Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F028906.22ON56356329900.0
KAFR0A050706.22ON56455021870.0
NCAS0D021606.22ON56356621420.0
CAGL0E02629g6.22ON54856321200.0
TDEL0G044706.22ON54254021130.0
NDAI0C026306.22ON58055320940.0
Kpol_1037.276.22ON54655220860.0
TBLA0G009706.22ON55954720360.0
TPHA0J003506.22ON55955920280.0
ZYRO0C07744g6.22ON54754620210.0
Suva_15.1776.22ON54453320120.0
SAKL0E01364g6.22ON54153920010.0
Smik_15.1716.22ON54453319960.0
ACR004W6.22ON56355919940.0
Skud_15.1636.22ON54453219910.0
KLLA0D01221g6.22ON56656619810.0
Kwal_56.224376.22ON53652819730.0
KLTH0C11176g6.22ON53652919720.0
Ecym_30276.22ON54954019580.0
YOR002W (ALG6)6.22ON54453319360.0
TBLA0A093105.669ON5464223226e-31
KLTH0F17666g5.669ON5554182987e-28
YOR067C (ALG8)5.669ON5774222961e-27
Kwal_55.217425.669ON5553932933e-27
NCAS0G004505.669ON5704222925e-27
Smik_15.2475.669ON5774222917e-27
CAGL0L10450g5.669ON5504162908e-27
TPHA0J013805.669ON5754252909e-27
Kpol_1018.735.669ON6214222891e-26
KNAG0L019205.669ON5684262872e-26
NDAI0F005105.669ON5704242863e-26
ZYRO0A11506g5.669ON5564202863e-26
ADR210C5.669ON5723942853e-26
Suva_8.1185.669ON5763932845e-26
TDEL0B025405.669ON5694272837e-26
Skud_15.2345.669ON5773932801e-25
SAKL0G00836g5.669ON5613902749e-25
KAFR0D024405.669ON5754152703e-24
KLLA0F16621g5.669ON5613842694e-24
Ecym_40515.669ON6044382661e-23
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F02890
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...  1156   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   847   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   829   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   821   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   818   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   811   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   808   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   788   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   785   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   783   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   779   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   775   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   773   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   772   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   771   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   767   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   764   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   764   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   758   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   750   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   128   6e-31
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   119   7e-28
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   118   1e-27
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   117   3e-27
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   117   5e-27
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   116   7e-27
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   116   8e-27
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   116   9e-27
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   115   1e-26
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   115   2e-26
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   114   3e-26
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   114   3e-26
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   114   3e-26
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   114   5e-26
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   113   7e-26
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   112   1e-25
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   110   9e-25
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   108   3e-24
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   108   4e-24
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   107   1e-23

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/563 (100%), Positives = 563/563 (100%)

Query: 1   MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE 60
           MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE
Sbjct: 1   MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE 60

Query: 61  YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD 120
           YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD
Sbjct: 61  YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD 120

Query: 121 YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF 180
           YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF
Sbjct: 121 YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF 180

Query: 181 TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM 240
           TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM
Sbjct: 181 TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM 240

Query: 241 AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL 300
           AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL
Sbjct: 241 AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL 300

Query: 301 YIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVV 360
           YIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVV
Sbjct: 301 YIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVV 360

Query: 361 GFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNL 420
           GFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNL
Sbjct: 361 GFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNL 420

Query: 421 SMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSIS 480
           SMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSIS
Sbjct: 421 SMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSIS 480

Query: 481 NIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGC 540
           NIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGC
Sbjct: 481 NIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGC 540

Query: 541 FVLFWMWTYYKLITLRNKTIQEL 563
           FVLFWMWTYYKLITLRNKTIQEL
Sbjct: 541 FVLFWMWTYYKLITLRNKTIQEL 563

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/550 (71%), Positives = 463/550 (84%), Gaps = 3/550 (0%)

Query: 15  SKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAI 74
           +K+KS  K     +  A  +EE FYASP+YDFLYPFR  G+QW+ +YIIV F LII+ AI
Sbjct: 17  AKSKSNPKKASKLNNEA--IEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAI 74

Query: 75  GLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGK 134
           GLGSYSG    PMFGDFEAQRHWMEITQHLP+S+WYWFDLQYWGLDYPP TAYHSY+LGK
Sbjct: 75  GLGSYSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGK 134

Query: 135 IGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIG 194
           IG+FIYP WF L+ SRG+E +GIKSYMR TVL+SE +FY PAI+YF+KW G+ + QSPIG
Sbjct: 135 IGSFIYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIG 194

Query: 195 QFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQM 254
           Q++AA AILFQP+LMLIDHGHFQYN VMLGLTVYAINNLLD FY++A+VCFVLSICFKQM
Sbjct: 195 QYIAATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQM 254

Query: 255 ALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF-GGVGNVLQSI 313
           +LYYAPIFF  LLSKSLFFPRLFNIPR + +A  T+ +   M++PLYIF GG+ N++QS+
Sbjct: 255 SLYYAPIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSV 314

Query: 314 HRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYP 373
           HRIFPFARGIFEDKVANFWCVTN+  KYK  FTQ +LQ YSL ATV+GF PA +I++ YP
Sbjct: 315 HRIFPFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYP 374

Query: 374 KKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFT 433
           KK L+PY LAACSM+FFLFSFQVHEKTILVPLLP TLL+TST+WN LSMV W+NNVALFT
Sbjct: 375 KKHLLPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFT 434

Query: 434 LWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLP 493
           LWPLLKKDGL LQY VC  + NWLLGNFSF+TP+FLPK+LTPGPSIS I ENY RRSLLP
Sbjct: 435 LWPLLKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLP 494

Query: 494 HNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLI 553
           HNI+WK++I+ SYL M + H L++ +  P+ YPD+W+ LNC +GFG FV FWMWTYY L 
Sbjct: 495 HNILWKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLF 554

Query: 554 TLRNKTIQEL 563
           TLRNKT+ +L
Sbjct: 555 TLRNKTLMDL 564

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/566 (69%), Positives = 466/566 (82%), Gaps = 6/566 (1%)

Query: 1   MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE 60
           M+ + K P+ +D SS+ KS    + +K    PE  E FYASP+YD LYPFR  GSQW+TE
Sbjct: 1   MAGKNKIPK-KDLSSQKKSGKTKETSKKHDIPE--ESFYASPLYDLLYPFRPAGSQWMTE 57

Query: 61  YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD 120
           Y IV+F LII+ A+GLG +SG+  PPMFGDFEAQRHWMEITQHLP+ +WYWFDL+YWGLD
Sbjct: 58  YTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLD 117

Query: 121 YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF 180
           YPP TAYHSY+ GKIG+F  P WF LD+SRG E   +K++MR TVL+SE +FYIP +VYF
Sbjct: 118 YPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYF 177

Query: 181 TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM 240
            KW+G+ ++QSPIGQF+AAAAIL QP+L+LIDHGHFQYN V LGLTVYAINNLLD FYAM
Sbjct: 178 VKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAM 237

Query: 241 AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL 300
           AAVCFVLSICFKQM LYY+PIFFA LLSKSLF P+LFNIPRFL++A AT+ S  +M+ PL
Sbjct: 238 AAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPL 297

Query: 301 YIFG---GVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVA 357
           Y+FG   G+ NVLQSIHRIFPFARGIFEDKVANFWCVTNV FKYK +FTQ ELQ YSLV 
Sbjct: 298 YVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVL 357

Query: 358 TVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNW 417
           TVVGF PA MI++FYPKK+L+PY L+ACSMAF+LFSFQVHEKTIL+PLLP TLL+TST+ 
Sbjct: 358 TVVGFLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDR 417

Query: 418 NNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGP 477
           N LS V W+NN+ LFTLWPLLKKDGL LQY VCL++ NWL+GNFSFITP FLPK+LTPGP
Sbjct: 418 NVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGP 477

Query: 478 SISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVG 537
           S+S I ENY  RSLLP NI WK+II++SY+ M  IHVL+  +  P  YPDLWV LNCT+G
Sbjct: 478 SVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLG 537

Query: 538 FGCFVLFWMWTYYKLITLRNKTIQEL 563
           FGCF LFW+W YYKL ++  K++  L
Sbjct: 538 FGCFFLFWIWNYYKLFSMIKKSLHHL 563

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/563 (68%), Positives = 467/563 (82%), Gaps = 15/563 (2%)

Query: 1   MSSEKKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTE 60
           MSSEKK+          K++SK +  + E      E FYASP+YDFL+PFR  GSQW+TE
Sbjct: 1   MSSEKKD---------KKAVSKFESEQGE------ESFYASPLYDFLFPFRPAGSQWLTE 45

Query: 61  YIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLD 120
           +II++F +II+ AIGLG YSG++  PM GDFEAQRHWMEITQHLP+S+WY++DL+YWGLD
Sbjct: 46  WIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLD 105

Query: 121 YPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYF 180
           YPP TA+HSYLLGK+GTF  P WF LD+SRG+ET G+K+YMRFTVLLSE IFY+PA+VYF
Sbjct: 106 YPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYF 165

Query: 181 TKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAM 240
           TKW+GRR+ QSPIGQF+AAAAILFQP+LMLIDHGHFQYN +MLG TVYAINNLLD FYA 
Sbjct: 166 TKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAP 225

Query: 241 AAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPL 300
           AA+CFVLSICFKQM+LYYAPIFFA LL +S+FFP+LFNIPRF+S++ ATL +   MF+P 
Sbjct: 226 AAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPF 285

Query: 301 YIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVV 360
           YIFGG+  + Q++ RIFPFARGIFEDKVANFWCV N   K+K +FT  +L+ YSL+ TVV
Sbjct: 286 YIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVV 345

Query: 361 GFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNL 420
           GF PA +++I YP+K L+PY LAACSM+F+LFSFQVHEKTILVPLLP TLLFTS +WN L
Sbjct: 346 GFAPAMILIILYPRKHLLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVL 405

Query: 421 SMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSIS 480
           SMV W+NNVALFTLWPLLK++GL+LQY VC  + NWL+GNFSFITPRFLPK +TPGPSIS
Sbjct: 406 SMVSWINNVALFTLWPLLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSIS 465

Query: 481 NIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGC 540
           ++++NYRRRSLLPH+I WK+II+ SY+ M   H L+  I AP ++PDLWV LNCT+GF  
Sbjct: 466 SVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVS 525

Query: 541 FVLFWMWTYYKLITLRNKTIQEL 563
           F LFW+WTYYK  TL  K IQ+L
Sbjct: 526 FSLFWLWTYYKFCTLLKKNIQDL 548

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/540 (71%), Positives = 458/540 (84%), Gaps = 2/540 (0%)

Query: 25  RNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQT 84
           +NK+     VEE FYASP+YDFLYPFR  GSQW+TEY+IV+F LII  A+G GSYSG  +
Sbjct: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63

Query: 85  PPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWF 144
           PPMFGDFEAQRHWMEITQHL  SQWYWFDL+YWGLDYPP TAYHSY+LGKIG+FI P WF
Sbjct: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123

Query: 145 ELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
           EL+ SRG+ET  +K++MRFTVLLSE +FYIPA+VYFTKW+G+ +++SPIGQF++AAAILF
Sbjct: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
           QP+LMLIDHGHFQYNCVMLGLTVYAIN+L + FYA+AA+CFVLSICFKQMALYYAPIFFA
Sbjct: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243

Query: 265 VLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF-GGVGNVLQSIHRIFPFARGI 323
            LLSKSLF PR FN PR  ++A AT+ S   M+APLYIF GG+ NV+QS+HRIFPFARGI
Sbjct: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGI 302

Query: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383
           FEDKVANFWCVTNVFFKYK +F Q +LQ YSL+AT++GF PA +++  YPKK +I Y LA
Sbjct: 303 FEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALA 362

Query: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443
            CSM+F+LFSFQVHEKTILVPLLP TLL+TS+NW+ LSM  W+NNV LFTL+PLLKKDGL
Sbjct: 363 TCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGL 422

Query: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503
            LQY VC  + NWLLGNFSF+TP+FLPK LTPGPS+S++  NYRRRS LP N+IWKIII+
Sbjct: 423 TLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIV 482

Query: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
            SY  M ++HV+++ +  P  YPDLWV LNC +GFGCF LFW+W+YY L T+  KT+Q+L
Sbjct: 483 SSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/553 (69%), Positives = 454/553 (82%), Gaps = 4/553 (0%)

Query: 15  SKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAI 74
             TK   K+  N+       +E FYASP+YDFLYPFR  GSQW+TEYIIV+F +II+ A+
Sbjct: 28  EDTKKSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAV 87

Query: 75  GLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGK 134
           GLG YSGF TPPMFGDFEAQRHWMEITQ+LP+SQWYWFDLQYWGLDYPP TA+HSYL GK
Sbjct: 88  GLGPYSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK 147

Query: 135 IGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIG 194
           IG+F  P WF L  SRG E   +K++MR TVL SE + YIPA+VYFTKW+G+R+ QSPIG
Sbjct: 148 IGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIG 207

Query: 195 QFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQM 254
           QF+A AAILFQP+L+LIDHGHFQ+N VMLGLTVY +NNLLD FYA AAVCFVLSICFKQM
Sbjct: 208 QFIAVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQM 267

Query: 255 ALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF----GGVGNVL 310
           ALYY+PIFFA LLSKSLF PRLFNIPRF +++FAT+ +   MF P+Y F    GG+ N+L
Sbjct: 268 ALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL 327

Query: 311 QSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMI 370
           QSI RIFPFARGIFEDKVANFWCVTNV FKYK  FTQ +LQ YSL+ T++ F PA ++++
Sbjct: 328 QSIKRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVIL 387

Query: 371 FYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVA 430
            YP+K+L+ Y L+ACSM+F+LFSFQVHEKTIL+PLLP TLL+TST+ N LS V W+NN+ 
Sbjct: 388 LYPRKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIG 447

Query: 431 LFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRS 490
           LFTLWPLLKKDGL LQY VCL++ NWL+GNFSFITPRFLPK+LTPGPSI  + ENYRR +
Sbjct: 448 LFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPT 507

Query: 491 LLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYY 550
           LLP N IWK+II++SY+ M +IH ++Y I  PS YPDLWV LNCT+GFGCFVLFW+W YY
Sbjct: 508 LLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYY 567

Query: 551 KLITLRNKTIQEL 563
           KL ++  K I +L
Sbjct: 568 KLFSMTKKNIHQL 580

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/552 (69%), Positives = 460/552 (83%), Gaps = 10/552 (1%)

Query: 15  SKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAI 74
           +  K +S++ +        VEE F+ASP+YDFL PFR   +QW+TEYIIV+F LI++ AI
Sbjct: 2   ASKKKISRINK-------PVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAI 54

Query: 75  GLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGK 134
           GLGSYSG   PPMFGDFEAQRHWMEITQHLP+S+WY+FDL+YWGLDYPP TAYHSY+LG 
Sbjct: 55  GLGSYSGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGV 114

Query: 135 IGTFIYPPWFELDASRGMETDG--IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSP 192
           IG+F+   WF L+ SRG E++   +K+YMR TV++SE IFYIP ++YFTKWVGR ++QS 
Sbjct: 115 IGSFLNKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSL 174

Query: 193 IGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFK 252
           IGQ++AAAAILFQP+LMLIDHGHFQYN VMLGLTVYAINNLLD FYA AA+CFVLSICFK
Sbjct: 175 IGQYIAAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFK 234

Query: 253 QMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQ 311
           QMALYYAPIFF  LL +SLF  + FNI RFLS+A +T+ + F M+APLY+FGG + NV+Q
Sbjct: 235 QMALYYAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQ 294

Query: 312 SIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIF 371
           S+HRIFPFARG+FEDKVANFWCVTN+F KYK ++TQ ELQ YSL+ATVVGF PA + ++F
Sbjct: 295 SVHRIFPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILF 354

Query: 372 YPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVAL 431
           YPKK L+PY LAACSM+F+LFSFQVHEKTILVPLLP TLL+TST+WN LS V WVNNV L
Sbjct: 355 YPKKHLLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGL 414

Query: 432 FTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSL 491
           FTLWPLLKKDGL LQY VC  + NWL+GNFSFITP+FLPK+LTPGP + N  + Y RRSL
Sbjct: 415 FTLWPLLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSL 474

Query: 492 LPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYK 551
           LPHNI+WKIII+ SY+ ML+IH+ E  ++ P +YPD+WV +NC +GFGCFVLFW+W YYK
Sbjct: 475 LPHNILWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYK 534

Query: 552 LITLRNKTIQEL 563
           + TL NKT+Q L
Sbjct: 535 IFTLANKTLQYL 546

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/547 (69%), Positives = 453/547 (82%), Gaps = 16/547 (2%)

Query: 32  PEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDF 91
           P  EE FYASP++DFLYPFR  GSQW+TEY+I++F +II+ AI LGSYSG  TPPMFGDF
Sbjct: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDF 73

Query: 92  EAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRG 151
           EAQRHWMEITQHLP+S+WYWFDLQYWGLDYPPFTAYHSY  GK+G+F  P WF L++SRG
Sbjct: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133

Query: 152 METD--GIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLM 209
            E+D  G+K+YMRFTV+LSE +FYIPA+VYFTKW+G+ + QSPIGQF+AAAAILFQP+LM
Sbjct: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193

Query: 210 LIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSK 269
           LIDHGHFQYN VMLGLTVYAINNLLD FY  AA+CFVLS+CFKQMALYY+PIFF  LLSK
Sbjct: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253

Query: 270 SLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG-------------GVGNVLQSIHRI 316
           SL  P   NI RF+ VA +T+ S  VMF P+Y+FG             G+ N++Q I RI
Sbjct: 254 SLVHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRI 312

Query: 317 FPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKF 376
           FPFARGIFEDKVANFWCVTNV  KY+ +FTQ +LQFYSLVAT++GF P+ + +  YP+KF
Sbjct: 313 FPFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKF 372

Query: 377 LIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWP 436
           LIPY LAACSM+FFLFSFQVHEK+IL+PL+P TLL+TST+WN LS+V W+NNVALFTLWP
Sbjct: 373 LIPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWP 432

Query: 437 LLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNI 496
           LL+KDGL LQY VC  + NWL+GNFSFITP+FLP  LTPGPSISNI ++YRR SLLPHNI
Sbjct: 433 LLRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNI 492

Query: 497 IWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLR 556
           +WKIII+ SY+ M  + +L+     P+ YPDLW+ LNCTVGFGCF+LFW+W  YK+I +R
Sbjct: 493 LWKIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMR 552

Query: 557 NKTIQEL 563
           NKT+ +L
Sbjct: 553 NKTLNDL 559

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/559 (67%), Positives = 452/559 (80%), Gaps = 6/559 (1%)

Query: 10  GEDASSKTKSLSKLQRNKDEAAPEVE----ECFYASPIYDFLYPFRSPGSQWVTEYIIVV 65
           G+     +K   K Q +K++ +   E    E FYASP+Y FL PF+S  +QW++ YIIV+
Sbjct: 2   GKSGKHNSKKFVK-QTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVL 60

Query: 66  FLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFT 125
           F LII+ AIGLG YSG    PMFGDFEAQRHWMEITQHLP+SQWY++DLQYWGLDYPP T
Sbjct: 61  FALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLT 120

Query: 126 AYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVG 185
           AYHSY+ G IG F  P WFEL+ SRGME   +K++MR T ++SE IFYIPAI+YFT WVG
Sbjct: 121 AYHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVG 180

Query: 186 RRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCF 245
           +++KQSP+GQ++AAAAILFQP LMLIDHGHFQYN VMLGLTVYAINNLLD  YA AA+ F
Sbjct: 181 KQRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISF 240

Query: 246 VLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF-G 304
           V+SICFKQM+LYYAPIFFA LL +SLF  + FN+ RFL++A AT+ S F +FAPLY+F G
Sbjct: 241 VMSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG 300

Query: 305 GVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFP 364
           G  N++QS+HRIFPFARGIFEDKVANFWCVTNV  KYK  +TQ ELQ YSL+ TVVGF P
Sbjct: 301 GKRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLP 360

Query: 365 AFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVF 424
           A + ++++PKK L+PY LAAC+M+FFLFSFQVHEKTILVPLLP TLL+TST+WN LS+V 
Sbjct: 361 AMVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVS 420

Query: 425 WVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAE 484
           W+NNVALFTLWPLLKKDG+ LQY VC ++ NWL+GNFSF TPRFLPKILTPGP I N+  
Sbjct: 421 WINNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNT 480

Query: 485 NYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLF 544
           +YRRRSLLP+NIIWKIII++SY+ M+ I  LE  +  P QYPD++V LNCT+GF CF  F
Sbjct: 481 HYRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSF 540

Query: 545 WMWTYYKLITLRNKTIQEL 563
           W+W YYKL TL +K +Q L
Sbjct: 541 WLWNYYKLFTLTSKNLQYL 559

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/546 (69%), Positives = 453/546 (82%), Gaps = 2/546 (0%)

Query: 19  SLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGS 78
           S +  +  K +A    EE FYASP+YDFLYPF+  GSQW+ EYII++F +II+ AIGLG 
Sbjct: 3   SKTSKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGP 62

Query: 79  YSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTF 138
           YSG    PM GDFEAQRHW+EITQHLP+SQWY+FDL+YWGLDYPP TAYHSY+LGK+G+ 
Sbjct: 63  YSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSL 122

Query: 139 IYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVA 198
           I P WF L+ SRG+E++ +K+YMRFTV+LSE IFYIPA+VYFTKWVGR +  SP+GQF+A
Sbjct: 123 INPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIA 182

Query: 199 AAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYY 258
           AAAILFQP LMLIDHGHFQYNCVMLG TVYAIN+L+D FYA AA CFVLSICFKQMALYY
Sbjct: 183 AAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYY 242

Query: 259 APIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG-GVGNVLQSIHRIF 317
           +PIFFA LL + +F   +   PRFLS+A AT+A+  VM+ PLYI G G  NVLQS+HRIF
Sbjct: 243 SPIFFAYLLGRCVFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIF 301

Query: 318 PFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFL 377
           PFARGIFEDKVANFWCVTN+F KYK +FTQ +LQ YSL+AT +GF PA ++++ YPKK L
Sbjct: 302 PFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHL 361

Query: 378 IPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPL 437
           +P+ LAACSM+FFLFSFQVHEKTILVPLLP TLL+TSTNW+ LS+V W+NNV LFTLWPL
Sbjct: 362 VPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPL 421

Query: 438 LKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNII 497
           LKKDGL LQYCVC    NWL+GNFSF+TP FLPK LTPGPS+S++  NYRRRSLLP +II
Sbjct: 422 LKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSII 481

Query: 498 WKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRN 557
           WK+II+ SY+ M  IHVL+  +A P  YPDLWV LNCT+GFGCF+LFW+W YYKL +L  
Sbjct: 482 WKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAG 541

Query: 558 KTIQEL 563
           +++Q+L
Sbjct: 542 QSLQQL 547

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/533 (69%), Positives = 445/533 (83%), Gaps = 4/533 (0%)

Query: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93
            EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++ AIGLG YSG  TPP+ GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEA 72

Query: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153
           QRHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HSYLLG IGTF  P WF LD SRG E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFE 132

Query: 154 T--DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLI 211
           +  +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AAAAILFQP+LMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLI 192

Query: 212 DHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSL 271
           DHGHFQYN VMLGLT YAINNLLD +YAMAA+CFVLSICFKQMALYYAPIFFA LLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 272 FFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVAN 330
           FFP+ FNI R   +AFATLA+  +MFAPLY  GG + N+ Q IHR+FPFARGIFEDKVAN
Sbjct: 253 FFPK-FNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDKVAN 311

Query: 331 FWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFF 390
           FWCV+N+F KYK  F+  +LQ YSLVATV+GF PA M+ + +PKK L+PY L ACSM+FF
Sbjct: 312 FWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFF 371

Query: 391 LFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVC 450
           LFSFQVHEKTILVPLLP TLL++ST+WN LS+V W+NNVALFTLWPLLKKDGL LQY V 
Sbjct: 372 LFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVS 431

Query: 451 LVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCML 510
            ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M 
Sbjct: 432 FLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMG 491

Query: 511 MIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
           + H L+  +A P +YPDLWV LNC VGF CF +FW+W+YYK+ T  NK++++L
Sbjct: 492 LYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/539 (68%), Positives = 448/539 (83%), Gaps = 1/539 (0%)

Query: 24  QRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQ 83
            + K  +   V+E F+ASP++DFL PFR   +QW  +YIIV+F LII+  +GLGS+SG  
Sbjct: 3   SKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMN 62

Query: 84  TPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPW 143
            PPM GDFEAQRHWME+T +LP+SQWYW+DL YWGLDYPP TAYHSY+LGK+G    P W
Sbjct: 63  VPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTW 122

Query: 144 FELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAIL 203
           F+L  SRG E+  +KSYMRFTVLLSE + YIP ++YF KW+G+ + Q+PIGQ++AAAAIL
Sbjct: 123 FQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAIL 182

Query: 204 FQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFF 263
           FQP+L+LIDHGHFQYN VMLGLTVYAINNLLD +YA AA+CFVLS+CFKQMALYYAPIFF
Sbjct: 183 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFF 242

Query: 264 AVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGI 323
           + LLSKSLF P LFN+PR L+VA ATL S   MF PLY++GG+ NVLQSIHRIFPF+RGI
Sbjct: 243 SYLLSKSLFSP-LFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGI 301

Query: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383
           FEDKVANFWC +N+F KYK ++TQS+LQ YSL AT +GF PAF+++ FYPKK LIPY L 
Sbjct: 302 FEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALT 361

Query: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443
           ACSM+FFLFSFQVHEKTILVPLLP TLL+TST+WN LSMV W+NN+A FTLWPLLKKDGL
Sbjct: 362 ACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGL 421

Query: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503
            LQY   L++ NWL+GNFSF+TPRFLPK LTPGPS S+++ENYRRRSLLP NI WK+II+
Sbjct: 422 VLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIV 481

Query: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQE 562
            SY+ M ++H+L++ +  P++YPDLWV LNC++GF  F LFW+W YYK+ TLRNKT+ +
Sbjct: 482 ASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/533 (68%), Positives = 444/533 (83%), Gaps = 4/533 (0%)

Query: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93
            EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++  IGLG YSG  +PP+ GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEA 72

Query: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153
           QRHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HSYLLG IG+F  P WF LD SRG E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFE 132

Query: 154 T--DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLI 211
           +  +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AA+AILFQP+LMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192

Query: 212 DHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSL 271
           DHGHFQYN VMLGLT YAINNLLD +YAMAA+CFVLSICFKQMALYYAPIFFA LLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 272 FFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVAN 330
            FP+ FNI R   ++FATLA+  +M APLY  GG + N+ Q IHRIFPFARGIFEDKVAN
Sbjct: 253 LFPK-FNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDKVAN 311

Query: 331 FWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFF 390
           FWCVTNVF KYK  F+  +LQ YSLVATV+GF PA ++ + +PKK L+PY L ACSM+FF
Sbjct: 312 FWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFF 371

Query: 391 LFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVC 450
           LFSFQVHEKTILVPLLP TLL++ST+WN LS+V W+NNVALFTLWPLLK+DGL LQY V 
Sbjct: 372 LFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVS 431

Query: 451 LVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCML 510
            ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M 
Sbjct: 432 FLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMG 491

Query: 511 MIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
           + H L+  +A PS+YPDLWV LNCTVGF CF +FW+W+YYK+ T  +K++++L
Sbjct: 492 LYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/559 (64%), Positives = 444/559 (79%), Gaps = 2/559 (0%)

Query: 5   KKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIV 64
           + +P+ E A   +K   +     D   P ++E F+ASP+YDFLYP R   +QW  +YIIV
Sbjct: 7   RDKPRMEGAP-PSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIV 65

Query: 65  VFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPF 124
           +F LII+ A+GLG YSG   PPMFGDFEAQRHWME+TQH+PVS+WY+  LQYWGLDYPP 
Sbjct: 66  IFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPL 125

Query: 125 TAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWV 184
           TAYHSYLLGK+G++I P WF L ASRG E++ +KSYMR TV+LSE  FYIPA++YFT+W+
Sbjct: 126 TAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWI 185

Query: 185 GRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVC 244
           GRR++QSPIGQ++A AAILFQP L+LIDHGHFQYNCVMLGLTV AINNLLD +YA+AAV 
Sbjct: 186 GRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVN 245

Query: 245 FVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG 304
           FV S+ FKQMALYYAP+ F  LLS+S+++PRL NIPRF++VA ATL +  V++APLY+ G
Sbjct: 246 FVFSLGFKQMALYYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLG 304

Query: 305 GVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFP 364
            +  + QSIHR+FPF RG+FEDKVANFWCVTNV  KYKT +T S+L+F+SLV T     P
Sbjct: 305 NISAIFQSIHRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLP 364

Query: 365 AFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVF 424
           + +I   YPKKF++PY LAACSM+FFLF FQVHEKTILVPLLP TLL+TST+WN LSMV 
Sbjct: 365 SLIITFLYPKKFMLPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVA 424

Query: 425 WVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAE 484
           W+NN+ALFTLWPLLKKDGL LQY +  ++ NWL+GNFSFITP FLPK+LTPGPS+S++A+
Sbjct: 425 WINNIALFTLWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVAD 484

Query: 485 NYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLF 544
            YRRRSLLP NIIW+III+VSY+C+  IH+ E       + PD+WV  NC VG   F LF
Sbjct: 485 GYRRRSLLPSNIIWRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALF 544

Query: 545 WMWTYYKLITLRNKTIQEL 563
           WMW  YK+  +RN TI +L
Sbjct: 545 WMWNNYKMFAMRNSTISDL 563

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/532 (69%), Positives = 442/532 (83%), Gaps = 4/532 (0%)

Query: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94
           EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++ AIGLG YSG  +PP+ GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73

Query: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154
           RHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HS L G IGTF  P WF LD SRG E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133

Query: 155 --DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLID 212
             +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AAAAILFQP+LMLID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 213 HGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLF 272
           HGHFQYN VMLGLT YAINNLLD +YAMAAVCFVLSICFKQMALYYAPIFFA LLS+SL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 273 FPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVANF 331
           FP+ FNI R   +AFATLA+  V+ APLY  GG + N+ Q I+RIFPF+RGIFEDKVANF
Sbjct: 254 FPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANF 312

Query: 332 WCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFL 391
           WCVTN+F KYK  FT  +LQ YSLVATV+GF PA ++ + +PKK L+PY L ACSM+FFL
Sbjct: 313 WCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFL 372

Query: 392 FSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCL 451
           FSFQVHEKTILVPLLP TLL++ST+WN LS+V W+NNVALFTLWPLLKKDGL LQY V  
Sbjct: 373 FSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSF 432

Query: 452 VMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLM 511
           ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M +
Sbjct: 433 LLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGV 492

Query: 512 IHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
            H+L+  +  PS+YPDLWV LNC VGF CF +FW+W+YYK+ T  NK++++L
Sbjct: 493 YHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/566 (64%), Positives = 456/566 (80%), Gaps = 10/566 (1%)

Query: 5   KKEPQGEDASSKTKSLSKLQRNKDEAAP-------EVEECFYASPIYDFLYPFRSPGSQW 57
           KK+   ++A  KT  +S L  N +           E  E F+ASP+YDFL PFR  G+QW
Sbjct: 4   KKKQTPKNAVKKT--VSSLPANAETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQW 61

Query: 58  VTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYW 117
             +Y+IV+F LII+ A+GLG YSG  TPPMFGDFEAQRHWMEITQHLPV +WYW+DLQYW
Sbjct: 62  CAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYW 121

Query: 118 GLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAI 177
           GLDYPP TAYHSYLLGK+G+F    WF+L++SRG E+  +KSYMRFTV++SE + YIPA+
Sbjct: 122 GLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLNLKSYMRFTVIISELLLYIPAV 181

Query: 178 VYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGF 237
           +YFTKWVG+ + QSPIGQ++AAAAILFQP L+L+DHGHFQYNCVMLG+TVY +NNLLDGF
Sbjct: 182 IYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGF 241

Query: 238 YAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMF 297
           YAM A+CFVLS+CFKQMALYY+PIFFA LLSKS + P + N+PR  +++ +T  +    F
Sbjct: 242 YAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSF 300

Query: 298 APLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVA 357
            P+YIFGG  N++QS+HRIFPFARGIFEDKVANFWCV+N+F KY+ +FTQ +LQ YSL+A
Sbjct: 301 GPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLA 360

Query: 358 TVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNW 417
           TV+G  P+F+I   YPK+ L+PY LAACSM+FFLFSFQVHEKTIL+PLLP TLL+TS +W
Sbjct: 361 TVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDW 420

Query: 418 NNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGP 477
           N LS+V W+NNVALFTLWPLLKKD L LQY V  +  NWL+GNFSF+TPRFLPK LTPGP
Sbjct: 421 NVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGP 480

Query: 478 SISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVG 537
           SIS+I  +YRR SLLP ++IW++II+ SY+ M +IH L+Y ++ PS+YPDLWV  NC++G
Sbjct: 481 SISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLG 540

Query: 538 FGCFVLFWMWTYYKLITLRNKTIQEL 563
           F CFV FW+W  YKL  +RN T+Q+L
Sbjct: 541 FSCFVTFWIWNNYKLFEMRNSTLQDL 566

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/528 (66%), Positives = 438/528 (82%), Gaps = 1/528 (0%)

Query: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94
            E F+ASP+YDFL PFR   +Q+  EY+IV+F L+I+ A+GLGS+SG  + P+ GDFEAQ
Sbjct: 9   NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQ 68

Query: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154
           RHWME+T HLP+SQWYW+DLQYWGLDYPP TAYHSY+LGK+G+ +   WF L +SRG+E 
Sbjct: 69  RHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIEN 128

Query: 155 DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHG 214
             IK+YMRFTV+LSE   YIPA++YFTKW G +++QSPIGQ++AAAAILFQP+L+LIDHG
Sbjct: 129 PDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 215 HFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFP 274
           HFQYN VMLGLTVY+INNLLDG+Y  AA+CFVLS+CFKQMALYY+P+FFA LLS+ L  P
Sbjct: 189 HFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISP 248

Query: 275 RLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCV 334
            L N+PRFLSVAF+T+ S  ++F+PLY+FGG  NVLQSIHRIFPF+RGIFEDKVANFWCV
Sbjct: 249 SL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVANFWCV 307

Query: 335 TNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSF 394
           +NV FKY   +TQ ELQ +S++AT  GF P+F++++ YPKK +IP+ LAACSMAFFLFSF
Sbjct: 308 SNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLFSF 367

Query: 395 QVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMY 454
           QVHEK+ILVPLLP TLL+ ST+WN LSMV W+NNVALFTLWPLLKKD L LQY + +++ 
Sbjct: 368 QVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILMLLS 427

Query: 455 NWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHV 514
           NWL+GNFSF+TPRFLPK +TPGPSIS ++E YRRRS LP N  WK+II+ SYL M  IH+
Sbjct: 428 NWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAIHI 487

Query: 515 LEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQE 562
           L++ +  P   PDLWV LNC +GF CF +FW+W +YKL T+RN  +Q+
Sbjct: 488 LDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/529 (66%), Positives = 439/529 (82%), Gaps = 1/529 (0%)

Query: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94
           +E F+ASP+YDFL PFR   +Q+  EY+IV+F L+I+ A+GLGS+SG  T PM GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154
           RHWME+T +LP+SQWYWFDLQYWGLDYPP TAYHSY LGK+G+ + P WF L +SRG ET
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 155 DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHG 214
             +K+YMRFTV+LSE   YIPA++YFTKW G +++QSPIGQ++AAAAILFQP+L+LIDHG
Sbjct: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 215 HFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFP 274
           HFQYN VMLGLTVYAINNLLDGF+  AA+CF+LS+CFKQMAL+Y+PIFFA LLS+SLF P
Sbjct: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248

Query: 275 RLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCV 334
             F   RF+SVA +T+ +  +MF+PLY+FGG+ NVLQSIHRIFPF+RGIFEDKVANFWCV
Sbjct: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307

Query: 335 TNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSF 394
           +NV  KY   FTQ +LQ  S  AT  GF P+F +++ YPKK +IPYGLAACSMAFFLF F
Sbjct: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367

Query: 395 QVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMY 454
           QVHEK+ILVPLLP +LLF ST+WN L++V W+NNVALFTLWPLLKKD L LQY + +++ 
Sbjct: 368 QVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427

Query: 455 NWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHV 514
           NWL+GNFSF+TPRFLP  +TPGPS+SN+AE YRRRS LP+NI+WKI+I+ SY+ M +IH+
Sbjct: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487

Query: 515 LEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
           L+  +  P++ PDLWV +NC +GF CF +FW+W  YKL T+RNK+I +L
Sbjct: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/540 (64%), Positives = 434/540 (80%), Gaps = 1/540 (0%)

Query: 24  QRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQ 83
           ++ +D     VEE F+ASP+YDFLYP R   +QW  +YII++F LI++ A+GLG YSG  
Sbjct: 11  EKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKG 70

Query: 84  TPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPW 143
             P+FGDFEAQRHWMEIT  LP+S+WY++DL+YWGLDYPP TAYHSY+LG++G+F+   W
Sbjct: 71  KGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATW 130

Query: 144 FELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAIL 203
           F+L+ SRG E+  +KS+MR TVLLSE + YIPA++YFT+W+GR + QSPIGQ+VA AAIL
Sbjct: 131 FKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAIL 190

Query: 204 FQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFF 263
           FQP+L+LIDHGHFQYNCVMLGL VY INNLLD FY  AA+CFVLS+ FKQMALYY+P+ F
Sbjct: 191 FQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF 250

Query: 264 AVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGI 323
           A L S+S ++PR FN PRF  +A ATL +   ++APL +FG   N++QS++R+FPF+RGI
Sbjct: 251 AYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGI 309

Query: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383
           FEDKVANFWCVTNV  KY+ ++TQ +LQFY L+ T +  FPAF+I+  YPKKFL+PY LA
Sbjct: 310 FEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALA 369

Query: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443
           ACSMAFFLFSFQVHEKTILVPLLP TLL  STNW+ LSMV W+NNVALFTLWPLLKKDGL
Sbjct: 370 ACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGL 429

Query: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503
            LQY +  ++ NWLLGNFSF+TP FLPK LTPGPS+S++A++YRRRSLLP NI W+III+
Sbjct: 430 LLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIV 489

Query: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
            SY+CM  IH+L+  +  P  YPD+WV   C +GF CF  FW+W YY+L  +RN ++ EL
Sbjct: 490 SSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/533 (68%), Positives = 444/533 (83%), Gaps = 4/533 (0%)

Query: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93
            EE FYASP+YDFLYPFR  G+QW+ EYII V  +I++  IGLG YSG  +PP++GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEA 72

Query: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153
           QRHWMEITQHLP+S+WYW+DLQYWGLDYPP TA+HSYLLG IG+F  P WF L+ SRG E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFE 132

Query: 154 T--DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLI 211
           +  +G+K+YMR TV++S+ +FY PA++YFTKW+GR + QSPIGQ +AA+AILFQP+LMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192

Query: 212 DHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSL 271
           DHGHFQYN VMLGLT YAINNLLD +YAMAAVCFVLSICFKQMALYYAPIFFA LLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 272 FFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQSIHRIFPFARGIFEDKVAN 330
            FP+ FNI R   +AFATLA+  ++FAPLY  GG + N+ Q IHRIFPFARGIFEDKVAN
Sbjct: 253 LFPK-FNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVAN 311

Query: 331 FWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFF 390
           FWCVTNVF KYK  FT  +LQ YSL+ATV+GF PA ++ + +PKK L+PY L ACSM+FF
Sbjct: 312 FWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFF 371

Query: 391 LFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVC 450
           LFSFQVHEKTIL+PLLP TLL++ST+WN LS+V W+NNVALFTLWPLLKKDGL LQY V 
Sbjct: 372 LFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVS 431

Query: 451 LVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCML 510
            ++ NWL+GNFSFITPRFLPK LTPGPSIS+I  +YRRRSLLP+N++WK  I+ +Y+ M 
Sbjct: 432 FLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMG 491

Query: 511 MIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563
             H L+  +A PS+YPDLWV LNC VGF CF +FW+W+YYK+ T  +K++++L
Sbjct: 492 FYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  128 bits (322), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 114/422 (27%), Positives = 188/422 (44%), Gaps = 74/422 (17%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPPF AY  + L +      P + + D  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQF----VPKFVKEDGC 98

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +  +G        + R TV++SE + ++   V+        K QS    FV A++I+ 
Sbjct: 99  LDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIIL 154

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  + G+ + +I    +  Y +  + + +++CFK + LY AP +F 
Sbjct: 155 SPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFV 214

Query: 265 VLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGV-------------GNVLQ 311
            LL        + N   F   ++  L  L V +  L   GG+              ++ Q
Sbjct: 215 FLLR-----AYVLNFQDFKFKSYKDLI-LVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQ 268

Query: 312 SIHRIFPFARGI--------------FEDKVANFWCVTNVFFKYKTMFTQSELQFYS--- 354
            + R+FPF+RG+              F DK+ +   V   F K+  +    E + ++   
Sbjct: 269 LLSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGS 328

Query: 355 --LVATVVGFFP---------AFMIMIFYPKKFLIPY-----------GLAACSMAFFLF 392
             LV  V  FF           F++ +FY    ++P             L  C  A FLF
Sbjct: 329 RGLVEDV--FFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLF 386

Query: 393 SFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLV 452
            + VHEK IL+ ++P + L        LS    V +    +L+PLL K   +L  C+ L+
Sbjct: 387 GWHVHEKAILLVIIPFSFLVVCDR-RLLSSFMLVGSAGYVSLFPLLFKGQDFLLKCLYLI 445

Query: 453 MY 454
           ++
Sbjct: 446 VW 447

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  119 bits (298), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 115/418 (27%), Positives = 178/418 (42%), Gaps = 81/418 (19%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +LL +      P   + D  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQF----VPQRVQDDGC 99

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV++SE + ++   VY    + +         FV A++I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVL 155

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I       Y +    F  ++CFK + LY AP FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 265 VLLSK-----SLFFPRLFNI-------PRFLSVAFATLASLFVMFAPLYIFGGVGNVLQS 312
            LL       S F  R +N             +    L+   V FAP      +  + Q 
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQL 270

Query: 313 IHRIFPFARGIFEDKVA-NFWCVTNVFFKYKTMF-------------------------- 345
           + R+FPF+RG+     A NFW + +   K  T+F                          
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 346 TQSELQFYS-----LVATV-VGFFP------AFMIMIFYPKKFLIPY-----------GL 382
            +++LQ Y+     LV  V     P       F++ +FY    +IP             L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 383 AACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKK 440
             C  A FLF + VHEK +L+ ++P + L T T+   L+    V +    +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 118/422 (27%), Positives = 176/422 (41%), Gaps = 89/422 (21%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+S+WY+     W LDYPPF AY  + L +      P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPKSVRDDGC 121

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + ++   +Y        + QS    FV A++I+ 
Sbjct: 122 LDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVL 177

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I    +  Y + AV +  +ICFK + LY AP +F 
Sbjct: 178 SPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFV 237

Query: 265 VLLS-----------KS----LFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL            KS    LF  R  N+ +  +V        F+ FA          +
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFA--------HQM 289

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWC--------VTNVFFK------YKTMFTQ------- 347
            Q + R+FPF+RG+     A NFW         +T V  K      + T F +       
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQN 349

Query: 348 -SELQFYSLVATVVG--------FFP---------AFMIMIFYPKKFLIPY--------- 380
             E+    L A   G        FF           F++ IFY    ++P          
Sbjct: 350 IKEIN-ERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKRF 408

Query: 381 --GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLL 438
              L  C +A FLF + VHEK I++ ++P T L    +   L     V +    +L+PLL
Sbjct: 409 VGSLTLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLL 467

Query: 439 KK 440
            K
Sbjct: 468 YK 469

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  117 bits (293), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 108/393 (27%), Positives = 168/393 (42%), Gaps = 78/393 (19%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ QWY+ +   W LDYPPF AY  + L ++   I      LD  
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 150 R----GMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQ 205
           +    GM T     + R TV+ SE + ++   VY  K      ++S    FV A++I+  
Sbjct: 104 KVGQFGMPT---IVFQRLTVIASEILLFVVLQVYINK--SHISERS--ANFVVASSIVLS 156

Query: 206 PTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAV 265
           P  ++IDH HFQYN  +  + + +I    +  Y +  + F ++ICFK + LY AP FF  
Sbjct: 157 PGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVF 216

Query: 266 LLSKSLF---------FPRLFNIPR---FLSVAFATLASLFVMFAPLYIFGGVGNVLQSI 313
           LL   +          +  L +I +      +    L    V FAP      +    Q +
Sbjct: 217 LLRVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF-----ISQWPQLL 271

Query: 314 HRIFPFARGIFEDKVA-NFWCVTNVFFKYKTM---------------------------F 345
            R+FPF+RG+     A NFW + ++  K  T+                            
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEI 331

Query: 346 TQSELQF-----------YSLVATVVGFFPAFMIMIFYPKKFLIPY-----------GLA 383
            Q  LQ+           Y ++   +     F++ +FY    +IP             L 
Sbjct: 332 KQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTN 416
            C  A FLF + VHEK I++ ++P + L TS  
Sbjct: 392 LCGFASFLFGWHVHEKAIMLIIIPFSFLVTSDR 424

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  117 bits (292), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 177/422 (41%), Gaps = 73/422 (17%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ +T  LP+ QWY+     W LDYPPF AY  +++ +    +      LD  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 150 R-GMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTL 208
             G   +    + R +V+ SE + ++    +      + + QS    F+ A +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 209 MLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLS 268
           +++DH HFQYN  +  + + +I       Y + AV +  ++CFK + LY AP +F  LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 269 KSLF------------FPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRI 316
             +               RL        +A   L+ + V F P +IF    ++ Q + R+
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGP-FIF----DMPQLLTRL 286

Query: 317 FPFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVG--FFPA-------- 365
           FPF+RG+     A NFW + +   K  T         ++L    +   FFPA        
Sbjct: 287 FPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATIKEIQKR 346

Query: 366 ----------------------------FMIMIFYPKKFLIPY-----------GLAACS 386
                                       F++ +FY    +IP             L  C 
Sbjct: 347 LSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFIGSLTLCG 406

Query: 387 MAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQ 446
           MA +LF + VHEK I++ ++P + L        LS     ++    +L+PLL ++  +L 
Sbjct: 407 MASYLFGWHVHEKAIMLVIIPFSFLVVCDR-RLLSSFMLASSAGYVSLFPLLYENQDFLI 465

Query: 447 YC 448
            C
Sbjct: 466 KC 467

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  116 bits (291), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 118/422 (27%), Positives = 174/422 (41%), Gaps = 89/422 (21%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+S+WY+     W LDYPPF AY  + L +      P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPKVVRDDGC 121

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + Y    +Y        + QS    FV A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVL 177

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I    +  Y + A  +  +ICFK + LY AP +F 
Sbjct: 178 SPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFV 237

Query: 265 VLLS-----------KS----LFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL            KS    LF  R  N+ +  S+        FV FA          +
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPFA--------HQM 289

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWC--------VTNVFFK------YKTMFTQ------- 347
            Q + R+FPF+RG+     A NFW         +T V  K      + T F +       
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQN 349

Query: 348 -SELQFYSLVATVVG--------FFP---------AFMIMIFYPKKFLIPY--------- 380
             E+    L A   G        FF           F++ +FY    ++P          
Sbjct: 350 IKEIN-ERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRF 408

Query: 381 --GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLL 438
              L  C +A FLF + VHEK I++ ++P T L    +   L     V +    +L+PLL
Sbjct: 409 VGSLTLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLL 467

Query: 439 KK 440
            K
Sbjct: 468 YK 469

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  116 bits (290), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 106/416 (25%), Positives = 171/416 (41%), Gaps = 81/416 (19%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ QWY+     W LDYPPF AY  + L +      P + + D  
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPSYVKSDGC 91

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + ++   VY        + QS    FV A++I  
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I    +  Y      + +++CFK + LY AP +F 
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 265 VLLSKSLFFPRLFNIPRFLSVAF------------ATLASLFVMFAPLYIFGGVGNVLQS 312
            LL   +   + F    +  + F              +A+  V F P +IF    ++ Q 
Sbjct: 208 FLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIF----DLPQL 262

Query: 313 IHRIFPFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVG--FFPA---- 365
           + R+FPF+RG+     A NFW + +   K  TM        Y L +  +     PA    
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 366 --------------------------------FMIMIFYPKKFLIPY-----------GL 382
                                           F++ + Y    ++P             +
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 383 AACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLL 438
             C +A FLF + VHEK I++ ++P + L  S     LS    + +    +L+PLL
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVISDR-RLLSSFMLLTSAGYVSLFPLL 437

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 110/425 (25%), Positives = 180/425 (42%), Gaps = 93/425 (21%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT +LP+S+WY+ +   W LDYPPF AY  ++L +      P   + D  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFA----PEIVKNDGC 119

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV++SE + +     Y      + + Q     FV A++I+ 
Sbjct: 120 LDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVL 175

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I       Y   AV + +S+CFK + LY AP +F 
Sbjct: 176 SPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFV 235

Query: 265 VLLSKSLF------------------FPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGV 306
            LL   +                   + RLF +   +S  F       + FAP +IF   
Sbjct: 236 FLLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFT------ICFAP-FIF--- 285

Query: 307 GNVLQSIHRIFPFARGIFEDKVA-NFWCVTNVFFKYKTM--------------FTQSEL- 350
             + Q + R+FPF+RG+     A NFW + +   K  T               FT S + 
Sbjct: 286 -QLPQVLSRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPIL 344

Query: 351 -----------------------QFYSLVATVVGFFPAFMIMIFYPKKFLIPY------- 380
                                   ++ ++   +     F++ +FY    +IP        
Sbjct: 345 PKTAAEIRERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYK 404

Query: 381 ----GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWP 436
                L  C MA +LF + VHEK I++ ++P + L  S     +S +  V      +L+P
Sbjct: 405 RFIGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVSDRRLLISFML-VTAAGYVSLFP 463

Query: 437 LLKKD 441
           LL ++
Sbjct: 464 LLFEN 468

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 113/422 (26%), Positives = 176/422 (41%), Gaps = 87/422 (20%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+WM IT  LP+S+WY+ +   W LDYPPF AY  + L +      P     D  
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQF----VPKIVRDDGC 164

Query: 150 RGMETDG-----IKSYMRFTVLLSE-CIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAIL 203
             +   G        + R TV++SE C+F +      T  +  R +      FV A++I+
Sbjct: 165 LDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS-----FVVASSIV 219

Query: 204 FQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFF 263
             P  +++DH HFQYN  +  + + +I       Y   AV + +++CFK + LY AP +F
Sbjct: 220 LSPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYF 279

Query: 264 AVLLSKSLFFPRLFNIP------------RFLSVAFATLASLFVMFAPLYIFGGVGNVLQ 311
             LL   +   + F               R L +    L    + FAP +IF     + Q
Sbjct: 280 VFLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAP-FIF----QMPQ 334

Query: 312 SIHRIFPFARGIFEDKVA-NFWCVTN--------VFFKY--------------------- 341
            + R+FPF+RG+     A NFW + +        V  K+                     
Sbjct: 335 VLSRLFPFSRGLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIA 394

Query: 342 --KTMFTQSELQFYSLVATVVGFFP---------AFMIMIFYPKKFLIPY---------- 380
             K    ++      LV  V  FF           F++ +FY    +IP           
Sbjct: 395 EIKLRMEENNNGSKGLVEDV--FFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFI 452

Query: 381 -GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLK 439
             L  C +A +LF + VHEK IL+ ++P + L        LS    V +    +L+PLL 
Sbjct: 453 GSLTLCGLASYLFGWHVHEKAILLVIIPFSFLVVCDR-RLLSSFMLVASAGYVSLFPLLY 511

Query: 440 KD 441
           ++
Sbjct: 512 EN 513

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 111/426 (26%), Positives = 176/426 (41%), Gaps = 86/426 (20%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  ++L +      P     D  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQF----VPAAVRADGC 108

Query: 150 RGMETDGIKS-----YMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G+       + R TV+ SE + ++   VY        K QS    FV A++I+ 
Sbjct: 109 LDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVL 164

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P L+++DH HFQYN  +  + + +I       + + A  +  ++CFK + LY AP +F 
Sbjct: 165 SPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFM 224

Query: 265 VLLS--------------KSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVL 310
            LL               K LF  R+ +  R   +    L    V FAP        ++ 
Sbjct: 225 FLLRTYVLQFEGFRFKSYKDLF--RIIHWGRLFKLGGVVLGVAVVCFAPF-----ARDMP 277

Query: 311 QSIHRIFPFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVG--FFPA-- 365
           Q + R+FPF+RG+     A NFW + ++  K  T+       F+ L+  V+    FPA  
Sbjct: 278 QLLSRLFPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASL 337

Query: 366 -----------------------------------FMIMIFYPKKFLIPY---------- 380
                                              F++ + Y    ++P           
Sbjct: 338 DIIRQRLKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFL 397

Query: 381 -GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLK 439
             L  C  A FLF + VHEK I++ ++P + L        L+    V      +L+PLL 
Sbjct: 398 GSLTLCGFASFLFGWHVHEKAIMLVIIPFSFLVVYDR-RLLTSFKLVTTAGYVSLFPLLY 456

Query: 440 KDGLWL 445
           K+  +L
Sbjct: 457 KNDDYL 462

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 108/424 (25%), Positives = 177/424 (41%), Gaps = 88/424 (20%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  + + +      P     D  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQF----VPKVVRDDGC 109

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R +V++SE + ++    +  K     + QS    F+ A +I+ 
Sbjct: 110 LDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIIL 165

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I       Y +  + + +++CFK + LY AP +F 
Sbjct: 166 SPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFV 225

Query: 265 VLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVG-------------NVLQ 311
            LL        + N+  F   ++  L  L + +  L+  GG+              ++ Q
Sbjct: 226 FLLR-----AYVLNVKNFKFKSYKDLI-LLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQ 279

Query: 312 SIHRIFPFARGI--------------FEDKVANFW-------------CVTNVFFKYKTM 344
              R+FPF RG+              F DK+A                C+ +  F     
Sbjct: 280 VFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTRE 339

Query: 345 FTQSELQFY------SLVATV----------------VGFFP--AFMIMIFYP--KKFLI 378
             QS +  Y       LV  V                 GF+   A + ++F P  K+F+ 
Sbjct: 340 EIQSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFI- 398

Query: 379 PYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLL 438
              L  C MA FLF + VHEK IL+ ++P + L        L+    V++    +L+PLL
Sbjct: 399 -GSLTLCGMASFLFGWHVHEKAILLVIIPFSFLVVCDR-RLLTSFMLVSSAGYVSLFPLL 456

Query: 439 KKDG 442
            K+ 
Sbjct: 457 YKND 460

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 109/420 (25%), Positives = 179/420 (42%), Gaps = 67/420 (15%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKI--GTFIYPPWFELD 147
           DF+  R+W+ IT +LP+ QWY+     W LDYPPF AY  + L +   GT       E+ 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEI- 103

Query: 148 ASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPT 207
             +G        + R TV+LSE + ++   V+        + QS    FV A++I+  P 
Sbjct: 104 VDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 208 LMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLL 267
            +++DH HFQYN  +  + + +I     G Y   A  + +++CFK + LY AP +F  LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 268 SKSLFFPRLFNIPRFLSVAFAT-------LASLFVMFAPLYIFGGVGNVLQSIHRIFPFA 320
                  + F    +  + F         L S+ +    L     V ++ Q + R+FPF+
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTRLFPFS 279

Query: 321 RGIFEDKVA-NFWC--------VTNVFFK--YKTMFTQSELQ------------------ 351
           RG+     A NFW         +T V  K  Y   FT   +Q                  
Sbjct: 280 RGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTIDEIKQRIAQN 339

Query: 352 -----------FYSLVATVVGFFPAFMIMIFYPKKFLIPY-----------GLAACSMAF 389
                      F+ ++  +      F +  FY    +IP             L  C +A 
Sbjct: 340 NNGTKGLVQDVFFVILPQITPKL-TFALTAFYQVLAVIPVLFDPSYKRFIGSLTLCGLAS 398

Query: 390 FLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCV 449
           +LF + VHEK I++ ++P + L  + +   L+    +      +L+PLL ++  +L  C+
Sbjct: 399 YLFGWHVHEKAIMLAIVPFSFL-VACDRRLLTSYMLLAASGYVSLFPLLYENQDFLLKCL 457

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 103/394 (26%), Positives = 159/394 (40%), Gaps = 86/394 (21%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DFE  R+W+ +T  LP+ +WY      W +DYPP  A+  + L ++     P     D  
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQV----VPGAVRRDGC 114

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +  +G        + R TV+ SE + Y+   VY    V     Q     FV   ++  
Sbjct: 115 LKLVAEGRYGWPTVVFQRLTVIASEVLLYVVLQVY----VSSSAAQERTVNFVVTTSVAL 170

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  +L+DH HFQYN  +  + V +I    +  Y +    F +++C K + LY AP +F 
Sbjct: 171 SPAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFV 230

Query: 265 VLLS--------------KSLFFP-RLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL               + L F  R  N+ R   V  A +A   V FAP   F GV  +
Sbjct: 231 FLLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMA---VTFAP---FAGV--M 282

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVG--FFPA- 365
            Q + R+FPF+RG+     A NFW + +   K  T         Y L  ++V     PA 
Sbjct: 283 PQLMARLFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLVQPPLIPAS 342

Query: 366 -----------------------------------FMIMIFYPKKFLIPY---------- 380
                                              F++ +FY    ++P           
Sbjct: 343 IDEIRARMAAGNHGTRGLVQDVSFVILPQIQPKLTFLLTLFYQVLAVLPVLFDPSFKRFI 402

Query: 381 -GLAACSMAFFLFSFQVHEKTILVPLLPATLLFT 413
             L+ C  + FLF + VHEK I++ ++P + L +
Sbjct: 403 GSLSLCGFSAFLFGWHVHEKAIMLVIVPFSFLVS 436

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 110/393 (27%), Positives = 162/393 (41%), Gaps = 89/393 (22%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+S+WY+     W LDYPPF AY  + L +      P     D  
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPKVVRDDGC 121

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + +    +Y        + QS    FV A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVL 177

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +  + + +I    +  Y   AV +  SICFK + LY AP +F 
Sbjct: 178 SPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFV 237

Query: 265 VLLS-----------KS----LFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL            KS    LF  R  N+ +  S+        F+ FA          +
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPFA--------HQM 289

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWC--------VTNVFFK--YKTMFTQSELQ------- 351
            Q + R+FPF+RG+     A NFW         +T +  K  Y  MF    ++       
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKD 349

Query: 352 -------------FYSLVATVVGFFP---------AFMIMIFYPKKFLIPY--------- 380
                           LV  V  FF           F++ IFY    ++P          
Sbjct: 350 IKEINERLLANNGSKGLVQDV--FFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRF 407

Query: 381 --GLAACSMAFFLFSFQVHEKTILVPLLPATLL 411
              L  C +A +LF + VHEK I++ ++P T L
Sbjct: 408 IGSLTLCGLASYLFGWHVHEKAIMLVIIPFTFL 440

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  113 bits (283), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 107/427 (25%), Positives = 172/427 (40%), Gaps = 81/427 (18%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +LL +      P   + D +
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQ----FVPKIVKEDGA 110

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + ++   V+        K +S    FV A++I+ 
Sbjct: 111 LDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVL 166

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  ++IDH HFQYN  +    + +I       Y   A  + +++CFK + LY AP +F 
Sbjct: 167 SPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFV 226

Query: 265 VLLSKSLFFPRLFNIPRFLSVAF------------ATLASLFVMFAPLYIFGGVGNVLQS 312
            LL   +   + F    +  + F              L   F+ F P      + ++ Q 
Sbjct: 227 FLLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPF-----LYDLPQV 281

Query: 313 IHRIFPFARGIFEDKVA-NFWCVTNVFFK------------------------------- 340
           + R+FPF+RG+     A NFW + +   K                               
Sbjct: 282 MTRLFPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDD 341

Query: 341 YKTMFTQSELQFYSLVATV-VGFFP------AFMIMIFYPKKFLIPY-----------GL 382
            K    Q+      LV  V     P       F++ +FY    +IP             L
Sbjct: 342 LKERLVQNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSL 401

Query: 383 AACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDG 442
             C ++ +LF + VHEK I++ ++P + L        LS    V      +L+PLL +  
Sbjct: 402 TLCGLSSYLFGWHVHEKAIMLVIVPFSFLVVCDR-RLLSSFMLVAAAGYVSLFPLLYEHQ 460

Query: 443 LWLQYCV 449
            +L  C+
Sbjct: 461 DFLLKCL 467

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 108/393 (27%), Positives = 163/393 (41%), Gaps = 88/393 (22%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+S+WY+     W LDYPPF AY  + L +      P     D  
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPKVVRDDGC 121

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ S+ + ++   VY        + QS    FV A++I+ 
Sbjct: 122 LDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVL 177

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P   +IDH HFQYN  +  + + +I       Y + A+ +  +ICFK + LY AP +F 
Sbjct: 178 SPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFV 237

Query: 265 VLLS-----------KS----LFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL            KS    LF  R  N+ +  S+        F+ FA          +
Sbjct: 238 FLLRAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPFA--------HQM 289

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWC--------VTNVFFK------YKTMFTQ------- 347
            Q + R+FPF+RG+     A NFW         +T +  +      + T F +       
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLRLPYVHTFATKFIKPPLIPQN 349

Query: 348 -SELQFYSLVATVVG--------FFP---------AFMIMIFYPKKFLIPY--------- 380
             E+    L A   G        FF           F++ IFY    ++P          
Sbjct: 350 LKEIN-ERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQILAVLPLLFDPSFKRF 408

Query: 381 --GLAACSMAFFLFSFQVHEKTILVPLLPATLL 411
              L  C +A FLF + VHEK I++ ++P T L
Sbjct: 409 VGSLTLCGLASFLFGWHVHEKAIMLVIVPFTFL 441

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  110 bits (274), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 104/390 (26%), Positives = 161/390 (41%), Gaps = 78/390 (20%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELD-- 147
           DF+  R+W+ IT  LP+ +WY      W LDYPPF AY  + L +    I      LD  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 148 --ASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQ 205
              + GM T     + R TV++SE + ++   ++  K     K       F+ A++I+  
Sbjct: 108 EVGNFGMPT---IIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSIVLS 160

Query: 206 PTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAV 265
           P  +++DH HFQYN  +  + + AI       Y +    F  ++CFK + LY AP FF  
Sbjct: 161 PGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVF 220

Query: 266 LLSKSLF---------FPRLFNI---PRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSI 313
           LL   +          +  L +I    R L +    L    V FAP      +  + Q +
Sbjct: 221 LLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMPQLL 275

Query: 314 HRIFPFARGIFEDKVA-NFWCVTNVFFKY------------------------------- 341
            R+FPF+RG+     A NFW + ++  K                                
Sbjct: 276 ERLFPFSRGLTHAYWAPNFWALYSLLDKVLTFVMLRLPYVHRFIIKFVAPPLIPATIDEI 335

Query: 342 KTMFTQSELQFYSLVATV-VGFFP------AFMIMIFYPKKFLIPY-----------GLA 383
           K   +Q+ +    LV  V     P       F++ +FY    +IP             L 
Sbjct: 336 KQRLSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFAGSLT 395

Query: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFT 413
            C  + FLF + VHEK I++ ++P + L T
Sbjct: 396 LCGFSSFLFGWHVHEKAIMLVIIPFSFLVT 425

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 175/415 (42%), Gaps = 71/415 (17%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  + +  WY+     W LDYPPF AY  + +  +     P +   D  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHL----VPSFVRRDGC 119

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+ SE + ++   +Y        + QS    F+ A++I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  +++DH HFQYN  +  + V +I    +  Y + A+ + +++CFK + LY AP +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 265 VLLSKSLFFPRLFNIPRFLSVAF----ATLASLFVMFAPLY--IFGG-VGNVLQSIHRIF 317
            LL   +     F    +  + F      L  L ++   ++   FG  + ++ Q + R+F
Sbjct: 236 FLLRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRLF 295

Query: 318 PFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVG--------------- 361
           PF+RG+     A NFW + +   K  T+F       ++  A  +                
Sbjct: 296 PFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEEIRQRI 355

Query: 362 --------------FFP---------AFMIMIFYPKKFLIPY-----------GLAACSM 387
                         FF           F++ +FY    +IP             L  C M
Sbjct: 356 AEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSLTLCGM 415

Query: 388 AFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDG 442
           A +LF + VHEK I++ ++P + L        +S    V++    +L+PLL ++ 
Sbjct: 416 ASYLFGWHVHEKAIMLVIIPFSFLVVFDRRLLISFTL-VSSAGYVSLFPLLYENA 469

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 157/384 (40%), Gaps = 72/384 (18%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           DF+  R+W+ IT  LP+++WY      W LDYPPF AY  + L +      P     D  
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQF----VPKSVAEDGC 107

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +   G        + R TV+LSE + Y    V+    +           FV A++I+ 
Sbjct: 108 LDIVKVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVL 163

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P L+++DH HFQYN  + G+ + +I    +  Y + A  F +++CFK + LY AP +F 
Sbjct: 164 SPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFV 223

Query: 265 VLLSKSLF---------FPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHR 315
            LL   +          +  L +I ++ ++    LAS+ +    L     +    Q + R
Sbjct: 224 FLLRAYVLDFSSFKFRSYKDLISIVQWSNL--LKLASVVMGIFSLAFLPFITTWQQLLAR 281

Query: 316 IFPFARGIFEDKVA-NFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFP---------- 364
           +FPF+RG+     A N W V +   K  T+          +++ V+   P          
Sbjct: 282 LFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMPKTAADIHVRI 341

Query: 365 --------------------------AFMIMIFYPKKFLIPY-----------GLAACSM 387
                                      F++ +FY    ++P             L  C  
Sbjct: 342 ESNNSGTRGLVQDVFFVVLPQITPKLTFLLTLFYQILAVVPVLFDPSFKRFVGSLTLCGF 401

Query: 388 AFFLFSFQVHEKTILVPLLPATLL 411
             FLF + VHEK I++ + P + L
Sbjct: 402 VSFLFGWHVHEKAIMLVIFPFSFL 425

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 173/438 (39%), Gaps = 91/438 (20%)

Query: 90  DFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDAS 149
           D E  R+W+ +T  LP+  WY      W LDYPPF AY  ++L +      P     D  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQF----VPAVVRDDGC 148

Query: 150 RGMETDG-----IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILF 204
             +  +G        ++R TV+ +E + ++   V+    +    +      F+ A++I  
Sbjct: 149 LDIVKEGKFGWPTVVFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIAL 204

Query: 205 QPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFA 264
            P  +++DH HFQYN  +  + + +I       Y +    F   +CFK + LY AP +F 
Sbjct: 205 SPGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFT 264

Query: 265 VLL---------------SKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNV 309
            LL                  +F  R FN+ +   +  + LA  FV F P+        +
Sbjct: 265 FLLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV--------L 316

Query: 310 LQSIHRIFPFARGI--------------FEDKVANFW---------CVTNVFF------- 339
            Q I R+FPF+RG+              F D++  F          C T +         
Sbjct: 317 PQLISRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNS 376

Query: 340 --KYKTMFTQSELQFYSLVATVVGFF-------PAFMIMIFYPKKFLIPY---------- 380
             + K     S      LV  ++            F + +FY    +IP           
Sbjct: 377 IEEIKNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFI 436

Query: 381 -GLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLK 439
             L  C  + FLF + VHEK I++ ++P + L  S +   L+    +      +L+PLL 
Sbjct: 437 GCLTLCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLLY 495

Query: 440 KDGLWLQYCVCLVMYNWL 457
           +   +L      V+Y W+
Sbjct: 496 QSSEFL----IKVLYTWI 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,294,051
Number of extensions: 2559814
Number of successful extensions: 7817
Number of sequences better than 10.0: 54
Number of HSP's gapped: 7927
Number of HSP's successfully gapped: 74
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 68 (30.8 bits)