Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F029106.30ON1221226384e-87
KAFR0A051106.30ON1221205846e-79
Smik_15.1656.30ON1201205837e-79
ZYRO0C07502g6.30ON1221205812e-78
YOL005C (RPB11)6.30ON1201205793e-78
Suva_15.1696.30ON1221205761e-77
Skud_15.1576.30ON1221205761e-77
TDEL0G043906.30ON1221205751e-77
CAGL0E02453g6.30ON1201205752e-77
NCAS0D021206.30ON1221185691e-76
NDAI0C026706.30ON1221205682e-76
Kpol_1037.216.30ON1201205682e-76
TBLA0E031506.30ON1181185412e-72
KLTH0C10934g6.30ON1221215301e-70
Kwal_56.224726.30ON1221215291e-70
ACL005C6.30ON1221205291e-70
TPHA0J004106.30ON1201205264e-70
SAKL0E01562g6.30ON1221205256e-70
KLLA0C06160g6.30ON1211185135e-68
TPHA0B029202.163ON130921262e-09
CAGL0L03872g2.163ON137921183e-08
Kpol_165.22.163ON128921159e-08
TBLA0B012902.163ON102851122e-07
KAFR0B045702.163ON131901113e-07
Ecym_54232.163ON127901071e-06
YNL113W (RPC19)2.163ON1421021072e-06
TDEL0F011802.163ON1291041062e-06
KNAG0I020602.163ON134901062e-06
Suva_14.2252.163ON1421041062e-06
Smik_14.2142.163ON1421021053e-06
SAKL0E10692g2.163ON1311041019e-06
AFL220C2.163ON135681019e-06
Skud_14.2182.163ON1561041011e-05
ZYRO0B09878g2.163ON13090992e-05
NDAI0F027502.163ON14969983e-05
KLTH0D09350g2.163ON14671984e-05
KLLA0F23760g2.163ON12788974e-05
NCAS0G025502.163ON15090975e-05
Kwal_26.84732.163ON15043951e-04
TPHA0B015207.441ON115070661.5
TBLA0J007305.604ON72689642.7
Kwal_23.58927.257ON67859633.3
SAKL0F13618g7.441ON117570625.2
TBLA0I009107.441ON113970616.1
TDEL0C030507.441ON114570608.4
Skud_2.47.441ON115175609.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F02910
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   250   4e-87
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   229   6e-79
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   229   7e-79
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   228   2e-78
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   227   3e-78
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   226   1e-77
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   226   1e-77
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   226   1e-77
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   226   2e-77
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   223   1e-76
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   223   2e-76
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   223   2e-76
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   213   2e-72
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   208   1e-70
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   208   1e-70
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   208   1e-70
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   207   4e-70
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   206   6e-70
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   202   5e-68
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    53   2e-09
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    50   3e-08
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    49   9e-08
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    48   2e-07
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    47   3e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    46   1e-06
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    46   2e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    45   2e-06
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    45   2e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    45   2e-06
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    45   3e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    44   9e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    44   9e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    44   1e-05
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    43   2e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    42   3e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    42   4e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    42   4e-05
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    42   5e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    41   1e-04
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    30   1.5  
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    29   2.7  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    29   3.3  
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    28   5.2  
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    28   6.1  
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    28   8.4  
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    28   9.1  

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  250 bits (638), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

Query: 121 VA 122
           VA
Sbjct: 121 VA 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  229 bits (584), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTKSPNA+VITF KEDHTLGNLIRAELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLR+QT+EGYDPK+ALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  229 bits (583), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 110/120 (91%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLATDD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL +DPDTK+PNAIV+TF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARFK+RIQT+EGYDPKDALKNACNGIINKLG+LKTNFETEWNLQTLA+DD F
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  227 bits (579), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 109/120 (90%), Positives = 112/120 (93%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQT EGYDPKDALKNACN IINKLG LKTNFETEWNLQTLA DD F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  226 bits (575), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIR+ELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACNGIINKL +LKTNFETEWNLQTLA+DD +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIRAELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFARFKLRIQTVEGYDPKDAL+NAC+ IINKLG LK+NFETEWNLQTLA DD F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  223 bits (569), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 105/118 (88%), Positives = 113/118 (95%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIR+ELLNDS+VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118
           YKVEHPFFARFKLRIQTVEGYDPKDALKNACN II+KLG+LK NFETEWNLQTLA D+
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHPFFA FKLRIQTVEGYDPK ALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPD+FELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIR+ELLNDSKVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARFKLRIQTVE YDPKDALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  213 bits (541), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/118 (83%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFE FLLG+GESKL I+PDTK+PN +VITF KEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118
           YKVEHP FARFK+RIQTVEGYDPKDAL+ ACN II KLGILKTNFETEWNLQTLA+DD
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  208 bits (530), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +GE+KL IDPDTK+PNA+++TF KEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FA+FKLRIQTVEGYDPKDALKNACNGII+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 V 121
            
Sbjct: 121 A 121

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/121 (78%), Positives = 109/121 (90%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +GE+KL IDPDTK+PNA+++TF KEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACNGII+KLG L++NFETEWNLQTLA++D +
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 V 121
            
Sbjct: 121 A 121

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +GESKL I+PDTK+ NA++ITF KEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACN IINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  207 bits (526), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 107/120 (89%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +G+SKL I+ DTK+ NA+VITF KEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARFKLRIQT E YDPKDALK ACN IINKLGILKTNF+TEWNLQTLA+DD F
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  206 bits (525), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +GESKL I+PDTK+PNA++ITF KEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN II KL  L++NFETEW+LQTLA+++ +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  202 bits (513), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 94/118 (79%), Positives = 106/118 (89%)

Query: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60
           MNAPDRFELFLL +GESKL ++ DTK+ +AI++TF KEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118
           YKVEHP FA+FK+RIQTVEGYDPKDALKNACN IINKL  L++NFETEWNLQTLAT+D
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 16  ESKLVIDPDTKSPNAIVITF--NKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKL 73
           E K+ I P+  SP+    +F  ++EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
           RIQT       +AL+     +++   +++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 16  ESKLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKL 73
           ++K+ + P   S +    +F   +EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
           RIQT       DAL+   + +I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 48.9 bits (115), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 16  ESKLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKL 73
           E K+ I P   S +    +F    EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
           RIQT       +AL+     +++   +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%)

Query: 21  IDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQTVEG 80
           + P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LR+QT   
Sbjct: 11  LPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYGD 70

Query: 81  YDPKDALKNACNGIINKLGILKTNF 105
               DAL      +++   +++  F
Sbjct: 71  ITASDALAQGLQDLMDLCDVVEDTF 95

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRI 75
           K+ I P   S +    +F   +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTVEGYDPKDALKNACNGIINKLGILKTNF 105
           QT       DALK     +++   +++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLVIDPDTKSPNAIVITF--NKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRI 75
           K+ + P+  S +    +F  + EDHTLGN +R  ++ + +V F  Y + HP      LRI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKDALKNACNGIINKLGILKTNF 105
           QT       +AL      +++   +++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKV 63
           PDR ++ LL    S+     D  S +  ++   +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            HP      +RIQT       DAL+     +++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGDGESKLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAY 61
           PDR ++ LL          P   S +    +F   +EDHTLGN +R  ++ +  V F  Y
Sbjct: 29  PDREKIKLL----------PQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGY 78

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            + HP      LRIQT       D L+     +++    ++  F
Sbjct: 79  SIPHPSENLLNLRIQTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRI 75
           K+ I P+  + +    +F    EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKDALKNACNGIINKLGILKTNF 105
           QT       DA K     +++   +++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAY 61
           + PDR ++ LL    S+     D  S +  ++   +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            + HP      +RIQT       +AL+     +++   ++++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKV 63
           PDR ++ LL    S+     D  S +  ++   +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            HP      +RIQT       DAL+     +++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 43.5 bits (101), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGDGESKLVIDPDTKSPNAIVITF--NKEDHTLGNLIRAELLNDSKVLFAAY 61
           PDR ++ LL          P   S +    +F  ++EDHTLGN +R  ++ + +V F  Y
Sbjct: 31  PDREKIKLL----------PQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGY 80

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            + HP      +RIQT       +AL+     +++    ++  F
Sbjct: 81  SIPHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.5 bits (101), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 38  EDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINK 97
           EDHTLGN +R  ++ + +V F  Y + HP      +RIQT       DAL      +++ 
Sbjct: 61  EDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRIQTYGKVTAVDALHKGLQDLMDM 120

Query: 98  LGILKTNF 105
             +++  F
Sbjct: 121 CDVVEDKF 128

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAY 61
           + PDR ++ LL    S    +  T +   IV    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNF 105
            + HP      +RIQT       DAL+     +++   +++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 18  KLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRI 75
           K+ I P   S +    +F   +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTVEGYDPKDALKNACNGIINKLGILKTNF 105
           QT       D L      +++    ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 37  KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIIN 96
           +EDHTLGN +R  ++ + +V F  Y + HP      +RIQT       +AL      +++
Sbjct: 74  QEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRIQTYGEITAVEALHKGLQDLMD 133

Query: 97  KLGILKTNF 105
              +++  F
Sbjct: 134 LCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNGI 94
            ++EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+     +
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  INKLGILKTNF 105
           ++    ++  F
Sbjct: 129 MDLCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 42.0 bits (97), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%)

Query: 18  KLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQT 77
           KL+ +  ++   +       EDHTLGN +R  ++ + +V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VEGYDPKDALKNACNGIINKLGILKTNF 105
                  +AL      +++    ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLVIDPDTKSPNAIVITFN--KEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRI 75
           K+ I P+  S +    +F    EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 54  KVKILPEGASEDGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGYSIPHPSENFLNVRI 113

Query: 76  QTVEGYDPKDALKNACNGIINKLGILKTNF 105
           QT       +A +     +++   +++  F
Sbjct: 114 QTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 35  FNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQT 77
            ++EDHTLGN +R  ++ +  V F  Y + HP      LRIQT
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQT 115

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 30.0 bits (66), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGDGE-SKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPF 67
           L +LG G   K+++     +     I   K+DH + N   A    + KV   A K +HPF
Sbjct: 826 LKVLGKGNFGKVLLSKSKNTGRVCAIKVLKKDHIIQNHDIASARAEKKVFLLATKTKHPF 885

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 886 LTNLYCSFQT 895

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 40  HTLGNLIRAELLNDSKVLFAAYKVEHPFF-----ARFKLRIQTVEGYDPKDALKNACNGI 94
           H+LGNLI  +LLN++K     +KV + F        FKL  +T       D + N     
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKLIQRT-----NIDGINNKAGKE 553

Query: 95  INKLGILKTNFETE---WNLQTLATDDTF 120
           + K   LK  ++ E   W  QTL   + +
Sbjct: 554 LGKRKKLKQKYQLEIDNWQTQTLPCKELY 582

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 41  TLGNLIRAELLNDSKVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   T + ++  DA     N I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON}
           similar to uniprot|P24583 Saccharomyces cerevisiae
           YBL105C PKC1 Protein Kinase C
          Length = 1175

 Score = 28.5 bits (62), Expect = 5.2,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 9   LFLLGDGESKLVIDPDTKSPNAI-VITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPF 67
           L +LG G    V+   +K+ +++  I   K+DH + N        + KV   A K +HPF
Sbjct: 851 LKVLGKGNFGKVLLAKSKNTDSLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPF 910

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 911 LTNLYCSFQT 920

>TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1139

 Score = 28.1 bits (61), Expect = 6.1,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGDGESKLVIDPDTKSPNAI-VITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPF 67
           L +LG G    V+   +K+   I  I   K+DH + N        + KV   A K +HPF
Sbjct: 815 LKVLGKGNFGKVLLSKSKNTGTICAIKVLKKDHIIQNHDIESARAEKKVFLLASKAKHPF 874

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 875 LTNLYCSFQT 884

>TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7.441
           YBL105C
          Length = 1145

 Score = 27.7 bits (60), Expect = 8.4,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 9   LFLLGDGE-SKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAAYKVEHPF 67
           L +LG G   K+++     +     I   K+DH + N        + KV   A K +HPF
Sbjct: 821 LKVLGKGNFGKVLLSKSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPF 880

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 881 LTNLYCSFQT 890

>Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON}
           YBL105C (REAL)
          Length = 1151

 Score = 27.7 bits (60), Expect = 9.1,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 2/75 (2%)

Query: 5   DRFELF-LLGDGESKLVIDPDTKSPNAI-VITFNKEDHTLGNLIRAELLNDSKVLFAAYK 62
           D F L  +LG G    VI   +K+ N +  I   K+D+ + N        + KV   A K
Sbjct: 822 DNFVLLKVLGKGNFGKVILSKSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATK 881

Query: 63  VEHPFFARFKLRIQT 77
            +HPF        QT
Sbjct: 882 TKHPFLTNLYCSFQT 896

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,023,619
Number of extensions: 549787
Number of successful extensions: 1343
Number of sequences better than 10.0: 62
Number of HSP's gapped: 1342
Number of HSP's successfully gapped: 62
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)