 RSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSE 1440
            RSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSE
Sbjct: 1381 RSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSE 1440

Query: 1441 ETKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNASTMGTSTVGDASNNVQ 1492
            ETKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNASTMGTSTVGDASNNVQ
Sbjct: 1441 ETKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNASTMGTSTVGDASNNVQ 1492

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1263 (58%), Positives = 887/1263 (70%), Gaps = 87/1263 (6%)

Query: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
            D+ YRPLNVKDALSYLEQVK QFNSRP IYNQFLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 207  DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266

Query: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG------VLENVRGSDITADQQPAIG 328
            +P+LIQGFNTFLP GYRI+C SNPN+PIKVTTP+G      +  +V+ ++    QQ A+ 
Sbjct: 267  YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALS 326

Query: 329  QLPTTQSPIQASLPP---PQSAHLHLPXXXXXXXXXXXXXNVHAENEPKKANDVEFSQAI 385
            Q    Q   QA +P      +A+L+               +  A+   KK  DVEFSQAI
Sbjct: 327  QNNMMQ---QAQIPIGSISNNANLN---------AAVQSVDDQAKQANKKPADVEFSQAI 374

Query: 386  SYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAXXXXXXXXXXXX 445
            +YVNKIKNRF+DQPDIYKNFLEILQTYQREQKPINEVYAQVT+LF NA            
Sbjct: 375  NYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLP 434

Query: 446  XSSASNE---QQPKQSPYSPQV--YSGADMARGYMYNNTGVYYPPQVNQP-----QSNLP 495
             SS   +   Q P+Q P   Q+  +SG+  AR           PP  N P     Q +LP
Sbjct: 435  DSSKEQQYTGQLPQQIPNQEQLEEFSGS-YAR-----------PP--NAPLDMVAQQSLP 480

Query: 496  PIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQ------QHAPSM----INND 545
            PIGSFSPPAN     TG ++    ++  +  +P+M  HEQ         P++    I+ND
Sbjct: 481  PIGSFSPPAN-----TGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISND 535

Query: 546  GIQISNMRGG----GTVPALNQYG---MISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMD 598
             I +S++R      G VP   QY     + P   T                         
Sbjct: 536  EIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQEL 595

Query: 599  EQYGSG---DMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIY 655
             +       +  VRPEIDLD               +N +L EETSFF+K KK I N+QIY
Sbjct: 596  LEQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIY 655

Query: 656  IEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHR 715
             EFLKVLNLFSQDLI+VD+LV KVE Y+    ELFEWF+NFVGYQ  PKIIEN++HEKHR
Sbjct: 656  TEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHR 715

Query: 716  LDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 775
            LDLDLCEA GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ
Sbjct: 716  LDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 775

Query: 776  YEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTI 835
            YEETLFKIEEERHEYD+YIESNLRTIQTLE I +KI+NM+EEEK  FKL PGLGHTSLTI
Sbjct: 776  YEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTI 835

Query: 836  YKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQK 895
            YKK+IRKVYDKERGFEIID LHEHPAI  PIVLKRLKQKDEEWRRAQREWNKVWRELEQK
Sbjct: 836  YKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQK 895

Query: 896  VYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDM 955
            VYFKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQNNKR+HWLTPKPK QL++   D 
Sbjct: 896  VYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDF 955

Query: 956  DIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKS 1015
            +I+FDI+ L++ F++H STYS  DKERL D  + FISLFF +P + I+ ALD ++++  S
Sbjct: 956  EILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNS 1015

Query: 1016 ---TDTKF-EKADDSKKRPRPDVELSLSDILHRAKYQKLK---------NGEGLGMXXXX 1062
               TD+   +  ++ KKR   D+ELS+SDILHR KYQK+K             +      
Sbjct: 1016 EKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDE 1075

Query: 1063 XXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTL 1122
                           +A +PWL+GDI+++ N+ G++TDR  +NLF NTN+Y+F+RHW+TL
Sbjct: 1076 ESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTL 1135

Query: 1123 YGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRL 1182
            Y RLLELK+M+  VTKEINNRK V+FAEDL L+STQL++MGLDF  K++Y+E L+LSKRL
Sbjct: 1136 YERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRL 1195

Query: 1183 IRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRL 1242
            I N++EHQWFEESLRQAYNN+AFKLYTVDKVV +LVKH HTLMTD K++E+M+LFEKDRL
Sbjct: 1196 IENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRL 1255

Query: 1243 QSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERW 1302
             S+T  KDQILYRL  RSHMS+TE MFR++YNKD R++ IQYI LDD+TL++   + E+W
Sbjct: 1256 SSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKW 1315

Query: 1303 NYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEA----GSDRYNPVGTSYSKL 1358
             YY+TSY+LPHPTEGI  + L +PFL++ILEF+ + L+        + +Y+P G S S  
Sbjct: 1316 KYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMY 1375

Query: 1359 KINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWK 1418
            KI I P  Y L IQ GS+DIFSR S+N+YP++ +       + K+K     FL+   GWK
Sbjct: 1376 KIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWK 1435

Query: 1419 KDL 1421
            K L
Sbjct: 1436 KHL 1438

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1389 bits (3596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1281 (57%), Positives = 885/1281 (69%), Gaps = 111/1281 (8%)

Query: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
            D+ YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 213  DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENV----RG----------- 316
            +P LIQGFNTFLPQGYRIECSSNP++PI+VTTPMG   V  N+    RG           
Sbjct: 273  YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFP 332

Query: 317  -SDITADQQPA-IGQLPTT------------QSPIQAS---LP----PPQSAHLHLPXXX 355
             SD    QQP+ +  +P++              P+ A+   LP    P   AH  +P   
Sbjct: 333  ESDGNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIP--- 389

Query: 356  XXXXXXXXXXNVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQRE 415
                      ++  + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQRE
Sbjct: 390  -------QSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 442

Query: 416  QKPINEVYAQVTVLFHNAXXXXXXXXXXXXXSSAS-------------------NEQQPK 456
            QKPINEVYAQVT LF NA             SSAS                      Q +
Sbjct: 443  QKPINEVYAQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQ 502

Query: 457  QSPYSPQVYSGADMARGYMYNNTGVY-YPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAI 515
                +          + ++Y  +G Y +P     PQ NLPPIGSFSPP NG   T   A 
Sbjct: 503  AQAQAQAQVEQQKQQQQFLYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGS--TVHEA- 559

Query: 516  PHADEQHVVAGVPAMAPHEQQHAPSMIN----NDGIQISNMRGGGT---VPALNQYGMIS 568
             + D+QH+        P   QH P+M++    N+   +S++R   T    P+  Q+    
Sbjct: 560  -YQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQH 618

Query: 569  PHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXX 628
            P                        S + + QY  GD+ VRPEIDLD             
Sbjct: 619  PQSI---------------------SPIANTQY--GDIPVRPEIDLDPSIVPVVPEPTEP 655

Query: 629  XXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPE 688
              NN+SL+EE +FFEK K+ IGN+ +Y EFLK+LNL+SQD++ +D+LV KV+ YL    E
Sbjct: 656  IENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 715

Query: 689  LFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCW 748
            LF WFKNFVGYQ+K K IEN++HEKHRLDLDLCEA+GPSYK+LPKSDTFMPCSGRDDMCW
Sbjct: 716  LFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 775

Query: 749  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIA 808
            EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI 
Sbjct: 776  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 835

Query: 809  SKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVL 868
            +KI NMTE EK  FKLPPGLGHTS+TIYKK+IRKVYDKERGFEIID LHEHPA+T P+VL
Sbjct: 836  NKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 895

Query: 869  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 928
            KRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSI
Sbjct: 896  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSI 955

Query: 929  KVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFR 988
            KVDQ NK++HWLTPKPK QLD+ F D +I +DI+ L D F+ H + YSNPDKERLKDL +
Sbjct: 956  KVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLK 1015

Query: 989  VFISLFFFIPRDLISAALDT-KSDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKY 1047
             FISLFF I  + I  +L + K +  +S+ +    +  S+KRP    E+SL DILHR++Y
Sbjct: 1016 YFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIASRKRPY-QQEMSLLDILHRSRY 1074

Query: 1048 QKLK-----NGEGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRA 1102
            QKLK     +G+   +                    A  PWL G++VE ANS G++ +R+
Sbjct: 1075 QKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRS 1134

Query: 1103 VYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDM 1162
            ++NLF NTN+YIF RHW+T+Y RLLE+KQM+ERVTKEIN R  V FA+DL+LLS+QL +M
Sbjct: 1135 IFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEM 1194

Query: 1163 GLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAH 1222
            GLDF G++AY++ L+LS+RLI  +LEHQWFEESLRQAYNNKAFKLYT+DKV  SLVKHAH
Sbjct: 1195 GLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAH 1254

Query: 1223 TLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSI 1282
            TLMTD K++E+M LF KDR  S+T  KDQI+YRL  RSHMS+TENMFR++++K T HVSI
Sbjct: 1255 TLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSI 1314

Query: 1283 QYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVE 1342
            QYI LDD+TL++ K D ++W YY+TSYALPHPTEGI  +KL +PFLER++EF  D+   E
Sbjct: 1315 QYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQDIDGTE 1374

Query: 1343 AGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEK 1402
               + ++P G S S LKI I P TY+L I++GSYD+F+R + N+YP   +      MV +
Sbjct: 1375 V-DEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQ 1433

Query: 1403 RKETAQKFLDGRFGWKKDLSD 1423
            +KE   KFLD   G + +L +
Sbjct: 1434 KKELISKFLDCAVGLRNNLDE 1454

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1373 bits (3554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1276 (56%), Positives = 885/1276 (69%), Gaps = 97/1276 (7%)

Query: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
            D  YRPLNVKDALSYLEQVK QF+ RP IYNQFLDIMKDFKSQ+IDTPGVIERVS LF+G
Sbjct: 204  DLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRG 263

Query: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQ 334
            +P L+QGFNTFLPQGYRIEC+++P+ PI+VTTPMG          T    PA+    +++
Sbjct: 264  YPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGT--------STLSGGPAMEAPSSSE 315

Query: 335  SPIQASLPPPQSAHLHLPXXXXXXXXXXXXXNVHAENEPK----KANDVEFSQAISYVNK 390
            S +Q      Q  H   P             N     +P+    K  +VEFSQAI+YVNK
Sbjct: 316  SNLQ------QQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNK 369

Query: 391  IKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAXXXXXXXXXXXXXSSA- 449
            IKNRF+DQPDIYK FLEILQTYQREQKPINEVY+QVTVLF +A             SS  
Sbjct: 370  IKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGT 429

Query: 450  -SNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSPPANGVA 508
             S  + P+ +    +        +   Y     YYP      Q NLPPIGSF+PP NG A
Sbjct: 430  TSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGT-QQNLPPIGSFAPP-NGTA 487

Query: 509  PTTGTAIPHADEQHVVA--GVPAMAPHEQ----QHAPSMIN---NDGIQISNMRGGGT-- 557
                 +  +A     V   G+P+M P++Q    Q  P +++   N+ I +SN+R   T  
Sbjct: 488  -----SREYAPGNQFVGPGGLPSMIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLTDQ 542

Query: 558  -VP-ALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLD 615
              P  LN    ++P                        +  M +QY + +  +RPEIDLD
Sbjct: 543  QYPNLLNMQNQMTP----------------GQMDINNATAPMAQQY-TNEAPIRPEIDLD 585

Query: 616  XXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDEL 675
                            N+SL EET+FFEK KK IG +Q+Y EFLK+LNL+SQDL+  DEL
Sbjct: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645

Query: 676  VTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSD 735
              KVE YL    ELF WFKNFVG+Q+KP IIEN++HEKH+LDLDLCEA GPSYKKLPK+D
Sbjct: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705

Query: 736  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 795
            TFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE
Sbjct: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765

Query: 796  SNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDE 855
            SNLRTIQTLETIA+KI NMT EEK  FKLPPGLGHTS TIYKK+IRKVYDK+RGFEIID 
Sbjct: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825

Query: 856  LHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKL 915
            LHE PA+TVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKL
Sbjct: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885

Query: 916  LTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTY 975
            LTTKQL+SEISSIKVDQ NKR+HWLTPKPK QL++QF+D DI  DI+GLT VF++H STY
Sbjct: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945

Query: 976  SNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDS--------- 1026
            SNP+KER+KD  RVF+SLFF IP D ++ AL  +S   +  + K +++  +         
Sbjct: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSS 1005

Query: 1027 -----KKRPRPDVELSLSDILHRAKYQKLK------NGEGLGMXXXXXXXXXXXXXXXXX 1075
                 KKRP  ++++ L+DIL + KYQK++      N E                     
Sbjct: 1006 SGSNSKKRPL-NIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQ 1064

Query: 1076 XXNA------SKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLEL 1129
              N        +PWL+G+I+E A++HG +++R V+N+F NTN+Y+F R W+ +Y RL E+
Sbjct: 1065 DENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEM 1124

Query: 1130 KQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEH 1189
            KQ++E+VTKE+N+R++ QFA+DLNL+STQL+DMGLDF G N+YQE L LSKRLI+N++EH
Sbjct: 1125 KQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEH 1184

Query: 1190 QWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVK 1249
            QWFEESLRQA+NNKAFKLYTVDKV+ SLVKHAHT++ D K+SE+M LFEKDRL SST  K
Sbjct: 1185 QWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAK 1244

Query: 1250 DQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSY 1309
            +QILYRL TR+HM++TENMFR+++N++  HV IQYI L+D+T++  K   + W YY+TSY
Sbjct: 1245 EQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSY 1304

Query: 1310 ALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKL 1369
            +LPHPTEG+ QD+L +PFLE+ LE E D    E G ++ +P G S SKLKI IDPK+Y L
Sbjct: 1305 SLPHPTEGVPQDELKIPFLEKTLELEVD----EEGDNKSSPEGVSSSKLKIKIDPKSYAL 1360

Query: 1370 IIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQ--KFLDGRFGWKKDLSD-DVI 1426
             I+ GS+D+FSR S+N YP       Y    +KRK   Q  KFLDG+ GWKK+L+  D  
Sbjct: 1361 EIEPGSFDLFSRKSMNVYPT------YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADST 1414

Query: 1427 NTVEPTKKIALLSEET 1442
            N  +  KK   LS+ T
Sbjct: 1415 NIEDLVKKSRELSKAT 1430

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1320 bits (3417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1417 (51%), Positives = 888/1417 (62%), Gaps = 111/1417 (7%)

Query: 84   KHVTLPSLSALSHE------LRNSPGKQDMARTSGGDGQRRKSSNGFSLASLDNPLPASN 137
            + + LPS S+L  E        N  G + +  +S        +S GFS+ASLDNPLP + 
Sbjct: 59   ERIILPSFSSLKTEDNRIDTSMNPIGPKSITTSSS-----TPASVGFSVASLDNPLPPAT 113

Query: 138  DAENSSL------RAPAARGLSIDEXXXXXXXXXXXXXXNQGKSAVTPPSLHIPTHXXXX 191
                  L      + P        +              NQ + +               
Sbjct: 114  KKPEIKLHPLPQQQQPRIYTQQQPQQQQILQQDQQEILQNQRQGST-------------- 159

Query: 192  XXXXXXXXXXXMVASVSAMGGGIDSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIM 251
                        + S  A   G    YRPLNVKDALSYLEQVK QF++RP IYN FLDIM
Sbjct: 160  -GASETSTTQSPLVSGPAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIM 218

Query: 252  KDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVL 311
            KDFKSQ IDTPGVIERVS+LFKG+P LIQGFNTFLPQGYRIECS+NPN+PIKVTTPMG  
Sbjct: 219  KDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSS 278

Query: 312  ENVRGSDITADQQPAIGQLPTTQSPIQASLPPPQSAHLHLPXXXXXXXXXXXXXNVHAEN 371
              V  +       P+  Q    Q+   A     QS    +P                   
Sbjct: 279  TTVLNTAPQKSPSPSDIQTNNQQTQAIAQEAQLQSQATPIPTQHDVGQNF---------G 329

Query: 372  EPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFH 431
              KK  DVEFSQAI+YVNKIK RF+DQPDIYK FLEILQTYQREQKPI+EVYAQVT+LF 
Sbjct: 330  SAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 389

Query: 432  NAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQV---------YSGADMARGYMYNNTGVY 482
            NA             SSAS  ++ +                    A+ A   M   TG Y
Sbjct: 390  NAPDLLDDFKKFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYY 449

Query: 483  YPPQ---------VNQPQSNLPPIGSFSPPANG--VAPTTGTAIPHADEQHVVAGVPAM- 530
             P +             Q NLPPIGSFSPP NG  V  T  +A P    Q  V  +P+M 
Sbjct: 450  EPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPET--QKGVMSLPSMM 507

Query: 531  ----APHEQ--QHAPSMINNDG--------IQISNMRGGGTVPALNQYGMISPHDYTXXX 576
                A  EQ  + A S + +D         +   N+     +P  N    +   +Y    
Sbjct: 508  NNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNY---- 563

Query: 577  XXXXXXXXXXXXXXXXXSMMMDEQY--GSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLS 634
                               M+D  Y     ++ VRPEIDLD               N+L+
Sbjct: 564  ----HPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLN 619

Query: 635  LSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFK 694
            L EET+FFE+VKK+IGN+QIY EFLK+LNLFS DL+ VDELV KVE Y+    ELF+WFK
Sbjct: 620  LMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFK 679

Query: 695  NFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDE 754
             FVGYQDKPK IEN++HEKH+LDLDLCEAYGPSYKKLPK+DTFMPCSGRDDMCWEVLNDE
Sbjct: 680  VFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDE 739

Query: 755  WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM 814
            WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLETIA+KIANM
Sbjct: 740  WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANM 799

Query: 815  TEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQK 874
            T+ EK  F+LPPGLGHTS+TIYKK+IRKVYDKERGFEIID LH +PAI+VPI+L+RLKQK
Sbjct: 800  TDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQK 859

Query: 875  DEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNN 934
            DEEWRRAQREWNK+WR+LEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEI+ IKVDQN+
Sbjct: 860  DEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNS 919

Query: 935  KRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLF 994
            KR+HWLTPKPK QLDY F D DI+FDI+ L  VF  + + YSNPDKER+KD+ RVF+S F
Sbjct: 920  KRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQF 979

Query: 995  FFIPRDLISAALDTKS---DEGKSTDTKFEKAD--------------DSKKRPRPDVELS 1037
            F IP   +S AL+ +    D    +D    K D               SKKRP  D +L+
Sbjct: 980  FSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPF-DNDLN 1038

Query: 1038 LSDILHRAKYQKLKNGEGLGMXXXXXXXXXXXXXXXXXXXNAS-----KPWLVGDIVERA 1092
            +SDILH+ K QK K  + +                     + S     K WLVGD+V+ A
Sbjct: 1039 MSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSA 1098

Query: 1093 NSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDL 1152
            N    + +R +YNLF NTN+YIF RH  TLY RL E+KQ+++ + KEI +R+V  FA+DL
Sbjct: 1099 NKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDL 1158

Query: 1153 NLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDK 1212
             L+STQL ++GLDF+  +AYQ+ L LSKRLI  ++EHQWFEES+RQAYNN+AFKLYT+DK
Sbjct: 1159 GLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDK 1218

Query: 1213 VVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQ 1272
            VV S VKHAHTL++D+K+SE+M LFE  R  + T  KDQILYR+  RSHMSSTENMFR++
Sbjct: 1219 VVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIE 1278

Query: 1273 YNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERIL 1332
            Y ++ RH SIQYI LDD+TL+ AK   E WNYY+TSY+L +PTEG+  + L VPFLE+++
Sbjct: 1279 YKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVI 1338

Query: 1333 EFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPD 1392
            EF+ +       +  Y+  G S S L I+ID + Y LI+Q GS D++SR++I +YPI   
Sbjct: 1339 EFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVAS 1398

Query: 1393 SKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTV 1429
             +     + ++ +  +K L    G   D  ++  N +
Sbjct: 1399 DESRAANISEKTQEIRKVLSHYDGNSNDDVNEKFNYI 1435

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1312 bits (3395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1254 (54%), Positives = 842/1254 (67%), Gaps = 90/1254 (7%)

Query: 216  SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275
            S YRPLNVKDALSYLEQVK QF+SRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF G+
Sbjct: 127  SAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGY 186

Query: 276  PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQS 335
            PALIQGFNTFLP GY IEC S+PN+PIKVTTP G +  +  +    +        P  QS
Sbjct: 187  PALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHGANTEPRLQS 246

Query: 336  PIQASLPPPQSAHLHLPXXXXXXXXXXXXXNVHAENEPKKANDVEFSQAISYVNKIKNRF 395
                ++P    +    P                    PKKA DVEFS AISYVNKIK RF
Sbjct: 247  --TQNVPTVYRSAEGSPAAIATPATTQEQYGTG----PKKAGDVEFSHAISYVNKIKTRF 300

Query: 396  SDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAXXXXXXXXXXXXXSSASNEQQP 455
            ++QPDIYK+FLEILQTYQREQKPINEVYAQVTVLF NA             SSA   Q  
Sbjct: 301  AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQ-- 358

Query: 456  KQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQP---QSNLPPIGSFSPPANG------ 506
                 S Q  +GA +A G+ +  +G+       QP   Q NLPP+G+FS P +       
Sbjct: 359  -----SHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMSLP 413

Query: 507  --VAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSMINNDGIQISNMRGGGTVPALNQY 564
                P  G  +      H+V                 ++N  I +S++RG          
Sbjct: 414  SVQGPNVG--LSQGQSGHIVT--------------QGVSNQHIPVSDLRGA--------- 448

Query: 565  GMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXX 624
                                         + + D QY   +  VRPEIDLD         
Sbjct: 449  -------------------PDASFRASEYNQVQDVQYM--EPTVRPEIDLDPSLVPVIPE 487

Query: 625  XXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLA 684
                  + L+L EE +FF+K KK IGN+QIY EFLK+LNL+SQDL+  ++LV  V +YL+
Sbjct: 488  PIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLS 547

Query: 685  GQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRD 744
            G PELF+WFK+FVGYQ++PK IENVIHEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD
Sbjct: 548  GSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRD 607

Query: 745  DMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTL 804
            +MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTL
Sbjct: 608  EMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTL 667

Query: 805  ETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITV 864
            ETIA+KIANMT EEK  FKLPPGLGHTS+TIYKK+IRKVYDK+RGFEIID LHEHPAITV
Sbjct: 668  ETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITV 727

Query: 865  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISE 924
            P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISE
Sbjct: 728  PLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISE 787

Query: 925  ISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLK 984
            ISSIKVDQ+NKR+H LTPK K QL Y F + ++  DI+ L  VF+ + +TYS  D ERLK
Sbjct: 788  ISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLK 847

Query: 985  DLFRVFISLFFFIPRDLISAALDTKSDEGKST----DTKFEKAD------DSKKRPRPDV 1034
            D F+ FISLFF  P   I   L  +S +  +     DT+  K D       ++KR R D 
Sbjct: 848  DFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDT 907

Query: 1035 ELSLSDILHRAKYQKLKNGEGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANS 1094
            E  L DIL+R K QK+  G                         A KPWL+G IV+ A++
Sbjct: 908  EHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGSIVDEADN 967

Query: 1095 HGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNL 1154
            HG V+DR  +N+F NTN+Y+F RH +T+Y RL+E+K+++  VTKEI+NRKVVQFA+DLNL
Sbjct: 968  HGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNL 1027

Query: 1155 LSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVV 1214
            +STQL DMGLDF G +AY+E L+LS+ LI  ELEHQWFEESLRQAY NKAFKLYT+DKV+
Sbjct: 1028 ISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVI 1087

Query: 1215 HSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYN 1274
             +LVKHAHT++ D+K+ E+M LF+ DR  +ST  KDQILYRL  RS+MS+ ENMFR++YN
Sbjct: 1088 QALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYN 1147

Query: 1275 KDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEF 1334
              T H SIQ++ ++D+TL++ K   ++W YY+TSY+L HPTEGI  D L  PFLE+I+E 
Sbjct: 1148 TTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIER 1207

Query: 1335 ENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSK 1394
            +   +D   G +RY+P G + S +K+ IDP TY + ++ G +DIFSR S+N++P R D K
Sbjct: 1208 DEGYID--DGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVK 1265

Query: 1395 GYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEETKDVGTL 1448
               +   + K   + FL+G  GWK+ L+     T E  +++    E  K+ GTL
Sbjct: 1266 K--KKSAELKLVLEGFLNGERGWKRGLTTK--RTAEAERRL----EYVKNNGTL 1311

 Score = 33.9 bits (76), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 214 IDSPYRPL----NVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVS 269
           I  P +PL    N+ +  ++ ++ K +F     IY +FL I+  +    ++   ++E VS
Sbjct: 485 IPEPIKPLEDELNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVS 543

Query: 270 TLFKGFPALIQGFNTFLPQGYR 291
               G P L   F +F+  GY+
Sbjct: 544 HYLSGSPELFDWFKSFV--GYQ 563

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1265 bits (3274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1281 (52%), Positives = 842/1281 (65%), Gaps = 121/1281 (9%)

Query: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
            D  YRPLN KDALSYLEQVK QFN+RP +YN FLDIMKD+KSQ IDT GVIER+STLFKG
Sbjct: 139  DPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 198

Query: 275  FPALIQGFNTFLPQGYRIECSSNPNEP--IKVTTPM---------------GVLENVRGS 317
            +P LIQG NTFLPQGY+IEC+ NPN+P  IKVTTP                G++E     
Sbjct: 199  YPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSL 258

Query: 318  DITADQQPA--IGQLPTTQSP----IQASLPPPQSAHLHLPXXXXXXXXXXXXXNVHAEN 371
              + D  P   +G  P    P       +LP P + + +LP               H   
Sbjct: 259  MPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNQNLPQHEQQNQQ-------HGSQ 311

Query: 372  EP---------------KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQ 416
             P               + + DVEFS AISYVNKIK RF+DQP+IYK+FLEILQTYQREQ
Sbjct: 312  SPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQ 371

Query: 417  KPINEVYAQVTVLFHNAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQV------------ 464
            KPI+EVYAQVT LF NA             ++A++EQQ        Q             
Sbjct: 372  KPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQQH 431

Query: 465  ---YSGA----DMARGYM---YNNTGVYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTA 514
               Y  A    D  + +    + NT  +Y  Q  +PQ NLPP+GSFSPP NG        
Sbjct: 432  QSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQ-NLPPLGSFSPPINGRENDPQLN 490

Query: 515  IPHADEQHVVAGVPAMAPHEQQ--HAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDY 572
            +P           PAM    QQ  H PS +      +  +  GGT+P  +  G +     
Sbjct: 491  LP-------AVQPPAMEFASQQVPHHPSHV------VPQVIPGGTLPLSDLRGAMD---- 533

Query: 573  TXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQV-----RPEIDLDXXXXXXXXXXXX 627
                                      +   S D+Q      RPEIDLD            
Sbjct: 534  ---------------------GNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIK 572

Query: 628  XXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQP 687
               N+L+L EETSFF++ KK +GN+Q+Y EFLK+LNLFSQDLI  +ELV KVE+YL G P
Sbjct: 573  PLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSP 632

Query: 688  ELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMC 747
            ELF+WFK+FV Y +KPK IENVIHEKHRLDLDLCEA  PSYKKLPK+DTFMPCSGRD+MC
Sbjct: 633  ELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMC 692

Query: 748  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETI 807
            WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI
Sbjct: 693  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETI 752

Query: 808  ASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIV 867
            A+KI+NMT EEK  FKLPPGLGHTS+TIYKK+IRKVYDK+RGFEIID LHE+PA++VPI+
Sbjct: 753  ANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPII 812

Query: 868  LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISS 927
            LKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISS
Sbjct: 813  LKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISS 872

Query: 928  IKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLF 987
            IKVDQ NKR++  TPKPK QLDY   D  ++FDI+ L + F+DH STYSNPDKE+L   F
Sbjct: 873  IKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFF 932

Query: 988  RVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKY 1047
            + F+S+FF I    I  +    SD   +++ +    +  +    P  EL  S   H  K 
Sbjct: 933  KGFLSVFFSISYQEIENSTPADSDAVSNSNPRKRLWESEQ----PLKELLRSKHKHHKKR 988

Query: 1048 QKLKNGEGLGMXXXX-XXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNL 1106
                  + +                       A KPWL+G+I++ AN HG V++R ++NL
Sbjct: 989  DTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNL 1048

Query: 1107 FGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDF 1166
            F NTNVY+F RH +T+Y RL E+K M+E VT+EIN+R VVQFA+DLNL+STQL DMGLDF
Sbjct: 1049 FANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDF 1108

Query: 1167 DGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMT 1226
             GK+AY + L L KRLIRN+++HQWFEESLRQAY NKAFK+YTVDKV+ SLVKHAH+++T
Sbjct: 1109 KGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIIT 1168

Query: 1227 DNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIG 1286
            D KS+E+M LFEKDR  ++T  K+QILYRL  RS+M  TENMFRV+ NKD+ HV IQY+ 
Sbjct: 1169 DAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVA 1228

Query: 1287 LDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSD 1346
            +DD+TL++ +   +RW+YY+TSYAL HPTEGI  +++ VPFLE+ L+   D  + + GS+
Sbjct: 1229 IDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQ---DDEEADEGSE 1285

Query: 1347 RYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKET 1406
              +P G S S L+I ++P++Y+L I+ GS DIF+R ++N +    ++     + E++++T
Sbjct: 1286 ERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKT 1345

Query: 1407 AQKFLDGRFGWKKDLSDDVIN 1427
                LDG  GWKK +S ++++
Sbjct: 1346 LMSQLDGSRGWKKGMSQELVD 1366

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 51/134 (38%), Gaps = 35/134 (26%)

Query: 6   NQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNISNSVSGSQHDXXXX 65
           +Q   + S++   L E +P   G++      +G+SK+ +P         V  SQ      
Sbjct: 11  SQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAP---------VDASQQ----- 56

Query: 66  XXXXXXXXXXXXXXXXXSKHVTLPSLSALSHELRNSPGK--QDMARTSGGDGQRRKS--S 121
                                 LPSLS L    R   G   Q +    G   Q   S  S
Sbjct: 57  -----------------PHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGS 99

Query: 122 NGFSLASLDNPLPA 135
            GFS+ASL+NPLPA
Sbjct: 100 KGFSVASLNNPLPA 113

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1145 (57%), Positives = 804/1145 (70%), Gaps = 70/1145 (6%)

Query: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433
            KK  DVEFSQAI+YVNKIKNRF++QPDIYK+FLEILQTYQREQKPINEVYAQVTVLF NA
Sbjct: 375  KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434

Query: 434  XXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSN 493
                         SS S  +Q +Q     Q      ++    YN T    PP   Q   N
Sbjct: 435  PDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPAFGLSA--YYNETS---PPTSRQ---N 486

Query: 494  LPPIGSFSPPANGVAPTTGTAIPH---ADEQHVVAGVPAMAP---HEQQHAPSMINNDGI 547
            LPP+GSFSPP NG       A+PH    D+Q    G+P +A    H  Q +P  I   GI
Sbjct: 487  LPPLGSFSPPPNG-------AVPHNYYRDQQPQTLGLPPVAQVENHIDQRSPPHIATQGI 539

Query: 548  Q-----ISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYG 602
                  +SN+R   T  + ++   +                          + + D QY 
Sbjct: 540  AGEPMPVSNLRSQITAQSPSELAQLH---------------QQQQIPSQPTANIPDGQYL 584

Query: 603  SGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVL 662
              D+ VRPEIDLD               ++L+L EETSFF++ KK IGN+QIY EFLK+L
Sbjct: 585  --DIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKIL 642

Query: 663  NLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCE 722
            NLFSQDL+ VDELV +VE+YL G  ELF WFKNFVG+QDKPK IEN++HEKHRLDLDLCE
Sbjct: 643  NLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCE 702

Query: 723  AYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782
            A GPSYKKLPKSDTFMPCSGRD+MCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 703  ACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 762

Query: 783  IEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRK 842
            IEEERHEYDFYIESNLRTIQTLETIASKIANM+EEEK  FKLPPGLGHTSLTIYKK+IRK
Sbjct: 763  IEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRK 822

Query: 843  VYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902
            VYDKERGFEIID LHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLD
Sbjct: 823  VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 882

Query: 903  HLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIV 962
            HLGLTFKQADKKLLTTKQLISEI SIK DQ NKRMHWLTPKPK QLDY   D  + FDI+
Sbjct: 883  HLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDIL 942

Query: 963  GLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKS--DEGKSTDTKF 1020
             LTD F++H S+YSNPDK RLKDLF++F+SLFF IP   ++ A+  +   D+ K   T+ 
Sbjct: 943  SLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDSTQK 1002

Query: 1021 EKAD--DSKKRPRPDVELSLSDILHRAKYQKLKN--GEGLGMXXXXXXXXXXXXXXXXXX 1076
             ++D  ++ KRPR D E+SLS++LHRAK Q+ K+   +                      
Sbjct: 1003 MESDNLNNSKRPRED-EISLSEVLHRAKNQRFKSRAADETSEESAAEPEPELNEEEETIR 1061

Query: 1077 XNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERV 1136
              A KPWL+G++VE  N+ GL+ +R  +N+F NTN+Y+F RH +TLY RL E+K+M++ V
Sbjct: 1062 QEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAV 1121

Query: 1137 TKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESL 1196
            TKEIN+RKVVQFA+DLNL+S QL++MGLDF+G +AY++   L KRLI  ++EHQWFEESL
Sbjct: 1122 TKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESL 1181

Query: 1197 RQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRL 1256
            RQAYNNKAFKLYTVDKV+ SLVKHAHT++TD+K+SE+M  FEKDR Q +T  KDQILYRL
Sbjct: 1182 RQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRL 1241

Query: 1257 LTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTE 1316
              RS+MSSTENMFR++YNK +++V IQ+I +DD+TL + +   E+W YY+TSY+L HPTE
Sbjct: 1242 QVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTE 1301

Query: 1317 GIMQDKLVVPFLERILEFENDM-LDVEAGS-DRYNPVGTSYSKLKINIDPKTYKLIIQDG 1374
            GI Q++L +PFLE++LE E D   DV+  S D+++P G S S LKI IDP+TY L I+ G
Sbjct: 1302 GISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAG 1361

Query: 1375 SYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKK 1434
            SYD+FSR S+N +P+  DS  Y    EK+K    +FL+ + GWKK+L DD +  ++  +K
Sbjct: 1362 SYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQ--EK 1419

Query: 1435 IALLSE-----------ETKDVGTLSTPVTTEKGAENTVHGLQ--PVALAENSNASTMGT 1481
            +A + E           +T+    +  P   E+  E+TV  +   P  L E   A   G 
Sbjct: 1420 LARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVADVNSLPKELVE---AEDRGN 1476

Query: 1482 STVGD 1486
             T  D
Sbjct: 1477 DTTAD 1481

 Score =  181 bits (459), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (93%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D+ YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVI+RVSTLFKG
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG 309
           +P LIQGFNTFLPQGYRIECS+NP+EPI+VTTPMG
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMG 282

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A++Y+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 286 LP 287
           LP
Sbjct: 445 LP 446

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 32/47 (68%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +V+ LF
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLF 245

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/1133 (57%), Positives = 787/1133 (69%), Gaps = 63/1133 (5%)

Query: 371  NEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
            ++ KKA DVEFSQAISYVNKIKNRFSDQPDIYK+FLEILQTYQREQKPINEVYAQVTVLF
Sbjct: 512  DQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLF 571

Query: 431  HNAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQP 490
             NA             SSAS  QQ +Q       +  A  A GY Y           NQP
Sbjct: 572  QNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQHQQAAAATGYGYYGE--------NQP 623

Query: 491  --QSNLPPIGSFSPPANGVAP-------TTGTAIPHADEQHVVAGVPAMAPHEQQHAPSM 541
              + NLPP+GSFSPP NG AP       + G A+P     H+      + P        M
Sbjct: 624  VARQNLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPM--THLETQAAKVTPSHYVMTQGM 681

Query: 542  INNDGIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXS------- 594
             +ND I +SNMR     P +   G  +P +                              
Sbjct: 682  -SNDAIPLSNMRS----PTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQQQE 736

Query: 595  ---------MMMDEQYGSG------DMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEET 639
                     +    Q G        D+ VRPEIDLD               ++LSL EET
Sbjct: 737  QSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEET 796

Query: 640  SFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGY 699
            SFF+K KK IGN+Q+Y EFLK+LNL+SQDL+ +D LV KVE+YL G  ELF WFKNFVGY
Sbjct: 797  SFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGY 856

Query: 700  QDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHP 759
            QD+PK IENVIHEKHRLDLD+CEA GPSYKKLPKSDTFMPCSGRD+MCWEVLNDEW+GHP
Sbjct: 857  QDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHP 916

Query: 760  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK 819
            VWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK
Sbjct: 917  VWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK 976

Query: 820  NMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWR 879
              FKLPPGLGHTSLTIYKK+IRKVYDKERGFEIID LHEHPA+ VP+VLKRLKQKDEEWR
Sbjct: 977  ANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWR 1036

Query: 880  RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHW 939
            RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ NKR+HW
Sbjct: 1037 RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHW 1096

Query: 940  LTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPR 999
            LTPKPK QLDY F D +I  DI+ LT+VF++H   YSN DKERLKD  + F+SLFF IP 
Sbjct: 1097 LTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPV 1156

Query: 1000 DLISAALDTKSDEGKSTDTKFEKADDSK----KRPRPDVELSLSDILHRAKYQKLK---N 1052
              ++  L  +S   K      +K + +     KRPR ++EL L DILHR KYQKLK   +
Sbjct: 1157 SEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPR-EIELPLRDILHRNKYQKLKLRSD 1215

Query: 1053 GE--GLGMXXX-XXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGN 1109
            GE   +G                      A KPWL+G+IVE AN+ G++++R  +NLF N
Sbjct: 1216 GEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFAN 1275

Query: 1110 TNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGK 1169
            T++Y+F RH +TLY RL+E+K +D+ VT+EIN+RKV QFA+DLNL+S QL++MGLDF G 
Sbjct: 1276 TSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGL 1335

Query: 1170 NAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNK 1229
            +AY++ L LSKRLI  ++EHQWFEESLRQAYNN+AFK YTVDKVV +LVKHAHT++TD K
Sbjct: 1336 DAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIK 1395

Query: 1230 SSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDD 1289
             SE+M LFEKDR  ++T  KDQILYR+  RSHMS+TENMFR+++N+ ++HV IQYI +DD
Sbjct: 1396 CSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDD 1455

Query: 1290 VTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYN 1349
            +TL +AK   ++W YY+TSY+L HPTEGI  + L VPFLE+I+E E +  +   G  +++
Sbjct: 1456 LTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFS 1515

Query: 1350 PVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQK 1409
            P G S S L+I IDP+TY L ++ GS D+FSR ++N++P+  +S+ +   V+K+ E  + 
Sbjct: 1516 PEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRG 1575

Query: 1410 FLDGRFGWKKDLSDDVINTVEPTKKIALLSEETKDVGTLSTPVTTEKGAENTV 1462
            +LD   GWKK+L    I +VE  +K+  +    K+ GTL      E G E+T 
Sbjct: 1576 YLDSEKGWKKNLDAKSIQSVE--EKLNFV----KNYGTLQGYRAQENGLESTT 1622

 Score =  181 bits (460), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 102/132 (77%), Gaps = 6/132 (4%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D  YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAI--GQLPT 332
           +P LIQGFNTFLPQGYRI+CS NP+EPIKVTTPMG    V G  +    Q A+  GQ P 
Sbjct: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGS-STVAG--VAEMNQAALFQGQQPR 390

Query: 333 TQSPIQA-SLPP 343
            Q  +Q  S PP
Sbjct: 391 IQQHLQPLSFPP 402

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A+SY+ ++K +F+ +P IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 286 LP 287
           LP
Sbjct: 585 LP 586

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 32/47 (68%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +V+ LF
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1231 bits (3186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/1082 (57%), Positives = 773/1082 (71%), Gaps = 31/1082 (2%)

Query: 366  NVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQ 425
            N+    + +K  DVEFSQA+SYVNKIKNRF+DQPDIYK+FLEILQTYQREQKPI+EVYAQ
Sbjct: 348  NIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQ 407

Query: 426  VTVLFHNAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPP 485
            VTVLF NA             SS S   Q    P    +        G    N G Y   
Sbjct: 408  VTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQPMYGV---NNGYYQAG 464

Query: 486  QVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAM--AP------HEQQH 537
            ++     NLPP+G+FSPP+NG  P         + QH +  +P+M  AP      H QQH
Sbjct: 465  KIPSANQNLPPLGNFSPPSNGAVPGRPEEF-STEAQHHMMALPSMLQAPTEHAQLHAQQH 523

Query: 538  APSMINNDGIQISNMRGGGTVPALNQYGMISPHDYT----XXXXXXXXXXXXXXXXXXXX 593
               M  N+ I IS++R    +   N       H+YT                        
Sbjct: 524  IAPM-TNEAIPISDLRS--QIIDNNHV-----HNYTPIELAQLQQQQQQQQQQQQQQQQQ 575

Query: 594  SMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQ 653
             M ++  Y +  + VRPEIDLD                +LSL EE +FF+K KK IGN+Q
Sbjct: 576  QMQLEAAYATEGI-VRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQ 634

Query: 654  IYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEK 713
            +Y+EFLK+LNL+SQD++++D+L+ KV+ YL    ELF+WFKNFVG+QDKPK IENV+HEK
Sbjct: 635  VYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEK 694

Query: 714  HRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRK 773
            H+LDLDLCEA GPSYKKLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRK
Sbjct: 695  HKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRK 754

Query: 774  NQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSL 833
            NQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK  FKLP GLGHTS 
Sbjct: 755  NQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTST 814

Query: 834  TIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELE 893
            TIY+K+IRKVYDKERGFEIID LHE+P++ VP+VLKRLKQKD+EWRRAQREWNKVWRELE
Sbjct: 815  TIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELE 874

Query: 894  QKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFN 953
            QKV+FKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQ NKR+HWLTPKPK QLDY+  
Sbjct: 875  QKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVK 934

Query: 954  DMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEG 1013
            D  ++FDI+ L DVF++H S+YSNPDKERL+D  + +I LFF IP   I  A++   D G
Sbjct: 935  DKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNG 994

Query: 1014 KSTDTKFEKAD--DSKKRPRPDVELSLSDILHRAKYQKLK---NGEGLGMXXXXXXXXXX 1068
            K  D   + +   +S KRPR DVE+ LSDIL+R++YQ+LK   +     +          
Sbjct: 995  KQLDENEQNSSKKNSNKRPR-DVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQ 1053

Query: 1069 XXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLE 1128
                      A KPWL+G +VE ANS GL+ +R +YN+F N N+Y+F+R+  T+Y RL E
Sbjct: 1054 DDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHE 1113

Query: 1129 LKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELE 1188
            +K +++ VTKEIN RKVVQFA+DLNL+S QL++MGLDF G ++Y + L LSKRLI  +LE
Sbjct: 1114 VKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLE 1173

Query: 1189 HQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCV 1248
            HQWFEESLRQAY N+AFKLYT+DKV+ SLVKHAH +MTD+KSS++M LFEKDR+ SST  
Sbjct: 1174 HQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTS 1233

Query: 1249 KDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTS 1308
            KDQILYRL TRSHMS+TE+MFR++YN     +SIQYI LDD+TLE+ K   ++W YY+TS
Sbjct: 1234 KDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITS 1293

Query: 1309 YALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYK 1368
            Y+L HPTEGI Q+++ +PFL++++E E   ++ E  + +Y+P G S S L I IDP+TY+
Sbjct: 1294 YSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYR 1353

Query: 1369 LIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINT 1428
            L ++ GS+DIFSR S+N++P+   S+ Y    + R+   + FL+G+ GWK+ LS D I+ 
Sbjct: 1354 LEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISK 1413

Query: 1429 VE 1430
            +E
Sbjct: 1414 IE 1415

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (94%)

Query: 216 SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275
           S YRPLNVKDAL+YLEQVKLQFNSRP IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+G+
Sbjct: 119 SYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGY 178

Query: 276 PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG 309
           P LIQGFNTFLPQGY IECSSNP++PIKVTTP+G
Sbjct: 179 PNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLG 212

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 219 RPLNVK--DALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFP 276
           +P +V+   A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 277 ALIQGFNTFLP 287
            L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 32/47 (68%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A++Y+ ++K +F+ +PDIY +FL+I++ ++ +      V  +V+ LF
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1218 bits (3152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1348 (49%), Positives = 838/1348 (62%), Gaps = 169/1348 (12%)

Query: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
            D+ YRPLN KDALSYLEQVK QFN+RP +YN FLDIMKD+KSQ IDT GVIER+STLFKG
Sbjct: 246  DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305

Query: 275  FPALIQGFNTFLPQGYRIECSSNPNEP--IKVTTP------MGVLENVRGSDITAD---- 322
            +P LIQG NTFLPQGY+IEC+SNP++P  IKVTTP      + +  N  GS +       
Sbjct: 306  YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGHLAGP 365

Query: 323  ------------QQPAIGQLPTTQSPI----QASLPPPQSAHL----HLPXXXXXXXXXX 362
                        Q+ A+ +    ++P+     A+    Q  H                  
Sbjct: 366  ATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSAQLQQS 425

Query: 363  XXXNVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEV 422
                 +A N P    DVEFS AISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPI+EV
Sbjct: 426  QQDQQYATNRPN--GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEV 483

Query: 423  YAQVTVLFHNAXXXXXXXXXXXXXSSASNEQ----------------------------- 453
            Y QVT LF NA             ++A++EQ                             
Sbjct: 484  YTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQSQQYQ 543

Query: 454  ----------QPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSPP 503
                      Q +Q   SP             +N+   +Y  Q  + Q NLPP+G+FSPP
Sbjct: 544  SFQSSPQELDQRQQQSNSP-------------FNHPASFYQHQQARAQ-NLPPLGNFSPP 589

Query: 504  ANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQH--APSMINNDGIQISNMRG---GGTV 558
             NG        +P A +   +   P       +H  A  M NN  + +S+MRG   GG  
Sbjct: 590  INGRDNEAQVNLP-AVQPPALDFPPQQQSQSHRHVVAQGMTNN-SLPVSDMRGPVDGGFA 647

Query: 559  PALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLDXXX 618
            P                                      D QY   +   RPEIDLD   
Sbjct: 648  P--------------------------------QPLYSQDVQYM--EPTSRPEIDLDPSL 673

Query: 619  XXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTK 678
                        N+ +L EETSFF+K KK +GN+Q+Y EFLK+LNLFSQDLI  DELV K
Sbjct: 674  VPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDK 733

Query: 679  VENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFM 738
            VE+YL G  ELF+WFK+FV Y ++PK IENV+HEKHRLDLDLCEA  PSYKKLPK+DTFM
Sbjct: 734  VEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFM 793

Query: 739  PCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNL 798
            PC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NL
Sbjct: 794  PCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANL 853

Query: 799  RTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHE 858
            RTIQ LETIA+KI+NMT EEK  FKLPPGLGHTS TIYKK+IRKVYDK+RGFEIID LHE
Sbjct: 854  RTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHE 913

Query: 859  HPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTT 918
            +PA++VPIVL+RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT 
Sbjct: 914  NPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTA 973

Query: 919  KQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNP 978
            KQLISEISSIK+DQ NKR++  T KPK QLD+  +D  ++FDI+ L D F+DH +TYSNP
Sbjct: 974  KQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNP 1033

Query: 979  DKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRPDVELSL 1038
            DKE+L   FR F+S+FF IP       LD  S+E K      E  D ++KR R D +   
Sbjct: 1034 DKEKLSAFFRGFLSIFFSIPL----TDLDNPSEEHK-----VENGDSTRKRSRDDDQF-F 1083

Query: 1039 SDILHRAKY------QKLKNGEGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERA 1092
             D+L            + ++                         +A KPWL+G+I++ A
Sbjct: 1084 RDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEA 1143

Query: 1093 NSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDL 1152
            N+HG V++R  YN+F NTN+Y+F RH +T+Y RL E K ++E VTKEIN+RKVVQFA+DL
Sbjct: 1144 NNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDL 1203

Query: 1153 NLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDK 1212
            NL STQL DMGLDF G +AY++ L L KRLI++++EHQWFEESLRQAY NKAFK+YTVDK
Sbjct: 1204 NLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDK 1263

Query: 1213 VVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQ 1272
            V+ SLVKHAH+++TD K++E+M LFEKDR   +T  ++QILYRL  RS M  TENMFR++
Sbjct: 1264 VIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIE 1323

Query: 1273 YNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERIL 1332
             N  + HVSIQ++ +DD+TL       ++W YY+TSY+L HPTEG+  +++  PFLE+ L
Sbjct: 1324 LNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTL 1383

Query: 1333 EFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPD 1392
              + D  +       Y+P G S S+L+I I+P++Y L I+  S D+F+RS++N++P +  
Sbjct: 1384 RDDGDSDEDSEW---YSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIG 1440

Query: 1393 SKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVI-------------------NTVEPTK 1433
                      +K  A   ++   GWKK L ++ I                    TV P  
Sbjct: 1441 EASGRDAKTMQKSLAD-MVNSEHGWKKGLQNESIGKAESIINFVKARGFLEKATTVSPDP 1499

Query: 1434 KIALLSEETKDVGTLSTPVTTEKGAENT 1461
            K+    E +   G +    TTEK  ++T
Sbjct: 1500 KVE--KEHSASNGAIPEGATTEKPGDDT 1525

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 84  KHVTLPSLSALSHELRNSPGK--QDMARTSGGDGQRRKS--SNGFSLASLDNPLP 134
           +HV LPSLS L    R   G   Q +    G   Q   S  S GFS+ASL+NPLP
Sbjct: 162 QHVVLPSLSGLETGGRAEYGASAQRLPFMQGAAPQSASSGGSKGFSVASLNNPLP 216

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1110 (55%), Positives = 760/1110 (68%), Gaps = 61/1110 (5%)

Query: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433
            +K  DVEFSQA+SYVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI+EVY+QVT+LF NA
Sbjct: 347  EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNA 406

Query: 434  -----XXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVN 488
                               + +N+     +    Q++        ++Y N   Y   Q N
Sbjct: 407  PDLLDDFKKFLPDNNNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYY---QNN 463

Query: 489  QPQS---------------NLPPIGSFSPPAN-------------GVAPTTGTAIPHADE 520
             P +               +LPP+G+F PP+N             G++      + H   
Sbjct: 464  VPTAAAAAANAAGNVVTIQSLPPLGNFLPPSNKNNNTTAVNNNLMGISSIMHPKVDHIQS 523

Query: 521  QHVVAGVPAMAPHEQQHAPSMINNDGIQISNMRG-----GGTV---------PA-LNQYG 565
            Q  +A         QQ + + + N+ +QIS +RG     G T          PA LNQ  
Sbjct: 524  QQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQ-- 581

Query: 566  MISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXX 625
             +    +                      M MD  Y   D+ VRPEIDLD          
Sbjct: 582  -LQAQQHISIQQQQQQQQQQQQQLQMQMQMQMDGGYPQ-DISVRPEIDLDPSIVPVIPEP 639

Query: 626  XXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAG 685
                 ++LSL EET+FF+K KK I N+QIY+EFLK+LNL+SQ+++ V+ELV KV+ YL  
Sbjct: 640  VEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGS 699

Query: 686  QPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDD 745
              ELF+WFK FVGYQDKPK IEN++HEKH+LDLDLCEAYGPSYKKLPK+DTFMPCSGRD+
Sbjct: 700  NKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDE 759

Query: 746  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE 805
            MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE
Sbjct: 760  MCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE 819

Query: 806  TIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVP 865
            TIASKIANMTEEE+  FKLP GLGHTS+TIY+K+IRKVY KERGFE+ID LHE+PA+ VP
Sbjct: 820  TIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVP 879

Query: 866  IVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEI 925
            I+LKRLKQKDEEWRRAQREWNKVWREL+QKVY+KSLDHLGLTFKQADKKLLTTKQLISEI
Sbjct: 880  IILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEI 939

Query: 926  SSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKD 985
            SSIKVDQ NK++HWLTPKPK QLDY+  D  I++DI+ LTDVF++H S YSNPDKERL+D
Sbjct: 940  SSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRD 999

Query: 986  LFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDS----KKRPRPDVELSLSDI 1041
              + FISLFFFIP   I AA+  +S    +     E + DS    KKR   D ++S  DI
Sbjct: 1000 FLQSFISLFFFIPLADIKAAIKIRSPLDDTKTDSEESSGDSDKFPKKRSIEDDDISFHDI 1059

Query: 1042 LHRAKYQKLKNG-EGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTD 1100
            L + KYQK+K G +                        A KPWL+G IV+ ANS G++ +
Sbjct: 1060 LDKVKYQKVKQGLDKNETFSNDISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQN 1119

Query: 1101 RAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLR 1160
            R+ YN+FGNTN+Y+FIRH  TLY RL E KQM+  VT+EI NR +V FA+DLNL+STQL+
Sbjct: 1120 RSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLK 1179

Query: 1161 DMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKH 1220
            +MGLDF+G ++Y++ L LS RLI   LEH WFEESLRQA+ NKAFKLYT+DKV  S+VKH
Sbjct: 1180 NMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKH 1239

Query: 1221 AHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHV 1280
            AHT+M+D K++E+M L EKDR  ++T  KDQILYRL  RSHMS+T+NMFR+++NK + ++
Sbjct: 1240 AHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNI 1299

Query: 1281 SIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERIL-EFENDML 1339
            SIQYIG+DD+TL + K   E+W YY+TSYAL HPTEG+ Q+++ +PFLE+IL   E    
Sbjct: 1300 SIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAE 1359

Query: 1340 DVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQM 1399
            + E  +D+Y+P G S S LKI I P+ Y L I+ GS+D FSR S+N+YPI   S  Y   
Sbjct: 1360 EEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNK 1419

Query: 1400 VEKRKETAQKFLDGRFGWKKDLSDDVINTV 1429
             +   +    FL+G+FGWK+ LS+D IN +
Sbjct: 1420 KKLSIDRVNAFLNGKFGWKQSLSEDEINNI 1449

 Score =  177 bits (449), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 79/92 (85%), Positives = 89/92 (96%)

Query: 218 YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277
           YRPLNVKDAL+YLEQVKLQF+SRP IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+G+P+
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 278 LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG 309
           LIQGFNTFLPQGY IEC++NPN+PIKVTTP+G
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIG 233

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 219 RPLNVK--DALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFP 276
           +P +V+   A+SY+ ++K +F   P IY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 348 KPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAP 407

Query: 277 ALIQGFNTFLP 287
            L+  F  FLP
Sbjct: 408 DLLDDFKKFLP 418

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 32/47 (68%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A++Y+ ++K +FS +PDIY +FL+I++ ++ +      V  +V+ LF
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 196

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1140 (53%), Positives = 767/1140 (67%), Gaps = 81/1140 (7%)

Query: 378  DVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAXXXX 437
            +VEFSQAI+YVNKIK R++DQP IYK+FLEILQTYQRE+KPI+EVY QVTVLF++A    
Sbjct: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523

Query: 438  XXXXXXXXXSSASNEQQPKQSPYS-PQV----------YSGADMARGYMYNNTGVYYPPQ 486
                     + A+N  QP Q P++ PQ+                ++ Y ++N G      
Sbjct: 524  EDFKKFLPETPANN--QPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYPFSNNGPVPSGF 581

Query: 487  VNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSMINND- 545
               PQ NLPPIGSFSPP    A  T T        +   G+       Q   PSM+  D 
Sbjct: 582  YQIPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISM-----QTALPSMMTPDT 636

Query: 546  -GIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGS- 603
              I ISN+R     P  +   +  P++ T                       +D+Q    
Sbjct: 637  EAIPISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRLPDQFPLDQQQSQQ 696

Query: 604  ---------------GDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKN 648
                            +   RPEIDLD               NN++L EETSFFEKVKK 
Sbjct: 697  QQAQQQAQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKF 756

Query: 649  IGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIEN 708
            I ++ IY+EFLKVLNL+SQDL++ +ELVT+V+ Y+    ELF+WFK FVGY + P  IEN
Sbjct: 757  ISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIEN 816

Query: 709  VIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGF 768
            +IHEKH+LDLDLCEAYGPSYKKLPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGF
Sbjct: 817  IIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGF 876

Query: 769  IAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGL 828
            IAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQTLETIA+KI NMT EEK  FKLP GL
Sbjct: 877  IAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGL 936

Query: 829  GHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKV 888
            GHTS TIYKK+IRKVYDKERGFEIID LHEHPA  VPI+L+RLK+KDEEWRRAQREWNKV
Sbjct: 937  GHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKV 996

Query: 889  WRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQL 948
            WRELEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEISSI+VDQNNKR+HWLTPKPK QL
Sbjct: 997  WRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQL 1056

Query: 949  DYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDT 1008
            D+ FND DI+ DI+ L +VF+DH STYSN +KERLKD  RVFI LFF IP   I   L  
Sbjct: 1057 DFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSG 1116

Query: 1009 KSDEGKSTDTKFEKA-----------DDSKKRPRPDVELSLSDILHRAKYQKLKNG---- 1053
            K+DE      KFEK              +KKR   ++++ L+D+L + KYQK+K      
Sbjct: 1117 KNDE------KFEKGSSSSSSTSNSTPSAKKRSL-ELDIPLADVLRKYKYQKIKEKVINE 1169

Query: 1054 -----------EGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRA 1102
                       +                          KPWL+G ++++ + HGL+ +R 
Sbjct: 1170 LENNSNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRH 1229

Query: 1103 VYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDM 1162
            ++NLF NTN+Y+F RHW+T+Y RLLELKQ++++VT+EIN+RKV  FA+DL L+STQL  M
Sbjct: 1230 IFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMM 1289

Query: 1163 GLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAH 1222
            GLDF   ++Y+E L L+KRLI+N++EHQWFEESLRQAYNNKAFKLYT DKV+ +LVKHA+
Sbjct: 1290 GLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHAN 1349

Query: 1223 TLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSI 1282
            +++TD+K+SE+M LFEKDRL+SST  +DQI+YRL TR+HM++TENMFR+++N++T HV I
Sbjct: 1350 SILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCI 1409

Query: 1283 QYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLER--ILEFENDM-L 1339
            QYI ++D+TL+ +    E W YY+TSYALPHPTEG+ Q+ L VPFLE+   LE EN   L
Sbjct: 1410 QYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDL 1469

Query: 1340 DVEAGSDRY----NPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKG 1395
            D E   + +    +P G S SKLKI ID +TY L ++ GS+D+FSR S+N++P   D+K 
Sbjct: 1470 DNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPT--DAKK 1527

Query: 1396 YVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEETKDVGTLSTPVTTE 1455
                ++++ E   KFL  + GW      D +  +E   K     +ET +   +  P+TTE
Sbjct: 1528 IESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKF---QETGEFIPIPKPITTE 1584

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/111 (74%), Positives = 94/111 (84%), Gaps = 5/111 (4%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D  YRPLNVKDALSYLEQVK+QFNS+P IYNQFLDIMKDFKSQ IDTPGVIERVSTLFKG
Sbjct: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGV-----LENVRGSDIT 320
           +P LIQGFNTFLPQGY I CS NP++P++VTTPMG      L NV  ++++
Sbjct: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVS 377

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A++Y+ ++K ++  +P+IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 286 LPQ 288
           LP+
Sbjct: 530 LPE 532

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 30/47 (63%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A+SY+ ++K +F+ QP IY  FL+I++ ++ +      V  +V+ LF
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (76%), Gaps = 1/26 (3%)

Query: 116 QRRKS-SNGFSLASLDNPLPASNDAE 140
           QR  S S GFS+AS DNPLP+SN+ E
Sbjct: 182 QRNNSASAGFSVASFDNPLPSSNNNE 207

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1093 (55%), Positives = 745/1093 (68%), Gaps = 80/1093 (7%)

Query: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433
            KK  DVEFS AISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYAQVTVLF NA
Sbjct: 347  KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 406

Query: 434  XXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQS- 492
                         +SA   QQ   +   PQ+ +GA     + ++       PQ +Q QS 
Sbjct: 407  PDLLDDFKKFLPDASAPQAQQQHLAQSHPQL-NGALTPSSFYHSQQQQGPQPQQDQSQSQ 465

Query: 493  ----------------------NLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAM 530
                                  NLPP+GSFS P  G        +  A   ++  G PA 
Sbjct: 466  HPVQQQQQQQQQQQQQTVIHQQNLPPLGSFSTP--GDHHPMNLPLVQAPNMNLNQGHPAH 523

Query: 531  APHEQQHAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXX 590
                       ++N  I IS++R               P +Y                  
Sbjct: 524  I------ITQGMSNQKIPISDLRTTADTS-------YRPAEY------------------ 552

Query: 591  XXXSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIG 650
               S   D QY   +   RPEIDLD               + L+L EE SFF+K KK IG
Sbjct: 553  ---SQGQDTQYM--ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIG 607

Query: 651  NRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVI 710
            N+QIY EFLK+LNL+SQDL+  + LV KV +YL+G PELF+WFK+FVGYQ+KPK IEN++
Sbjct: 608  NKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIV 667

Query: 711  HEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIA 770
            HEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIA
Sbjct: 668  HEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 727

Query: 771  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGH 830
            HRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEK  FKLPPGLGH
Sbjct: 728  HRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGH 787

Query: 831  TSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 890
            TS+TIYKK+IRKVYDK+RG+EIID LHE+PAITVPIVLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 788  TSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 847

Query: 891  ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDY 950
            ELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQNNKR+H LTPK K QLD+
Sbjct: 848  ELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDH 907

Query: 951  QFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKS 1010
             F D ++ +DI+ L  VF+++ +TYS PDKERLKD F+ FISLF   P   I  AL  K 
Sbjct: 908  DFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKAL-AKR 966

Query: 1011 DEG-------KSTDTKFEKADDS------KKRPRPDVELSLSDILHRAKYQKLKNGEGLG 1057
            D          +T+T  EK  +       KKR R D +  L D+L R K QK       G
Sbjct: 967  DAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRG 1026

Query: 1058 MXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIR 1117
                                 A  PWL+G IV+ A++HG V +R  +NLF NTN+Y+F R
Sbjct: 1027 DSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFR 1086

Query: 1118 HWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLK 1177
            H +T+Y RL+E+K+M++ VTKEI NRKVVQFA+DLNL+STQL DMGLDF G++AY++ L+
Sbjct: 1087 HLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQ 1146

Query: 1178 LSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELF 1237
            LS+ LI  +LEHQWFEESLRQAY NKAFK+YTVDKV+ +LVKHAH ++TDNK+ E+M LF
Sbjct: 1147 LSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLF 1206

Query: 1238 EKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKD 1297
            EKDR   ST  KDQILYRL  RS+MS+ ENMFR++YN+ T HV IQ++ +DD+TLE+ K 
Sbjct: 1207 EKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKS 1266

Query: 1298 DNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSK 1357
              ++W YY+TSY+L HPTEGI  D L  PFLE+I+E E D+++ +   ++Y+P G + S 
Sbjct: 1267 LKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDK--DEKYSPEGVATSN 1324

Query: 1358 LKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGW 1417
            LK+ IDP TY + ++ GS+DIFSR ++N++P+R D +   +   + K   ++FL+   GW
Sbjct: 1325 LKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRK--KKSSELKLELERFLNSNSGW 1382

Query: 1418 KKDLSDDVINTVE 1430
            KKDLS   I  VE
Sbjct: 1383 KKDLSAKQIAEVE 1395

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 87/99 (87%)

Query: 216 SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275
           S YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G+
Sbjct: 158 SSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGY 217

Query: 276 PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENV 314
           P LIQGFNTFLPQGY IECSS+PN+PIKVTTP G    V
Sbjct: 218 PTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTTGEV 256

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 286 LP 287
           LP
Sbjct: 417 LP 418

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 32/47 (68%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLF 430
           A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +V+ LF
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 214 IDSPYRPLNVKDALSYLEQVKLQFNSRPYI-----YNQFLDIMKDFKSQNIDTPGVIERV 268
           I  P +PL  +D L+ +E+      ++ YI     Y +FL I+  +    +D   ++E+V
Sbjct: 579 IPEPIKPL--EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKV 636

Query: 269 STLFKGFPALIQGFNTFLPQGYR 291
                G P L   F +F+  GY+
Sbjct: 637 GHYLSGCPELFDWFKSFV--GYQ 657

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1120 (53%), Positives = 746/1120 (66%), Gaps = 100/1120 (8%)

Query: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433
            +K  +VEFS AISYVNKIK RF+DQPDIYK FLEILQTYQREQKPI+EVYAQVT+LF N 
Sbjct: 420  QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNN 479

Query: 434  XXXXXXXXXXXXXSSASN-------------------------------------EQQPK 456
                         SS S                                      + Q +
Sbjct: 480  PDLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQ 539

Query: 457  QSPYSPQVY--SGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSPPANGVA-PTTGT 513
            Q+   PQ Y      M     Y  +GV   P      +NLPP+G+FS  A+G A P   +
Sbjct: 540  QAMLPPQPYLQQNQSMQGQGFYPQSGVLMQP------TNLPPLGNFS--ASGQASPAENS 591

Query: 514  AIPHADEQHVVAG--VPAMAPHEQQHAPSM-INNDGIQISNMRG--GGTVPALNQYGMIS 568
             +  +  QH+  G  +P       QH  +  ++N  I +S MR    GT    NQ   I 
Sbjct: 592  HMLPSMHQHIAGGHVIP-------QHVVTQGMSNQDIPVSEMRSTMNGT---YNQVEYIQ 641

Query: 569  PHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXX 628
                                       +   QY    M  RPEIDLD             
Sbjct: 642  -------------------GAPGYPQPLEGVQYMEAPM-ARPEIDLDPSLVPVVPEPIQP 681

Query: 629  XXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPE 688
              + ++L +E +FFE+VK+ IGN+Q+Y EFLK+LNL+SQDL+   ELV+KVE YL    E
Sbjct: 682  PEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKE 741

Query: 689  LFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCW 748
            LF+WFK+FVGYQ+KPK IEN++HEKHRLDLDLCEA GPSYKKLPK DTFMPCSGRD+MCW
Sbjct: 742  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCW 801

Query: 749  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIA 808
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA
Sbjct: 802  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIA 861

Query: 809  SKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVL 868
            +KIANMT EEKN FKLPPGLGHTSLTIYKK++RKVYDK+RGFEIID LHEHPA+TVPIVL
Sbjct: 862  NKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVL 921

Query: 869  KRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSI 928
            KRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSI
Sbjct: 922  KRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSI 981

Query: 929  KVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFR 988
            KVDQ NKR+H LTPKPK QLD++ ND ++++DI+ L   FV   ++YSN DK +L   F+
Sbjct: 982  KVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFK 1041

Query: 989  VFISLFFFIPRDLISAALDTKSD----EGKSTDTKFEKADDSKKRPRPDVELSL-SDILH 1043
             FISLFF  P   ++ A+  +S     E    D+    ++ S KR   D +  L  DIL 
Sbjct: 1042 AFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILR 1101

Query: 1044 RAKYQKLKNGEGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAV 1103
            R K  K  N E                        A+KPWL+G +++ AN+ G+V+DR +
Sbjct: 1102 RTKNAKTSNSE--ENQNSSSVKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHI 1159

Query: 1104 YNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMG 1163
            +NLF NT +Y+F RH +TLY RLLE+K++D  VT EI NRK+VQFA DLNL+STQL DMG
Sbjct: 1160 FNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMG 1219

Query: 1164 LDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHT 1223
            L F    AY E L+LSKRLI  +L+HQWFEESLRQAY NKAFK+YT+DKVV SLVKHAH+
Sbjct: 1220 LAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHS 1279

Query: 1224 LMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQ 1283
            ++TD K++ +M LFE+DRL+  T  KDQILYRL  R+ M  +ENMFR++YN D+ HVSIQ
Sbjct: 1280 IITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQ 1339

Query: 1284 YIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEA 1343
            Y+ +DD+TL++ ++  E+W+YY+TSY+L HPTEGI Q+ +  PFL +I+E E + LD E 
Sbjct: 1340 YVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEE 1399

Query: 1344 GSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKR 1403
             +D+++P G S SKLK+NI P+TY+L  + GS D+F+R S+N++P    ++   +M    
Sbjct: 1400 QNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQSTQPASKM---- 1455

Query: 1404 KETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEETK 1443
                 KFL+   GWKK+LS ++I   E   K+ +L E+ K
Sbjct: 1456 ----DKFLNSSKGWKKNLSTEIIGRAE--SKMKILKEQGK 1489

 Score =  176 bits (445), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 92/115 (80%), Gaps = 1/115 (0%)

Query: 216 SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275
           S YRPLNVKDALSYLEQVK QF+SRP +YN FLDIMKDFKSQ IDTPGVI+RV+TLF+GF
Sbjct: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258

Query: 276 PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQ-QPAIGQ 329
           P LIQGFNTFLP GY+IECS+NPN+PIKVTTP G    V     T  Q  P  GQ
Sbjct: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQ 313

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 203 MVASVSAMGGGIDSPYRPLNVK--DALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNID 260
           +VA+   M G +    +   V+   A+SY+ ++K +F  +P IY QFL+I++ ++ +   
Sbjct: 405 IVAAGGGMLGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKP 464

Query: 261 TPGVIERVSTLFKGFPALIQGFNTFLP 287
              V  +V+ LF+  P L+  F  FLP
Sbjct: 465 IHEVYAQVTILFQNNPDLLDDFKKFLP 491

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFH 431
           A+SY+ ++K +FS +PD+Y +FL+I++ ++ +      V  +VT LF 
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1070 (56%), Positives = 733/1070 (68%), Gaps = 94/1070 (8%)

Query: 374  KKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNA 433
            KK  DVEFS AISYVNKIK RF++QPDIYK+FLEILQTYQREQKPINEVYAQVTVLF NA
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 434  XXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSN 493
                         +SA       QS  +P   +G            G +YP     PQ N
Sbjct: 394  PDLLDDFKKFLPDASAP------QSTTTPAPVNG------------GTFYPQAA--PQQN 433

Query: 494  LPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAP-------HEQQHAPSM-INND 545
            LPP+GSFSPP++G A          + +HV  G+PA+ P         QQH  +  ++ND
Sbjct: 434  LPPLGSFSPPSSGSA---------REGEHV--GLPAVQPPSMDISGQPQQHIITQGMSND 482

Query: 546  GIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGD 605
             I IS +R                                             +   SG+
Sbjct: 483  DIPISEVRNTA------------------------------------DGAYRSDLRNSGE 506

Query: 606  MQ-----VRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLK 660
            +Q      RPEIDLD               N +SL EETSFF+K KK IGN+QIY EFLK
Sbjct: 507  VQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLK 566

Query: 661  VLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDL 720
            +LNL+SQDL+  DELV KVE YL G  ELF+WFKNFVGY+ KPK IEN++HEKHRLDLDL
Sbjct: 567  ILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDL 626

Query: 721  CEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 780
            CEA GPSYKKLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL
Sbjct: 627  CEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 686

Query: 781  FKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKII 840
            FKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEK  FKL PGLGHTS+TIYKK+I
Sbjct: 687  FKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVI 746

Query: 841  RKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 900
            RKVYDK+RGFEIID LHE P+I VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KS
Sbjct: 747  RKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKS 806

Query: 901  LDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFD 960
            LDHLGLTFKQADKKLLTTKQL+SEIS+IKVDQ NKR+H LTPKPK QLDY F D ++++D
Sbjct: 807  LDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYD 866

Query: 961  IVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAAL-----DTKSDEGKS 1015
            I+ L  VF+D  +TYSNPDKE++ D  + F+ LFF  P   +  A      D    +G+ 
Sbjct: 867  ILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEE 926

Query: 1016 TDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLKN----GEGLGMXXXXXXXXXXXXX 1071
               + E +D S+KR R +  L L D+L R KYQK +N                       
Sbjct: 927  NSGQ-ENSDLSRKRTREEENL-LKDVLRRNKYQKGRNFAEEEPIPEESEFAEKTVEEKEE 984

Query: 1072 XXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQ 1131
                   A KPWL+G IV+ AN HG V +R  +N+F NTN+Y+F RH +TLY RL E+K 
Sbjct: 985  EEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKD 1044

Query: 1132 MDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQW 1191
            ++E VT+EI NRKVVQFA+DLNL+STQL DMGLDF+G +AY + L LSKRLI  ++EHQW
Sbjct: 1045 INEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQW 1104

Query: 1192 FEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQ 1251
            FEESLRQAY NKAFK+YT+DKVV SLVKHAHT++TD K+ E+M LFEKDR   +T  K+Q
Sbjct: 1105 FEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQ 1164

Query: 1252 ILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYAL 1311
            ILYRL  RSHM++ ENMFR++YN+ + H SIQ++ +DD+TLE+ K   +RW YY+TSY+L
Sbjct: 1165 ILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSL 1224

Query: 1312 PHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLII 1371
             HPTEGI  ++L  PFLE+ILE + +    E G   Y+P G S S LK+ I+P+TY L +
Sbjct: 1225 SHPTEGISHEELQPPFLEKILE-KEEEFQCENG--EYSPEGVSSSNLKVKINPETYSLDV 1281

Query: 1372 QDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDL 1421
            Q GSYD FSR SIN++PI  ++  Y     ++ +    +L+G  GWK+ L
Sbjct: 1282 QPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGL 1331

 Score =  171 bits (434), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%), Gaps = 2/102 (1%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D  YRPLNVKDALSYLEQVK QFN+RP +YN FLDIMKDFKSQ IDTPGVIERVS LF+G
Sbjct: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNE--PIKVTTPMGVLENV 314
           +P LIQGFNTFLPQGY+IECSSNPN+  PIKVTTP G   +V
Sbjct: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSV 256

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/958 (59%), Positives = 697/958 (72%), Gaps = 44/958 (4%)

Query: 490  PQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSMIN----ND 545
            PQ NLPPIGSFSPP NG     G      D+QH+        P   Q  P+M++    N+
Sbjct: 561  PQQNLPPIGSFSPPTNGSTTHEG----FQDQQHMQPPHLMPLPSMVQQGPNMVHQGIVNE 616

Query: 546  GIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSMMMDEQYGSGD 605
             I +S++R   T    +QY   +P ++                     S ++D QYG  D
Sbjct: 617  NIPLSDLRTSLT----DQY---APSNFQQQQQQQPSI-----------SPIIDSQYG--D 656

Query: 606  MQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLF 665
            + VRPEIDLD               +N+SL+EE +FFEK K+ IGN+ +Y EFLK+LNL+
Sbjct: 657  VPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLY 716

Query: 666  SQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYG 725
            SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ+K K IENV+HEKHRLDLDLCEA+G
Sbjct: 717  SQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFG 776

Query: 726  PSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE 785
            PSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE
Sbjct: 777  PSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEE 836

Query: 786  ERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYD 845
            ERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLPPGLGHTS+TIYKK+IRKVYD
Sbjct: 837  ERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYD 896

Query: 846  KERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLG 905
            KERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLG
Sbjct: 897  KERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLG 956

Query: 906  LTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLT 965
            LTFKQADKKLLTTKQLISEISSIKVDQ NK++HWLTPKPK QLD+ F D DI +DI+ L 
Sbjct: 957  LTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLA 1016

Query: 966  DVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDT-KSDEGKSTDTKFEKAD 1024
            D F+ H + YSNPDKERLKDL   FISLFF IP + I  AL + K +   S+ +    + 
Sbjct: 1017 DSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSS 1076

Query: 1025 DSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGMXXXXXXXXXXXXXXXXXXXNA 1079
              +KRP    E+SL DILHR+KYQKLK     +G+   +                    A
Sbjct: 1077 TPRKRPYQQ-EMSLLDILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEA 1135

Query: 1080 SKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKE 1139
              PWL G++VE ANS G++ +R ++NLF N+N+YIF RHW+T+Y RLLE+KQM+E+VTKE
Sbjct: 1136 KNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKE 1195

Query: 1140 INNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQA 1199
            I+ R +V FA+DL+LLS+QL +MGLDF+G++AY++ LKLS+RLI  ELEHQWFEE LRQA
Sbjct: 1196 ISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQA 1255

Query: 1200 YNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTR 1259
            YNNKAFKLYT+DKV+  LVKHAHTLMTD K++E+M LF KDR  S+T  KDQI+YRL  R
Sbjct: 1256 YNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQAR 1315

Query: 1260 SHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIM 1319
            S+MS+TENMFR+++++   HVS+QYI LDD+TL++ + D ++W YY+TSYALPHPTEGI 
Sbjct: 1316 SYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGIS 1375

Query: 1320 QDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIF 1379
             +KL +PFLER++E+  D  D     ++++P G S S LKI I P TYKL I+ GSYD+F
Sbjct: 1376 HEKLKIPFLERLIEYGQDT-DGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVF 1434

Query: 1380 SRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIAL 1437
            +R + N+YP   +   + +MV K+     KFLD     + DL++        TKK+++
Sbjct: 1435 TRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNE--------TKKLSM 1484

 Score =  266 bits (680), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/266 (57%), Positives = 169/266 (63%), Gaps = 26/266 (9%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D  YRPLNVKDALSYLEQVK QFNSRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 64  DPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 123

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENVRGSDITADQQPAIGQLP 331
           +P LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG   V  NV     +A +      LP
Sbjct: 124 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLP 183

Query: 332 TTQS---PIQASLPPPQSAHLH--------------------LPXXXXXXXXXXXXXNVH 368
                  P   ++P   S   H                    LP              + 
Sbjct: 184 EADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQPLT 243

Query: 369 AENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTV 428
           A+ + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYAQVT 
Sbjct: 244 AQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 303

Query: 429 LFHNAXXXXXXXXXXXXXSSASNEQQ 454
           LF NA             SSAS  +Q
Sbjct: 304 LFQNAPDLLEDFKKFLPDSSASANEQ 329

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 632 NLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELF 690
           ++  S+  S+  K+K    ++  IY  FL++L  + ++   ++E+  +V +     P+L 
Sbjct: 253 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 312

Query: 691 EWFKNFV 697
           E FK F+
Sbjct: 313 EDFKKFL 319

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/956 (58%), Positives = 686/956 (71%), Gaps = 41/956 (4%)

Query: 477  NNTGVYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHV----VAGVPAMAP 532
            NN G+        PQ NLPPIGSFSPP NG          + D+QH+    +  +P+M  
Sbjct: 563  NNRGI--------PQQNLPPIGSFSPPTNGSTVHEN----YQDQQHMQPPHLMPLPSMVQ 610

Query: 533  HEQQHAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXX 592
            H        I N+ + +S++R   T     QY                            
Sbjct: 611  HGANIVHQGIANENLPLSDLRTSLT----EQYA-------------PSNIQQQQQQHPQS 653

Query: 593  XSMMMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNR 652
             S + + QYG  D+ VRPEIDLD               +N+SL+EE +FFEK K+ IGN+
Sbjct: 654  ISPIANSQYG--DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNK 711

Query: 653  QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHE 712
             +Y EFLK+LNL+SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ++ K IEN++HE
Sbjct: 712  HLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHE 771

Query: 713  KHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR 772
            KHRLDLDLCEA+GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR
Sbjct: 772  KHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHR 831

Query: 773  KNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTS 832
            KNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLPPGLGHTS
Sbjct: 832  KNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTS 891

Query: 833  LTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWREL 892
            +TIYKK+IRKVYDKERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWREL
Sbjct: 892  MTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWREL 951

Query: 893  EQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQF 952
            EQKV+FKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ NK++HWLTPKPK QLD+ F
Sbjct: 952  EQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDF 1011

Query: 953  NDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDE 1012
             D +I  DI+ L D F+ H + YSNPDKERLKDL + FISLFF I  + I  +L      
Sbjct: 1012 PDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQS 1071

Query: 1013 GKSTDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGMXXXXXXXXX 1067
               +    +      ++     E++L DILHR++YQKLK     +G+   +         
Sbjct: 1072 VSESSGSDDGGSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESN 1131

Query: 1068 XXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLL 1127
                       A  PWL G++VE ANS G++ +R ++NLF NTN+YIF RHW+T+Y RLL
Sbjct: 1132 IIEEEELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLL 1191

Query: 1128 ELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNEL 1187
            E+KQM+E+VTKEIN R  V FA+DL+LLS QL +MGLDF G++AY++ LKLS+RLI  +L
Sbjct: 1192 EIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDL 1251

Query: 1188 EHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTC 1247
            EHQWFEESLRQAYNN+AFKLYT+DKV  SLVKHAHTLMTD K++E+M LF KDR  ++T 
Sbjct: 1252 EHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTS 1311

Query: 1248 VKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMT 1307
             K QI+YRL  RSHMS+TENMFR++++K T HVSIQYI LDD+TL++ K+D ++W YY+T
Sbjct: 1312 AKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVT 1371

Query: 1308 SYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTY 1367
            SYALPHPTEG++ +KL +PFLER++EF  D +D +   ++++P G S S LKI I P TY
Sbjct: 1372 SYALPHPTEGVLHEKLKIPFLERLIEFGQD-IDGKDVDEKFSPEGISVSTLKIKIQPTTY 1430

Query: 1368 KLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSD 1423
            KL I++GSYD+F+R S N+YP   +   + ++V ++KE   +FLD     + DL++
Sbjct: 1431 KLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNE 1486

 Score =  259 bits (662), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 165/262 (62%), Gaps = 63/262 (24%)

Query: 218 YRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPA 277
           YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G+P 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 278 LIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---------------------------- 309
           LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG                            
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 310 ------------VLENVRGSDITADQQPAI------GQLPTTQSPIQASLPPPQSAHLHL 351
                       V  NV  S+   DQQ  +        LP+ Q   Q+ +P     H  +
Sbjct: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQ---QSEIP----VHHQI 401

Query: 352 PXXXXXXXXXXXXXNVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQT 411
           P              +  + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQT
Sbjct: 402 PQIQP----------LAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQT 451

Query: 412 YQREQKPINEVYAQVTVLFHNA 433
           YQREQKPINEVYAQVT LF NA
Sbjct: 452 YQREQKPINEVYAQVTHLFQNA 473

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 286 LP 287
           LP
Sbjct: 484 LP 485

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 632 NLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELF 690
           ++  S+  S+  K+K    ++  IY  FL++L  + ++   ++E+  +V +     P+L 
Sbjct: 418 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 477

Query: 691 EWFKNFV 697
           E FK F+
Sbjct: 478 EDFKKFL 484

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1027 (55%), Positives = 719/1027 (70%), Gaps = 49/1027 (4%)

Query: 482  YYPPQVNQ--PQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAP 539
            YY    N+  PQ NLPPIGSFSPP NG    +     + D+QH+        P   QH P
Sbjct: 545  YYNHSTNRGVPQQNLPPIGSFSPPTNG----STVHDNYQDQQHMQPPHLVPLPSMVQHGP 600

Query: 540  SMIN----NDGIQISNMRGGGTVPALNQYGMISPHDYTXXXXXXXXXXXXXXXXXXXXSM 595
            +M++    N+ + IS++R   T    +QY   +P  +                     S 
Sbjct: 601  NMVHQGIANENLPISDLRTSLT----DQY---APSTF-----------QQQQQNPPSISP 642

Query: 596  MMDEQYGSGDMQVRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIY 655
            + D QYG  D+ VRPEIDLD               +N+SL+EE +FFEK K+ IGN+ +Y
Sbjct: 643  ITDLQYG--DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLY 700

Query: 656  IEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHR 715
             EFLK+LNL+SQD++ +D+LV KV+ YL    ELF WFKNFVGYQ+K K IEN++HEKHR
Sbjct: 701  TEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHR 760

Query: 716  LDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 775
            LDLDLCEA+GPSYK+LPKSDTFMPCSGRDDMCWE+LNDEWVGHPVWASEDSGFIAHRKNQ
Sbjct: 761  LDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQ 820

Query: 776  YEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTI 835
            YEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK+ FKLPPGLGHTS+TI
Sbjct: 821  YEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTI 880

Query: 836  YKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQK 895
            YKK+IRKVYDKERGFEIID LHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQK
Sbjct: 881  YKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQK 940

Query: 896  VYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDM 955
            V+FKSLDHLGLTFKQADKKLLTTKQLISEI+SIKVDQ NK++HWLTPKPK QLD+ F D 
Sbjct: 941  VFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDK 1000

Query: 956  DIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALD-TKSDEGK 1014
            DI +DI+ L D F+ H + YSNPDKERLKDL + FISLFF IP + I  AL   K +  +
Sbjct: 1001 DIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSE 1060

Query: 1015 STDTKFEKADDSKKRPRPDVELSLSDILHRAKYQKLK-----NGEGLGMXXXXXXXXXXX 1069
            S+ +    +  S+KRP    E+SL DILHR +YQKLK      G+   +           
Sbjct: 1061 SSGSDDGGSSTSRKRPY-QQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTI 1119

Query: 1070 XXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLEL 1129
                     A  PWL G++VE ANS G++ +R+++NLF NTN+YIF RHW+T+Y RLLE+
Sbjct: 1120 EEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEI 1179

Query: 1130 KQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEH 1189
            KQM+ ++TKE+N R  V FA+DL+LLS QL +MGLDF G++AY++ L+LS+RLI  +LEH
Sbjct: 1180 KQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEH 1239

Query: 1190 QWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVK 1249
            QWFEESLRQAYNNKAFKLYT+DKV  SLVKHAHTLM D K++E+M LF KDR   +T  K
Sbjct: 1240 QWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAK 1299

Query: 1250 DQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSY 1309
            DQI+YRL  RS+MS+ ENMFR++ NK + HVS+QYI LDD+TL++ K D ++W YY+TSY
Sbjct: 1300 DQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSY 1359

Query: 1310 ALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKL 1369
             LPHPTEGI  +KL +PFLER++EF  D  D     + ++P G S S L+I I P TYKL
Sbjct: 1360 GLPHPTEGISHEKLKIPFLERLIEFGQDT-DGREVDEEFSPEGISLSTLRIKIQPITYKL 1418

Query: 1370 IIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTV 1429
             I++GSYD+F+R ++N+YP   +   + +MV ++     +FL+     + DL++   + +
Sbjct: 1419 HIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGM 1478

Query: 1430 EPTKKIALL---------SEETKDVGTLSTPVTTEKGAENTVHGLQPVALAENSNASTMG 1480
            +  +K+ALL           E K++ T       ++  +N       V  +  SNA   G
Sbjct: 1479 Q--EKLALLKGVTAKVNDENEVKELKTEEDLAAKQEQPKNLPTSDANVITSSISNAPQYG 1536

Query: 1481 TSTVGDA 1487
             +  G++
Sbjct: 1537 NAEAGES 1543

 Score =  261 bits (666), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 168/249 (67%), Gaps = 31/249 (12%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D  YRPLNVKDALSYLEQVK QF+SRP IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 221 DPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 280

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG---VLENV--RGSDITADQQPA--- 326
           +P LIQGFNTFLPQGYRIECS+NP++PI+VTTPMG   V  NV   G      Q+P+   
Sbjct: 281 YPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLS 340

Query: 327 ---------IGQLPTTQSPI---------QASLPPPQS----AHLHLPXXXXXXXXXXXX 364
                       LP   S +         + SLP   +    + +H P            
Sbjct: 341 EPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIH-PPEIPPHHQILQG 399

Query: 365 XNVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYA 424
            ++  + + KK  DVEFSQAISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYA
Sbjct: 400 QSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYA 459

Query: 425 QVTVLFHNA 433
           QVT LF NA
Sbjct: 460 QVTHLFQNA 468

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 286 LP 287
           LP
Sbjct: 479 LP 480

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 632 NLSLSEETSFFEKVKKNIGNR-QIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELF 690
           ++  S+  S+  K+K    ++  IY  FL++L  + ++   ++E+  +V +     P+L 
Sbjct: 413 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 472

Query: 691 EWFKNFV 697
           E FK F+
Sbjct: 473 EDFKKFL 479

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/841 (61%), Positives = 630/841 (74%), Gaps = 22/841 (2%)

Query: 608  VRPEIDLDXXXXXXXXXXXXXXXNNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQ 667
            VRPEIDLD               + L L EET+FF+KVKK IGN+ IY EFLKVLNL+S 
Sbjct: 830  VRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNLYSV 889

Query: 668  DLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPS 727
            DL+ VDELV K++ YL    ELF WFKNFVGY +KPK IEN++HEKH+LDLDLCEA GPS
Sbjct: 890  DLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEACGPS 949

Query: 728  YKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 787
            YKKLPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++++ 
Sbjct: 950  YKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKKV 1009

Query: 788  HEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKE 847
            HEYDFYIESNLRTIQTLETIASKIANMTE EK  FKLP GLGHT+ TIYKK+IRKVYDKE
Sbjct: 1010 HEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVYDKE 1069

Query: 848  RGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 907
            RGFEIID LHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLT
Sbjct: 1070 RGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLT 1129

Query: 908  FKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDV 967
            FKQADKKLLTTKQLISEISSIKVDQ +KRMHWLTPKPK QLD+   D DIIFDI+   ++
Sbjct: 1130 FKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVEI 1189

Query: 968  FVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKA---- 1023
            FV+H STYSNP+KERL D  + F SLFF IP + I  A+ +K D  +  D K E      
Sbjct: 1190 FVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAI-SKRDITEKNDEKLEDKQKNG 1248

Query: 1024 -DDSKKRPRPDVELSLSDILHRAKYQKLKNG------EGLGMXXXXXXXXXXXXXXXXXX 1076
             ++SKKR   D+ LSL DIL R KYQ+LK G      +G G                   
Sbjct: 1249 EENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHG---NRHDDQKLLEEEELLR 1305

Query: 1077 XNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERV 1136
              A KPWL+G +VE AN+ G +  R ++N+F NTN+YIFIRH +T+Y RL E+KQM+++V
Sbjct: 1306 QEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKV 1365

Query: 1137 TKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESL 1196
            ++EI+ RK+ +FA+DLNL+STQL +MGLDF   + YQ+ L L KRLI  +LEHQWFEESL
Sbjct: 1366 SREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESL 1425

Query: 1197 RQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRL 1256
            RQA+NNKAFKLYT+DKV  +LVKHAHT+++D K++E+M LFEKDR ++ST  KDQILYRL
Sbjct: 1426 RQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRL 1485

Query: 1257 LTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTE 1316
             TR+ M+  ENMFR++YN  T+H+ IQYI LDD+T++DAK   E+W YY+TSYAL HPTE
Sbjct: 1486 QTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTE 1545

Query: 1317 GIMQDKLVVPFLERILEFENDMLDVEAGSD-------RYNPVGTSYSKLKINIDPKTYKL 1369
            GI Q+ + +PFLERI+E E    D E           +Y+P G S S LKI IDP+ Y L
Sbjct: 1546 GIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYCL 1605

Query: 1370 IIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTV 1429
             I++GS+DIFSR S+N++P++         + K K T +KFL+ + GWK+ +S D + ++
Sbjct: 1606 NIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQMESI 1665

Query: 1430 E 1430
            E
Sbjct: 1666 E 1666

 Score =  173 bits (439), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 98/135 (72%), Gaps = 12/135 (8%)

Query: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274
           D+ YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVI RVS+LF  
Sbjct: 296 DNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

Query: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG--VLENVRGSDITADQQPAIGQLPT 332
           +P+LIQGFNTFLPQGYRIECSSNPN PI V TPMG   +  V  + +T +Q         
Sbjct: 356 YPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGVLETSVTENQ--------- 406

Query: 333 TQSPIQASLPPPQSA 347
               +Q SLP P + 
Sbjct: 407 -NHQLQHSLPQPSTT 420

 Score =  120 bits (302), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 82/138 (59%), Gaps = 7/138 (5%)

Query: 372 EPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFH 431
           E ++  DVEFSQAISYVNKIKNRF++QP IYK+FLEILQTYQREQKPINEVY+QVTVLF 
Sbjct: 536 EQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

Query: 432 NAXXXXXXXXXXXXXSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQ 491
            A             SSA+N      S     +Y+         +N    +  P      
Sbjct: 596 EAPDLLEDFKKFLPDSSANNNGSIVTSQEENFMYANG-------FNQQQPHLTPHSEIQA 648

Query: 492 SNLPPIGSFSPPANGVAP 509
            NLPP+GSFS   NGV P
Sbjct: 649 QNLPPLGSFSTQPNGVFP 666

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 75/144 (52%), Gaps = 16/144 (11%)

Query: 203 MVASVSAMGGGIDSPYRPLNVK--DALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNID 260
           MV+SVS     +    R  +V+   A+SY+ ++K +F ++PYIY  FL+I++ ++ +   
Sbjct: 523 MVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKP 582

Query: 261 TPGVIERVSTLFKGFPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDIT 320
              V  +V+ LF+  P L++ F  FLP     + S+N N  I  +      EN   ++  
Sbjct: 583 INEVYSQVTVLFQEAPDLLEDFKKFLP-----DSSANNNGSIVTSQE----ENFMYANGF 633

Query: 321 ADQQPAIGQLPTTQSPIQA-SLPP 343
             QQP +    T  S IQA +LPP
Sbjct: 634 NQQQPHL----TPHSEIQAQNLPP 653

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 368 HAENEPKKAND---VEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYA 424
           + ++ PK+ N    +    A+SY+ ++K +F+ +PD+Y +FL+I++ ++ +      V A
Sbjct: 288 NTQDSPKEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIA 347

Query: 425 QVTVLFHN 432
           +V+ LFH+
Sbjct: 348 RVSSLFHD 355

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 632 NLSLSEETSFFEKVKKNIGNRQ-IYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELF 690
           ++  S+  S+  K+K    N+  IY  FL++L  + ++   ++E+ ++V       P+L 
Sbjct: 542 DVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLL 601

Query: 691 EWFKNFV 697
           E FK F+
Sbjct: 602 EDFKKFL 608

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  317 bits (813), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 241/772 (31%), Positives = 367/772 (47%), Gaps = 90/772 (11%)

Query: 649  IGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVG-YQDKPKIIE 707
            + +  IY EFLK++NLF+Q LI ++    +   +      L   F N +  Y+D  + ++
Sbjct: 214  VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMK 273

Query: 708  NVIHEKHRLDL-DLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDS 766
              +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGHPVWASE+ 
Sbjct: 274  PTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEV 333

Query: 767  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK------- 819
            GFIAH+KNQYEETLFK+EEERHEYDF++ S          +   I   TE EK       
Sbjct: 334  GFIAHKKNQYEETLFKVEEERHEYDFFLLS----------VEHLIVKFTEYEKSLQLSKD 383

Query: 820  -----NMFKLP--PGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLK 872
                 N    P  P +   S+T  +K+IR++Y  E G  +ID +  +P   VP +LK  K
Sbjct: 384  DGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAK 441

Query: 873  QKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ 932
            +K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K+ L  KQL+ E  S K D+
Sbjct: 442  EKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDK 501

Query: 933  NNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFIS 992
              K  +        +  Y+F D  +++D+  +    +   S+ S   K     +F  F  
Sbjct: 502  LLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFD 556

Query: 993  LFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRPDVE-LSLSDILHRAKYQKLK 1051
            L F       +  LD +     +  +  + ++D       DVE + +  IL         
Sbjct: 557  LLF--EESSFTKHLDFQFCHNPAISSNSQISED-------DVEAMFMKGILEE------- 600

Query: 1052 NGEGLGMXXXXXXXXXXXXXXXXXXXNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTN 1111
              +GLG                         W   D   +       ++R   N+F + N
Sbjct: 601  --KGLG------------------------RWFSNDTELKKE----FSNRQNINIFCDIN 630

Query: 1112 VYIFIRHWSTLYGRLLELKQMDERVTKEINN--RKVVQFAEDLNLLSTQLRDMGLDFDGK 1169
            +     +  TLY R  ++K  +  + K++    R+    A+ L LL  QL D GL+    
Sbjct: 631  IMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSDNGLELGQD 690

Query: 1170 NAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNK 1229
            + Y+     SK+ +   L+HQWFEESLR  + NKA+KLYT+D+V+ +++    T+     
Sbjct: 691  DGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPS 750

Query: 1230 SSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDD 1289
              ++++L   +  + +T    Q+ YR   R  M    +MFR++  +D+  +  QYIG+DD
Sbjct: 751  LLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDD 810

Query: 1290 VTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLE-RILEFENDMLDVEAGSDRY 1348
            +       +    + Y   Y     T+ +  D L  P+    +L+ E   +    G + Y
Sbjct: 811  LLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREEQNIPFMNG-NIY 869

Query: 1349 NPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMV 1400
             P       L +NI+P  Y + I  GS DI S + I +      S    QM 
Sbjct: 870  KP------HLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKTQMA 915

>Kpol_543.34 s543 (75894..77843) [1950 bp, 649 aa] {ON}
           (75894..77843) [1950 nt, 650 aa]
          Length = 649

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 10/87 (11%)

Query: 462 PQVYSGADMARGYMYNNTGVYYPPQ---VNQPQSNLPPIGSFSPP------ANGVAPTTG 512
           P++ + ++++     N   + YP +    N   S   P G++ PP      ANG     G
Sbjct: 470 PKITNKSNLSIHSCVNEYELKYPNKKEGANGNSSATKPAGAYKPPHARRAEANGTRKVPG 529

Query: 513 TAIPHADEQ-HVVAGVPAMAPHEQQHA 538
             I +A ++ + V G+P MAP E + A
Sbjct: 530 MTIVNAKQKTNTVPGIPGMAPKESKTA 556

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 650 GNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQ---DKPKII 706
           G + +Y ++LKVLN   QD  AV + V   ++      ++ E+  N + YQ   ++ K I
Sbjct: 82  GLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKKYI 141

Query: 707 ENVIHEK 713
           +N IH K
Sbjct: 142 DNFIHSK 148

>Ecym_6134 Chr6 complement(245146..247062) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AEL286C
          Length = 638

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 484 PPQVNQPQSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAG---------VPAMAPHE 534
           P + N   S   P+G++ PP    A  TG+++P A  +  V G         VP MAP E
Sbjct: 474 PKKNNGTSSVSKPVGAYKPPHARRAAATGSSVPGAAVKPAVPGMTPKASKGLVPGMAPKE 533

Query: 535 QQ 536
            +
Sbjct: 534 SK 535

>TPHA0G02610 Chr7 complement(545411..546379) [969 bp, 322 aa] {ON}
           Anc_2.389 YMR140W
          Length = 322

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 835 IYKKIIRKVYDKER--GFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWREL 892
            YK I     +K R  G  +I+ +   P   +PI  K+LK  +  +   Q + +K W  +
Sbjct: 117 FYKPISSTEMEKYRNNGIGLINHIKNLPPNNIPIESKKLKADNNCYSPIQEQIDK-WESI 175

Query: 893 EQKVYFKSLD 902
           E  +YFK+L+
Sbjct: 176 ENDLYFKALN 185

>KLLA0F14234g Chr6 (1317691..1320885) [3195 bp, 1064 aa] {ON}
           similar to uniprot|P12954 Saccharomyces cerevisiae
           YJL092W HPR5 DNA helicase and DNA-dependent ATPase
           involved in DNA repair required for proper timing of
           commitment to meiotic recombination and the transition
           from Meiosis I to Meiosis II potential Cdc28p substrate
          Length = 1064

 Score = 33.1 bits (74), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 666 SQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIEN---VIHEKHRLDLDLCE 722
           +QD I+ D+L+    NY     +L  W  N   + D P + EN   ++ +K+ ++ +LC 
Sbjct: 776 NQDRISYDQLIKDYYNYGFNSRQLLFWKDNKYSHVDLPNMTENTIGIVTKKNEIESELCS 835

Query: 723 A 723
           A
Sbjct: 836 A 836

>KLLA0C15125g Chr3 (1316235..1318316) [2082 bp, 693 aa] {ON} highly
            similar to uniprot|P49367 Saccharomyces cerevisiae
            YDR234W LYS4 Homoaconitase catalyzes the conversion of
            homocitrate to homoisocitrate which is a step in the
            lysine biosynthesis pathway
          Length = 693

 Score = 33.1 bits (74), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%)

Query: 1352 GTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFL 1411
            G+S  +    I  K  KL++     +IF R+SIN   +  +    + M+  R + A K L
Sbjct: 576  GSSREQAATAILAKGIKLVVSGSFGNIFFRNSINNALLTLEIPALINMLRDRYKDAPKEL 635

Query: 1412 DGRFGW 1417
              R GW
Sbjct: 636  TRRTGW 641

>TPHA0C01970 Chr3 complement(445831..447459) [1629 bp, 542 aa] {ON}
            Anc_8.450 YDR229W
          Length = 542

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 13/130 (10%)

Query: 1120 STLYGRLLELKQMDERVTKEINNRKVVQ----FAEDLNLLSTQLRDMGLDFDGKNAYQE- 1174
            S L+  L   +Q+  R+  ++ N  ++Q    F E+   L+ + ++  ++       QE 
Sbjct: 174  SGLFHLLANHEQIMSRIINDLLNENILQELTNFKEENKKLTKEFKNNFMELSSSLKLQEK 233

Query: 1175 -TLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSEL 1233
               +LSK+ IRN L       + RQ+ NN  F+L  V+ + H   +  + L+ D  ++ L
Sbjct: 234  RNAELSKKKIRNIL-------TYRQSLNNLQFQLDQVETLKHHYFQDCYKLVEDTCNNVL 286

Query: 1234 MELFEKDRLQ 1243
              +    R Q
Sbjct: 287  KNVASTTRAQ 296

>KLTH0E10582g Chr5 (953799..955862) [2064 bp, 687 aa] {ON} highly
            similar to uniprot|P49367 Saccharomyces cerevisiae
            YDR234W LYS4 Homoaconitase catalyzes the conversion of
            homocitrate to homoisocitrate which is a step in the
            lysine biosynthesis pathway
          Length = 687

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 3/114 (2%)

Query: 1352 GTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFL 1411
            G+S  +    +  K   L++     +IFSR+SIN   +  +    ++M+  +   A K L
Sbjct: 570  GSSREQAATALLAKGIDLVVSGSFGNIFSRNSINNALLTLEIPALIEMLRAKYRDAPKEL 629

Query: 1412 DGRFGW--KKDLSDD-VINTVEPTKKIALLSEETKDVGTLSTPVTTEKGAENTV 1462
              R GW  K DL +  VI T        +L ++  ++G     +  + G E  V
Sbjct: 630  TRRTGWFLKWDLPNSTVIATEGSLDGPVVLEQKVGELGKNLQEIIVKGGLEGWV 683

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 155,231,385
Number of extensions: 7084220
Number of successful extensions: 18328
Number of sequences better than 10.0: 79
Number of HSP's gapped: 18802
Number of HSP's successfully gapped: 162
Length of query: 1492
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1369
Effective length of database: 39,377,481
Effective search space: 53907771489
Effective search space used: 53907771489
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)