Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F028706.18ON95495450870.0
KAFR0A050506.18ON94894626480.0
TDEL0G045106.18ON96995325640.0
NDAI0I022606.18ON96796025610.0
NCAS0D026506.18ON95094925600.0
YOR005C (DNL4)6.18ON94495125220.0
Suva_15.1806.18ON94894624770.0
Smik_15.1746.18ON94594724630.0
ZYRO0C07854g6.18ON94495924400.0
Kpol_1032.76.18ON96595224260.0
CAGL0E02695g6.18ON94695624170.0
Skud_15.1666.18ON94795023740.0
TPHA0M002606.18ON96696123370.0
TBLA0G010406.18ON97296023110.0
Kwal_56.224146.18ON96395622010.0
KLTH0C11286g6.18ON95195221230.0
ACR008W6.18ON98195320470.0
KLLA0D01089g6.18ON90794920060.0
SAKL0F10912g7.343ON6932732817e-25
NDAI0A019407.343ON7654572747e-24
TPHA0D045707.343ON7364092631e-22
KLLA0D12496g7.343ON7003812631e-22
ACL155W7.343ON6973742585e-22
Suva_4.827.343ON7552682577e-22
YDL164C (CDC9)7.343ON7552682542e-21
TBLA0E020507.343ON7203862513e-21
Smik_4.747.343ON8452732524e-21
Skud_4.937.343ON7552402505e-21
Kwal_56.246167.343ON7154612496e-21
KLTH0H01408g7.343ON7232682424e-20
CAGL0I03410g7.343ON7242682424e-20
Kpol_2001.717.343ON7262782399e-20
TDEL0C020407.343ON7054122391e-19
ZYRO0F11572g7.343ON7312682263e-18
KNAG0C037407.343ON7272682264e-18
KAFR0B008307.343ON7104032237e-18
NCAS0A141107.343ON7532402202e-17
Suva_8.4007.46ON98598910.047
Ecym_21886.228ON461105870.11
YOR346W (REV1)7.46ON98597860.16
KLLA0B02200g6.228ON466105820.37
Skud_15.5137.46ON98698800.77
AFL107W6.228ON463105800.81
NDAI0E039307.46ON102895791.1
TPHA0H028307.46ON92388791.2
CAGL0E05588g7.46ON88766771.7
TPHA0E027706.228ON450105762.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F02870
         (954 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...  1964   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...  1024   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   992   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   991   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   990   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   976   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   958   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   953   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   944   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   939   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   935   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   919   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   904   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   894   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   852   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   822   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   793   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   777   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   112   7e-25
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   110   7e-24
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   105   1e-22
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   105   1e-22
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   103   5e-22
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   103   7e-22
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   102   2e-21
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   101   3e-21
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   101   4e-21
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   100   5e-21
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   100   6e-21
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    98   4e-20
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...    98   4e-20
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...    97   9e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    97   1e-19
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    92   3e-18
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    92   4e-18
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    91   7e-18
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    89   2e-17
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    40   0.047
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    38   0.11 
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    38   0.16 
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    36   0.37 
Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346...    35   0.77 
AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic ho...    35   0.81 
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    35   1.1  
TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.4...    35   1.2  
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    34   1.7  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    34   2.2  

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 1964 bits (5087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/954 (100%), Positives = 954/954 (100%)

Query: 1   MSEKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWR 60
           MSEKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWR
Sbjct: 1   MSEKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWR 60

Query: 61  KTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRN 120
           KTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRN
Sbjct: 61  KTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRN 120

Query: 121 ERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKF 180
           ERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKF
Sbjct: 121 ERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKF 180

Query: 181 CLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSV 240
           CLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSV
Sbjct: 181 CLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSV 240

Query: 241 RLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEI 300
           RLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEI
Sbjct: 241 RLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEI 300

Query: 301 KFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKS 360
           KFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKS
Sbjct: 301 KFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKS 360

Query: 361 SAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420
           SAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS
Sbjct: 361 SAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420

Query: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480
           FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL
Sbjct: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480

Query: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540
           IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF
Sbjct: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540

Query: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSR 600
           CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSR
Sbjct: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSR 600

Query: 601 SLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITT 660
           SLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITT
Sbjct: 601 SLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITT 660

Query: 661 SNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQ 720
           SNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQ
Sbjct: 661 SNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQ 720

Query: 721 LIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLL 780
           LIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLL
Sbjct: 721 LIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLL 780

Query: 781 KLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLD 840
           KLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLD
Sbjct: 781 KLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLD 840

Query: 841 FELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE 900
           FELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE
Sbjct: 841 FELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE 900

Query: 901 DKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954
           DKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS
Sbjct: 901 DKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/946 (53%), Positives = 692/946 (73%), Gaps = 11/946 (1%)

Query: 7   EGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNN 66
           E P NFAPSP F+WLC+ELF K + V  Q R +  K IT+RYYE+++NFV LWR TVG++
Sbjct: 9   EVPRNFAPSPQFKWLCEELFSKLEEVPNQ-RHLTTKRITLRYYEIITNFVNLWRTTVGDD 67

Query: 67  FYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSF 126
            YP LILALPYRDRR YN+KD TLIKAIC YL LPK S TEK+LLNWKQRA R+ +LS  
Sbjct: 68  IYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVS 127

Query: 127 CVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMS 186
           CV E+RKRKS  +P ++  ITLD+LN++LD L+  ++ +G+G + L++SS F +C+E MS
Sbjct: 128 CVNEMRKRKS--EPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMS 185

Query: 187 FIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNED 246
           F+EL+YFFDI+LK R+IG HEHKLLNAWHPDA DY SVVSDL +V  +L+ P++RLR+++
Sbjct: 186 FMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDE 245

Query: 247 LTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRR 306
           L++ IG AFAPHLAK+L+ISY+KI KKL +DF IEEKMDGERIQIHYMDYGN+IKFLSRR
Sbjct: 246 LSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRR 305

Query: 307 GTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFL 366
           G DYTYLYG + STGTIACYLKLN +VKEC+LDGEMVTYD+++ ++LPFG+VKS+A N L
Sbjct: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365

Query: 367 SKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNN 426
           +KE IS   YHPL M FDLV+LNG+SLV+ PLYQRKDYL+ +L      V IV+F RC+N
Sbjct: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425

Query: 427 LESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRD 486
              I KSL  AISVGSEGI+LK  NSRYM+ SRNDSWIKIKP+YL+QFGENMDLI+IGRD
Sbjct: 426 ENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRD 485

Query: 487 PGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASR-IVKFVSFCTIAN 545
             KKD+F C L V +D+ + +++++ +   ++L +++S+ E P+ +R I K VSFC IAN
Sbjct: 486 SAKKDSFYCGLTV-LDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIAN 544

Query: 546 GISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNT 605
           GIS  E+KEI +KTRG W++ ++V PP E ++FGT+ P+EWI+P+ S+VLE+K+RSLDNT
Sbjct: 545 GISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNT 604

Query: 606 ESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYK-LPKVNAGESITTSNKG 664
           ES+ K+++AG TL+GGYCR +R D DW + ++++E  RDR+ K  P  +  +++  S K 
Sbjct: 605 ESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKR 664

Query: 665 RKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724
           RKK+  T +   ++PR  +T     S IF  L F +LSDY D     RI ++ L +L+++
Sbjct: 665 RKKQLLTPLNQNLNPRDIQTT----SKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE 720

Query: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784
            GGK+ +N+++K   +  LRI+C  +  ECN LIKRGYDILSP WV+DC+E+ +++K+E 
Sbjct: 721 NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP 780

Query: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844
           +HCF+VS +LM L+  RVD+Y DS+E+ +S +RL  ++     ++     S  N+  +  
Sbjct: 781 SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSS-KDISPDLLSPANMSLDFE 839

Query: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904
            +P  LF+ R  F+ E         +   + +L+GG+V   I +CN++I P  +     +
Sbjct: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899

Query: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENY 950
            ++ IR  LA  +        +P IVS EW+  SI++N+QVPEE+Y
Sbjct: 900 SMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/953 (51%), Positives = 661/953 (69%), Gaps = 10/953 (1%)

Query: 2   SEKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDR-RINLKPITVRYYEVVSNFVQLWR 60
           SE  E+ P NFAPSPDF WLC+ELFVK + V  Q R  +  KP++VRYYEV+S+F++LWR
Sbjct: 20  SESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWR 79

Query: 61  KTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRN 120
           KTVGNN +P L+L+LPYRDRR YNIKD TL+KAIC YL LPK+S+TEK+LL WK+RA+R 
Sbjct: 80  KTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRG 139

Query: 121 ERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKF 180
            RLS+FCV EIRKRKS P P +R  IT+DKLN  LD L   ++++G G + L+DS  F F
Sbjct: 140 VRLSNFCVEEIRKRKSEPSPGRR--ITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNF 196

Query: 181 CLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSV 240
           CL+NMSFIEL++FFDI+LK R+IGG EHKLLN WHPDA+DY SVVSDL +V  +L++P  
Sbjct: 197 CLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEH 256

Query: 241 RLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEI 300
           RLR +DL++ +G AF P LAK++ ISYEKI  KL +DF IEEKMDGERIQ+HYMDYG +I
Sbjct: 257 RLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKI 316

Query: 301 KFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKS 360
           +FLSRRG DYT LYG +  +GT+A YL  + NV++C+LDGEM+T+D ++ ++LPFG+VKS
Sbjct: 317 RFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKS 376

Query: 361 SAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420
           SA+  LS E I +  + P+ M  DLVYLNG SL+ LPLYQRK++L+++L  C   V+I+ 
Sbjct: 377 SARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILP 436

Query: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480
           + RC+   +I KSL  +IS+GSEGI+LK   +RY + +RND WIK+KP+YL+QFGEN+DL
Sbjct: 437 YVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDL 496

Query: 481 IIIGRDPGKKDAFMCALGV-TIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVK-FV 538
           +IIGR PGKKD+ MC L V   ++    +  + E+  ++LD+E  E +     +I+K F+
Sbjct: 497 VIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFI 556

Query: 539 SFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVK 598
           SFC IANGIS  EFKEID+KTRG W + DQ  P ++ L+FG+K P EWIDPK S++LEVK
Sbjct: 557 SFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVK 616

Query: 599 SRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESI 658
           +RSLDNTES+ KK+ AG TL GGYCR +R DKDWT CY+ SE  ++R +K      G S 
Sbjct: 617 ARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHK-SSTGVG-SF 674

Query: 659 TTSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTL 718
                 + K     I        K+    + ++IF+ L F VLSDY+D     RI ++  
Sbjct: 675 NKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEF 734

Query: 719 TQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESAR 778
             LI+   GK++ N+++K   E   RII   +  EC ALI+RGYDILSP W+LDCI +  
Sbjct: 735 DDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRM 794

Query: 779 LLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGEN 838
           ++KLE  HCFNVS ELM + + RVDEY DSF N I+  +LD LID ++           N
Sbjct: 795 VVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREAN 854

Query: 839 LDFELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTD 898
              EL  +P  LF  R+V+I     +      ++S+ KL GG +   I  CNLII+PN +
Sbjct: 855 --SELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNEN 912

Query: 899 DEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYS 951
                Q L ++R  +   + + +ST  IP IV+ +W+ +SI+EN QVPEE+++
Sbjct: 913 QRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFT 965

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/960 (51%), Positives = 667/960 (69%), Gaps = 26/960 (2%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLV----ATQDRRINLKPITVRYYEVVSNFVQLWRKTVG 64
           P NFAPSP F+WLCDELFVK + +     ++  +   KPI V+YYEV+ +F+ LWRKTVG
Sbjct: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78

Query: 65  NNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLS 124
           N+ YP LIL LPYRDRR YN++D TLIKAIC YL LPK S TEK+LL+WKQRA R+ RLS
Sbjct: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138

Query: 125 SFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQ-GSRTLADSSHFKFCLE 183
           SF V+EI+KRKS P    R+ IT+DKLN  LD L+  ++S+G  G R L+DS  F FCLE
Sbjct: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198

Query: 184 NMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLR 243
           NM+F+EL++FFDI+LK R+IGGHEHK LN WHPDA DY SVVSDL +V  KL++P+V L+
Sbjct: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258

Query: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303
           N+DLT+ +GS FAP  AK+L+ISYEKI  KL  DF IEEKMDGERIQ+HY DYGN++ FL
Sbjct: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318

Query: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363
           SRRGTDYTYLYG     GT++ YL L+ NV+ C+LDGEMVT+D+E+  +LPFGLVKSSA+
Sbjct: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378

Query: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423
           + +++E ++N  Y PL M FDLVYLNG SLV++PLYQRK YL KI T     V+++   R
Sbjct: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438

Query: 424 CNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483
           C++  SI  +L  AIS+GSEG++LK  NSRY VASRND WIK+KP+YL+QFGENMDLI+I
Sbjct: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

Query: 484 GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDL-----DTEDSEP-ETPKASRIVKF 537
           G+DPGKKD+ MC L V  +D         E VNLD      + ED E  E  +   I +F
Sbjct: 499 GKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558

Query: 538 VSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEV 597
           VSFC+IANGIS  EFK I + T+G W++ D++ PPS+ L+FG++ P EWIDPK+S+V+EV
Sbjct: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618

Query: 598 KSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKL-PKVNAGE 656
           K+RSL+N E   KK++ G+TL+GGYCR +R DKDW TCYT+SE  R +++KL     A  
Sbjct: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678

Query: 657 SITTSNKGRKKRNTTSILGVISPRKKRTPEG-EHSDIFQNLHFCVLSDYLDPYTGNRIDR 715
             T +    K+R    I        ++TP   + S IF  L+F V+SD +D  TG+R+ R
Sbjct: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDA-TGSRVSR 737

Query: 716 NTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIE 775
             L   I++ GG +++NV+AK   E   RI+C  +  EC +LI RGYDI+ P WVLDCI+
Sbjct: 738 EELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCIK 797

Query: 776 SARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFS 835
              LLKLE  +CFNVS+ELM+++  RVD + DSFE +IS     RLI+ ++ ++ +   S
Sbjct: 798 DDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPPS 857

Query: 836 GENLDFELRGLPPL-LFFDRSVFIAETKLSDR-IYAKISSETKLFGGQVTHTIEDCNLII 893
              + +++    PL LF+ R++ +   ++ D+ ++ K+  + +L+GG+ T  +  CNL++
Sbjct: 858 ---IQYDMVDTVPLFLFYGRTILL---RIKDKALFTKLKVQIRLYGGKTTGDLASCNLVV 911

Query: 894 IPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           I     +++I V + +R  L  +    +    +P IV+ EW+  SI E  QVPEE++ V+
Sbjct: 912 I----QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/949 (52%), Positives = 665/949 (70%), Gaps = 19/949 (2%)

Query: 9   PTNFAPSPDFQWLCDELFVKF-DLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNF 67
           P NF+PSP FQWLCDELFVK  D+ + +D +   KP+TVRYYEV+++F+ LWRKTVGN+ 
Sbjct: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76

Query: 68  YPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFC 127
           +P LIL LPYRDRR +NI+D TLIKAIC YL LP+ S TEK+LL+WK RA +  +LS FC
Sbjct: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136

Query: 128 VAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSF 187
           V EI+KRKS  +P  +  IT+D+LN  LD LA  ++S+G+G + LADS  FKFCLENMSF
Sbjct: 137 VNEIKKRKS--EPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSF 194

Query: 188 IELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDL 247
           IEL++FFDILLK R+IGG EHK LNAWHPDA DY SVVSDL +VT +L++P +RL+N DL
Sbjct: 195 IELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDL 254

Query: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307
            +  G AFAP LAK+L+ISYEKI  KL +DF IEEKMDGERIQ+HY DYG ++KF SRRG
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367
           TDYTYLYG     G I  +LKLN++VK+CILDGEM+TYD+ + MILPFGLVKSSA++ L+
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427
           K+ I N  Y PLFM FDL+++NGTSL ++PL  RK+YL+ I T     ++++S     N 
Sbjct: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434

Query: 428 ESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDP 487
           +SI KSL  AIS+GSEGI+LK+ +SRY VASRND WIK+KP+YL+QFGENMDLI+IGRDP
Sbjct: 435 DSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDP 494

Query: 488 GKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGI 547
           GKKD+ MC L V  +D +  + +  ++  + LD ++  P   +   I KFVSFC IANG+
Sbjct: 495 GKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAP-VEQERTIHKFVSFCVIANGL 553

Query: 548 SNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTES 607
           S  EFK+ID+KTRGLW R D++ PP   LQFGT+ P+EWIDPK+S+V+EVK+RS+D  ES
Sbjct: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613

Query: 608 NVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKK 667
           N +K+  G TL+GGYCR +R DKDW TCYT+SEF R +  K  + N  + +    K +KK
Sbjct: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVK-SRRNGSDQVIHGVKRQKK 672

Query: 668 RNTTSILGVISPRKKRTPEG---EHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724
                IL      +    EG   +++  F+NL+F V+SD  D   G RI++  + + I +
Sbjct: 673 NRRKYILD-----QSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQE 727

Query: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784
            GG +I+N+++K+     LRII      EC+ALI+RGYD+++P W++DC++S  LLKLE 
Sbjct: 728 GGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEP 787

Query: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844
            +CFNVS EL +L+  RVD + DS+E  I+  +L  L++  L+ +          D EL 
Sbjct: 788 KYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYADEELI 847

Query: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904
            +P  LF DR +    T+   +  + +  + KL+GG++T  I  CNLII+PN +     Q
Sbjct: 848 KIPLFLFQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQ----Q 901

Query: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           +LQ+ R  L   I        IP IV+  W+ +SI+EN QVPEE+Y V+
Sbjct: 902 LLQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/951 (51%), Positives = 654/951 (68%), Gaps = 23/951 (2%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68
           P NFAPSPDF+WLC+ELFVK   V         K  + +YYE++SNFV++WRKTVGNN Y
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIY 70

Query: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128
           P L+LALPYRDRR YNIKD  LI+ IC YL LPK S+TE++L +WKQR  +   LSS  V
Sbjct: 71  PALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLV 130

Query: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188
            EI KR++ P     +AIT+D +N  LD L+  + + G+G ++L  S  F  C+ENMSF+
Sbjct: 131 EEIAKRRAEPSS---KAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFV 187

Query: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248
           ELKYFFDI+LK R+IGG EHKLLN WHPDA DY SV+SDL  VT KLY+P VRL+++DL+
Sbjct: 188 ELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLS 247

Query: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308
           +K+G AFAP LAK++N+SYEKI + L  DF +EEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 248 IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI 307

Query: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368
           DYTYLYG   S+GTI+ +L+  ++VKEC+LDGEMVT+D ++++ILPFGLVK SAK  LS 
Sbjct: 308 DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSF 367

Query: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428
            SI+N  +HPL+M FDL+YLNGTSL  LPL+QRK YL+ IL+     V+IV  +RC  +E
Sbjct: 368 NSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427

Query: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488
           SI KSL  AIS+GSEG++LK  NS Y VASRN++WIK+KP+YL++FGEN+DLI+IGRD G
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487

Query: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548
           KKD+FM  L + +D+ + +  Q + +  +D  +++   +  +  R+ K +SFC+IANGIS
Sbjct: 488 KKDSFMLGL-LVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSR-RRVKKILSFCSIANGIS 545

Query: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608
             EFKEID+KTRG W+R  +V PP+  L+FG+K P EWIDP ES+VLE+KSRSLDNTE+N
Sbjct: 546 QEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETN 605

Query: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKG--RK 666
           ++KY    TL+GGYC+ +RYDK+WT CYT+++    R     K N       S  G  RK
Sbjct: 606 MQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTV---KSNPSYQAERSQLGLIRK 662

Query: 667 KRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYG 726
           KR    I       +K+ P    S+IF  L F VLSDY+   TG RI R  L + I+++G
Sbjct: 663 KRKRVLISDSFHQNRKQLP---ISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719

Query: 727 GKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNH 786
           GK+IYNV+ K    G +R+I      EC ALI RGYDIL P+WVLDCI   RL+ +E N+
Sbjct: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779

Query: 787 CFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGL 846
           CFNVS+++  ++  RVD   DSFEN+IS T+L  L    L   P G      +D E+R  
Sbjct: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELE---IDSEVRRF 836

Query: 847 PPLLFFDRSVFIAETKLS---DRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKI 903
           P  LF +R  ++   K+S   D I  KI    KLFGG++T     CNLIIIP TD   + 
Sbjct: 837 PLFLFSNRIAYVPRRKISTEDDIIEMKI----KLFGGKITDQQSLCNLIIIPYTDPILRK 892

Query: 904 QVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954
             + ++  K+   I+  ++  +I  +V+ EW+  SI EN QVPEE++ V++
Sbjct: 893 DCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVN 943

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/946 (50%), Positives = 645/946 (68%), Gaps = 13/946 (1%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68
           P NFAPSPDF+WLC+ELF K + V         K ++ RYYE++SNF +LWRKTVGNN Y
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIY 70

Query: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128
           P LILALPYRDRR YNIKD  LI+ +C YL LPK S TE++L +WKQR  +   LSS  V
Sbjct: 71  PALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLV 130

Query: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188
            EI KR++ P    R++IT+D +N  LD+L+   ++ G+G + L  S  F  CLENM+F+
Sbjct: 131 EEISKRRTEP---TRKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFV 187

Query: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248
           ELK+FFDILLK R+IGG EHKLLN WHPDA DY SVVSDL  VT KLY+P +RL+N+DL+
Sbjct: 188 ELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLS 247

Query: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308
           +K+G AFAP LAK++N+SYEKI   L +DF +EEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 248 IKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGI 307

Query: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368
           DYTYLYG +  +GTI+ YLK +++VKEC+LDGEMVT+D  +++ILPFGLVK SAK  LS 
Sbjct: 308 DYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSF 367

Query: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428
             I+N  +HPL+M FDL+YLNGTSL  LPLYQRK+YLS IL      V+IV ++RC + E
Sbjct: 368 NDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAE 427

Query: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488
           S+ KSL  AIS+GSEG++LK  +S Y VASRN++WIK+KP+YL++FGEN+DLIIIGRD G
Sbjct: 428 SVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548
           KKD+FM  L + +D+ +     QE    +  D+      T    R+ K +SFC+IANGIS
Sbjct: 488 KKDSFMLGL-LVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGIS 546

Query: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608
             EFKEID+KTRG W++   + PP   L+FG+K P EWI+P ES+VLE+KSRSLDNTE+N
Sbjct: 547 QEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETN 606

Query: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKKR 668
           ++KY    TL+GGYCR +RYDKDWT CYT+ E   +R+ K    +  E++      +K++
Sbjct: 607 MQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPKKRK 666

Query: 669 NTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGK 728
                  V  P ++   +   S +F  L F VLSDY++  TG RI R+ L  +I+ +GGK
Sbjct: 667 RAL----VSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGK 722

Query: 729 VIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHCF 788
           +I+NV+ K    G +R+I      EC ALI RGYDIL P W++DC    +LL +E ++CF
Sbjct: 723 LIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCF 782

Query: 789 NVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLPP 848
           +VS +L  ++  RVD + DSFEN+IS ++L  L       +   S    +  FEL+ +P 
Sbjct: 783 SVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLL---STRQADKSFELQIIPL 839

Query: 849 LLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQVLQK 908
            LF +R V+I  +K+  +    +  + +LFGG++T      NLIIIP  D   +   L++
Sbjct: 840 FLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEE 899

Query: 909 IRGKLASMIQKLNS--TERIPPIVSEEWLYQSIKENIQVPEENYSV 952
           +  ++   ++  NS    RIP IV+ EW+  SI EN QVPEE++ V
Sbjct: 900 VHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/947 (50%), Positives = 649/947 (68%), Gaps = 14/947 (1%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68
           P NFAPSPDF+WLC+ELF K D V  +      K  + +YYEV+SNFV++WRKTVGNN Y
Sbjct: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIY 70

Query: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128
           P LILALPYRDRR YNIKD  LI+ IC YL LPK S+TE +L +WKQR  + + LSS  V
Sbjct: 71  PALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLV 130

Query: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188
            EI KR+S P+    +AIT+D +NS LD+L+  +S+ G+G + L  SS F  CLE+MSF+
Sbjct: 131 EEIAKRRSEPNG---KAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFV 187

Query: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248
           ELKYFFDILLK R+IGG EHK L+ WHPDA DY SVVSDL  V  KLY+P VRL+N+DLT
Sbjct: 188 ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT 247

Query: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308
           +K+G AFAP LAK++N+ YEKI + L +DF +EEKMDGERIQ+HYM+YG  ++F SRRG 
Sbjct: 248 IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI 307

Query: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368
           DYTYLYG   S+GTI+ +L   +NV+EC+LDGEMVT+D  +++ILPFGLVK SAK+ LS 
Sbjct: 308 DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSF 367

Query: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428
            SI+N  +HPL++ FDL+YLNGTSL  LPL+QRK+YL  ILT     V++V  +RC N+E
Sbjct: 368 NSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427

Query: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488
           SI KSL  AIS+GSEG++LK  NS Y VASRN++WIK+KP+YL++FGEN+DL+IIGRDPG
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487

Query: 489 KKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGIS 548
           KKD+FM  LG+ + + +    + +E  +   +   +E       ++ K +SFC++ANGIS
Sbjct: 488 KKDSFM--LGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545

Query: 549 NAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTESN 608
             EFKEID+KTRG W++  +V PP+   +FG+K P EWI+P ES+VLE+KSRSLDNTE+N
Sbjct: 546 QEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETN 605

Query: 609 VKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKL-PKVNAGESITTSNKGRKK 667
           ++KY    TL+GGYC+ +R+DKDWT C+T++E    R  +  P   A +S       RKK
Sbjct: 606 MQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKS--HLKLVRKK 663

Query: 668 RNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGG 727
           R           + ++ P    S IF  L+F VLSDY+   +  RI R  L   I+ +GG
Sbjct: 664 RREVLTSNTFDQKTEQIPT---SIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGG 720

Query: 728 KVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHC 787
           ++IYN++ K    G +R+I      EC ALI RGYDIL PSWV+DC+   +L+ +E  +C
Sbjct: 721 RLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYC 780

Query: 788 FNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLP 847
           FNVS+++  ++  RVD   DSFEN+IS T+L  L     HN+P         D E++  P
Sbjct: 781 FNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQ-HNLPPP--EEVERDAEVQVFP 837

Query: 848 PLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQVLQ 907
             LF +R V+I   K+  +    +  + +LFGG++T     CNL+IIP  D   +   ++
Sbjct: 838 LFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIK 897

Query: 908 KIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954
           ++  ++   ++ L++  +IP IV+ EW+  SI  N QVPEE++ V++
Sbjct: 898 EVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVVT 944

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/959 (50%), Positives = 656/959 (68%), Gaps = 27/959 (2%)

Query: 1   MSEKVEE--GPTNFAPSPDFQWLCDELFVKFDLVATQDR-RINLKPITVRYYEVVSNFVQ 57
           MS K ++   P NFAPSPDF+WLCDELFVK D V  Q R     K +TV+Y+E++S FV+
Sbjct: 1   MSTKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVK 60

Query: 58  LWRKTVGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRA 117
           LWRKTVG+N YP LIL LPYRDRR +NIKD TLIKAIC +L LP  S TEK+LL WK+RA
Sbjct: 61  LWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRA 120

Query: 118 SRNERLSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSH 177
            R  +LS FCV EIR+R+S P   +R  IT+DKLN  LD LA  ++++G+G ++LADSS 
Sbjct: 121 GRGIKLSDFCVEEIRRRRSEPLNGER--ITIDKLNECLDQLAEERNTKGRGFKSLADSSV 178

Query: 178 FKFCLENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYE 237
           FK+CLENMSF E+KY+FDI+LK R+IGG EHK LN WHPDA DY SVVSDL +V  KL++
Sbjct: 179 FKYCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWD 238

Query: 238 PSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYG 297
           PS RL+N+DL + +G  FAP LAKRL ISY+K+  +L SDF IEEKMDGERIQ+HYMDYG
Sbjct: 239 PSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYG 298

Query: 298 NEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGL 357
            ++K+ SRRG DYTYLYG D  TGT+A YL+L+  V+EC+LDGEM+++D E+  +LPFGL
Sbjct: 299 RKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGL 358

Query: 358 VKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVD 417
           VKSSA++ L+ E I    Y PL+M  D +YLNG SL+++PL  RK YLS IL  C   V+
Sbjct: 359 VKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVE 418

Query: 418 IVSFARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGEN 477
           I+    C +  SI  SL  AI +GSEGIILK   S+Y + +R D+WIKIKP+YL+QFGEN
Sbjct: 419 IIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGEN 478

Query: 478 MDLIIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKF 537
           +DL++IGRDPGKKD+ MC L V   D +P     ++ VNLD      E E P+ + + KF
Sbjct: 479 LDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLD----SEEEEEPRKA-VKKF 533

Query: 538 VSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEV 597
           +SFCTIANGIS  EFK+I++KT G W+  +  KPP + L+FG+K P EWI P++S+VLEV
Sbjct: 534 ISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEV 592

Query: 598 KSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLP--KVNAG 655
           K+RSLDNTES+ +K++ G TL GGYCR +R DK+WT CYT+ E  ++R+ K+P  + +  
Sbjct: 593 KARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNN 652

Query: 656 ESITTSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDR 715
           +    S K R+ R  + +   +S       E + S IF  L F V+SDY+      RI +
Sbjct: 653 QKPMKSKKIRRPRIVSRLNQTLSC----DDEAKTSSIFDGLIFYVISDYMASQDSERISK 708

Query: 716 NTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIE 775
             L  LI   GGK+ +NV++    +G LRII   + +EC ALI+RGYDILSP W++DC+ 
Sbjct: 709 EQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVN 768

Query: 776 SARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFS 835
           +  L+ +E  HCF+VS+++ +++ TRVD + DS++ EI+    DRL D+         FS
Sbjct: 769 TGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITE---DRLRDILTSKEFDSDFS 825

Query: 836 GENLDF--ELRGLPPLLFFDRSVFIAE--TKLSDRIYAKISSETKLFGGQVTHTIEDCNL 891
             +LD   ++  +P  LF  R VFI E  + L  ++   +  + +L+GGQ+T  +  CNL
Sbjct: 826 TGSLDVISDVEDIPLFLFSRRIVFIPEGFSYLDTQL---LKHKVRLYGGQLTDNVNQCNL 882

Query: 892 IIIPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENY 950
           II+P+     + +++  +R  L++          IP IV   W+ +SI+ENIQVPEE++
Sbjct: 883 IIVPDGKINLRGRIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/952 (50%), Positives = 642/952 (67%), Gaps = 20/952 (2%)

Query: 7   EGPTNFAPSPDFQWLCDELFVKFDLVATQDRRIN-LKPITVRYYEVVSNFVQLWRKTVGN 65
           E P NF+PSPDF+WLCDELFVK D +  + + +N  KP  + YY++++NF+ +WR+TVGN
Sbjct: 29  EEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGN 88

Query: 66  NFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSS 125
           + YP LIL +PYRDRR YNIK+  LI+ +C YL LPK S TE++L+ WK RA RN RLS+
Sbjct: 89  DIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLST 148

Query: 126 FCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENM 185
           FCV EI+KRK   +P ++  IT+DKLN  LD+L   +  +G  S+ +++S  FKFC ENM
Sbjct: 149 FCVEEIKKRKG--EPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENM 206

Query: 186 SFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNE 245
           +++ELKYFFDILLK +I+GG EHK LN WHPDA DY SVVSDL  V+ KL+ P  RL+ +
Sbjct: 207 TYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYD 266

Query: 246 DLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSR 305
           DLT+ I  AF P  AKRL  SY+ I ++L +DF IEEKMDGERIQ+HYM+YG ++KFLSR
Sbjct: 267 DLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSR 326

Query: 306 RGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNF 365
           RG DY+YLYG + + G I  YL  +++VKECILDGEMVTYD  K  ILPFGLVKSSA   
Sbjct: 327 RGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQS 386

Query: 366 LSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCN 425
           LS   I    YHPL+MAFDLVYLNG+SL  LPL+QRK+YL K+L  C  FV+I+    CN
Sbjct: 387 LSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCN 446

Query: 426 NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR 485
           +   I  SL  AI +GSEGIILK+ +S+Y+VA R+D WIKIKP+YL+QFGENMDLI+IGR
Sbjct: 447 DSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR 506

Query: 486 DPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIAN 545
           DPGKKD+ MC L +T D+      + EE  +LD +  D+     K  +  K +SFC IAN
Sbjct: 507 DPGKKDSLMCGLILTGDN------EPEEITSLDSNPTDTAESFLKPDK-RKIISFCNIAN 559

Query: 546 GISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNT 605
           GIS  EF++ID+ T G W +FD   PP +  +FGTK P+EWI P+ S+VLE+K+RSL+  
Sbjct: 560 GISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETN 619

Query: 606 ESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESIT-TSNKG 664
           ES   KY  G TLFGGYCR +RYDKDW +C+T +EF   R  K   VN  ++      K 
Sbjct: 620 ESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKK 679

Query: 665 RKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724
           R K+   + L  I    K  P+ E + IF+ LHF V+SDY+D   G+R+ ++ L  L+++
Sbjct: 680 RPKKRMFNSLTEIFENTKDAPD-ESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLE 738

Query: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784
           + GK+++N +++      LRII   +  E  +LI+RGYDI+ P W+LDCI + +L++L  
Sbjct: 739 HNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLP 798

Query: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGS---FSGENLDF 841
           +HCFNVS  LME++ TRVD Y DS+E  ++    + LI+  +    S       GEN   
Sbjct: 799 SHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGEN--- 855

Query: 842 ELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDED 901
            L+ +P LLF +R  FI ET  S  IY ++ S+ +L+GG++ + I DCN+I+  NT  E+
Sbjct: 856 HLK-IPILLFCNRRFFIPETLPSTPIY-ELKSKVELYGGKLVNKISDCNVIVFTNTHTEN 913

Query: 902 KIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           + +V++KIR  L  +         +P IV   W+   I E +QVPEE+Y  +
Sbjct: 914 RKEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/956 (50%), Positives = 645/956 (67%), Gaps = 36/956 (3%)

Query: 5   VEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINL--KPITVRYYEVVSNFVQLWRKT 62
            EE   NFAPSPDF WLC++LF K D V  + R  NL  KP+T RYYEV+SNF  LWR T
Sbjct: 18  TEEQAVNFAPSPDFLWLCEQLFAKIDHVQFE-RANNLLTKPVTARYYEVISNFTTLWRTT 76

Query: 63  VGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNER 122
           VGNN YP L L LPYRDRR +NIKD TLIKAIC +L LPK SSTEKKL+NWKQ A R+ R
Sbjct: 77  VGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVR 136

Query: 123 LSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCL 182
           LS FCV EI+KR+S P   + + IT+D LN  LD LA  ++ +G+  + LA+S     CL
Sbjct: 137 LSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCL 196

Query: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242
            +M+F+E++YFFDILLK R +GGHEHKLLN WHPDA DY SVVSDL +V K+L++PS RL
Sbjct: 197 TSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRL 256

Query: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302
            N+DL + IG AFAP LA +L++SY+KI +KLG DF IEEKMDGERIQ+HY ++G++IKF
Sbjct: 257 GNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKF 316

Query: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362
            SRR TDYTYLYG +  TGT+A ++ LN+NVK+C+LD E+VT+D   +++LPFG+VKSSA
Sbjct: 317 YSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA 376

Query: 363 KNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422
           KN LS++ I    +HPL M FD++YLNG +LVDLP Y+R++YL +ILT     ++I+   
Sbjct: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436

Query: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482
           R N+ + I KSL  A+SVGSEGIILK+ +SRY++ASR+D WIKIKP+YL+QFGENMDL++
Sbjct: 437 RANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVL 496

Query: 483 IGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCT 542
           +GRDP KKD+ M  L           L  EE +       +S+     + R   FVS C 
Sbjct: 497 MGRDPSKKDSLMLGL-----------LDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCI 545

Query: 543 IANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSL 602
           IANGISN E+KEID+KT+GLW   +++ PP EY++FG+K P +WIDPK+SL+LE+K+RSL
Sbjct: 546 IANGISNEEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSL 604

Query: 603 DNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSN 662
           DNT S+ +K+ AG TLFGGYCR +R DK+W TCYT+ EFER +     +   G S     
Sbjct: 605 DNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWR-KRGSSKPQKV 663

Query: 663 KGRKKRNTTSILGVISPRKKRTPEGEH-SDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQL 721
             +K+R   +I+  ++   +   E EH SDIF  ++F VLSDY D     RI ++ + ++
Sbjct: 664 ISKKRR--YNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKV 721

Query: 722 IIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLK 781
           I+  GG+++ NV+ +      LRII     +ECN+LI RGYDI+SP WV DC+ S +++K
Sbjct: 722 IVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMK 781

Query: 782 LERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRL----IDVHLHNMPSGSFSGE 837
           LE +HCFN SK+LM+ +  R+D+Y D +E +I+      L    I       P   F   
Sbjct: 782 LEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF--- 838

Query: 838 NLDFELRGLPPLLFFDRSVFIAETKLSD-RIYAKISSETKLFGGQVTHTIEDCNLIIIPN 896
             D  L  +P  LF  R VF+    LSD     K S     +GG+VT+ +   NL+I+  
Sbjct: 839 --DNSLMDVPHFLFHGRIVFL----LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVG 892

Query: 897 TDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSV 952
              + +I     IR +++S + K +   RIP +VSE WLY  IK+N QV E+NY +
Sbjct: 893 AVTQRRI---NDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNYRL 945

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/950 (49%), Positives = 634/950 (66%), Gaps = 19/950 (2%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68
           P NFAPSPDF+WLC+ELFV+ D V         K  + +YYE++SNFV+ WRK VGNN Y
Sbjct: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIY 70

Query: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128
           P L+LALPYRDRR YNIKD  LI+ IC YL LP+ S TE++L +WKQR SR   LSS  V
Sbjct: 71  PALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLV 130

Query: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFI 188
            EI KR+  P+P+ + +IT+D +N  LD+L+  +S  G+G + L +S  F  CLE+MSF+
Sbjct: 131 EEIAKRR--PEPNGK-SITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFV 187

Query: 189 ELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLT 248
           ELKYFFDI+LK R+IGG EH+ LN WHPDA DY SVVSDL  VT KLY+P VRL+N+DL+
Sbjct: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247

Query: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308
           +K+G AFAP LAK++++ YEKI + L +DF IEEKMDGERIQ+HYM+YG  IKF SRRG 
Sbjct: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307

Query: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368
           DYTYLYG   S+GTI+ YLKL   VKEC+LDGEMVT+D  +++ILPFGLVK SAK  LS 
Sbjct: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367

Query: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428
             I+N  + PL+M FDL+YLN  SL  LPL+QRK YLS ILT     V+IV   RC +++
Sbjct: 368 SDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427

Query: 429 SITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPG 488
           S+  SL  AIS+GSEG++LK  NS Y +ASRN +WIK+KP+YL++FGEN+DLIIIGRD G
Sbjct: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 489 KKDAFMCALGVTIDDPQPRVLQQE----ENVNLDLDTEDSEPETPKASRIVKFVSFCTIA 544
           KKD+FM  L + ID+ +     QE    E VN   D++  +       ++ K +SFC++A
Sbjct: 488 KKDSFMLGL-LVIDEREMEERDQELSSSEVVN---DSKIEQDVINSKKKVKKVLSFCSVA 543

Query: 545 NGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDN 604
           NGIS+ EFKEI+++TRG W+R     PPS  LQFG++ P EWI+P +S+VLE+KSRSLDN
Sbjct: 544 NGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRSLDN 602

Query: 605 TESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKG 664
           TE+++++Y    TL+GGYCR +RYDKDWT CYT+++   DR  K       E+       
Sbjct: 603 TETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAH 662

Query: 665 RKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724
           +K++       +  P  +   +   S IF  L F VLSDY+   TG RI R  L   I+ 
Sbjct: 663 KKRKRAL----ISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVK 718

Query: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784
           +GGK+I+NV+ K    G +R+I     +EC  LI RGYDI+ PSWV+DCI   +L+ +E 
Sbjct: 719 HGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEP 778

Query: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844
           ++CF+VS +L E++  RVD   DSFEN IS  +L  L           S     +D E +
Sbjct: 779 SYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFK---SRQDLSSIGEIGIDSEAQ 835

Query: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904
            +P  LF +R V+I  TK   R    +  + +LFGG++T     CNLIIIP  D   +  
Sbjct: 836 VIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRRKD 895

Query: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVLS 954
            ++K+  ++   ++  ++  ++  IVS  W+  SI EN QVPEE++ V++
Sbjct: 896 CIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVVN 945

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/961 (47%), Positives = 642/961 (66%), Gaps = 21/961 (2%)

Query: 6   EEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGN 65
           E  P NF+PSPDF+WLC+ELFVK D V  + + ++ +P  ++Y  V++NF+ LWR TVGN
Sbjct: 13  EREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVGN 72

Query: 66  NFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSS 125
           + YP L L LPYRDRR Y I++ TLI+ +C YL L K S TE++L  WKQ+A R+  LSS
Sbjct: 73  DIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSS 132

Query: 126 FCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSS----RGQGSRTLADSSHFKFC 181
           FC+ EI+KR S  +P  ++ IT+DKLNSILD L+  +SS     G   + L+     K+C
Sbjct: 133 FCIQEIKKRLS--EPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYC 190

Query: 182 LENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVR 241
            ENMSFIEL+YFFDIL+K R+IGG EHK LNAWHPDA DY SVVS+L+ VT+KL+ P+ R
Sbjct: 191 FENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFR 250

Query: 242 LRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIK 301
           L ++DLT+ + +AF P LAK++N+SYE + +++ + F+IEEKMDGERIQIHYMDYG++IK
Sbjct: 251 LNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIK 310

Query: 302 FLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSS 361
           + SRRG DYTYLYG D ST TI+ YL+LNE+VKECILDGEMV+YD+ +  ILPFG+VKS 
Sbjct: 311 YFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSG 370

Query: 362 AKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSF 421
           A N L  + + N    PLF+ FD+++LNG+ L +LPLYQRK+YLS ILT     ++I+ F
Sbjct: 371 AANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKF 430

Query: 422 ARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLI 481
           +  ++ ESI  +L AAISVGSEGI+LKK +S Y V  RN+ WIK+KP+YL+QFGEN+DLI
Sbjct: 431 SIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLI 490

Query: 482 IIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETP-----KASRIVK 536
           +IGRDPGKKD+ MC + V  ++     + QEE + L  D +DS+   P     +  RI K
Sbjct: 491 VIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITK 550

Query: 537 FVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLE 596
           F+SFC IANGISN EFKEID+KT G W++F    PP++YL+FGT+ PVEWI+P +S+VLE
Sbjct: 551 FISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLE 610

Query: 597 VKSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGE 656
           VK+RSL+N E+   K++ G TL+G YCR +R DKD+  CYT S+          K ++ E
Sbjct: 611 VKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATN---KKRSSSE 667

Query: 657 SITTSNKGRKKRNTTSILGVISP--RKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRID 714
                +  +KKR+ TS + +++     +    G  S IF  L F V+SDY+D  +  R+ 
Sbjct: 668 LYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLR 727

Query: 715 RNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCI 774
            + L  +I   GG++I+N++++   E  +RI+      ECN LIKRGYDI+ P W+LDCI
Sbjct: 728 IDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCI 787

Query: 775 ESARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSF 834
            + +LL  E +HCFNVS+ L  +S  RVD   DS++  I+   L+ LI       P    
Sbjct: 788 ANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLIS---SKTPKEQL 844

Query: 835 SGENLDF--ELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLI 892
               L F  ++  +P  LF ++  +  +   S+++  + +   KL+GG   + I DCN+I
Sbjct: 845 YSNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVI 904

Query: 893 IIPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSV 952
           II +   +   + +  IR +L+      N+   IP IVS +W+ +SI +  QV EE++ +
Sbjct: 905 IIGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPI 964

Query: 953 L 953
           +
Sbjct: 965 I 965

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/960 (46%), Positives = 643/960 (66%), Gaps = 25/960 (2%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRR-----INLKPITVRYYEVVSNFVQLWRKTV 63
           P NFAPSPDF+WLCDELFVK D +  Q +      I+ KPI+ RY++ +++F++LWR T+
Sbjct: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82

Query: 64  GNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERL 123
           G++ +P L L LPYRDRR YNIKD+TLI+AIC YL LPK S  E++L+ WK +A R E L
Sbjct: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142

Query: 124 SSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRT-LADSSHFKFCL 182
           ++FC+ EI KRK+ P  ++ + I++DKLN ILDDL   + +     R+ L     FKFCL
Sbjct: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202

Query: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242
           ENM+FIELKYFFDI++K +I+G  E+  L  WHPD+ +Y SVVSDL +++ KL+ PS+++
Sbjct: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262

Query: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302
            N DL++K+G  FAP LAKRL +SY+ I  +L +DF IEEKMDGERIQ+HYM+YG  +KF
Sbjct: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322

Query: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362
            SR GTDYTYLYG D S GTIA +L+L++NVKEC+LDGEMVT+D   + +LPFGLVKSSA
Sbjct: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382

Query: 363 KNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422
            + L+K+ I N S+HPLFM FD++YLNG+SL+DLPL++RK++L+ +LT    +V+I+S  
Sbjct: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442

Query: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482
           RC +   I K L AAISVGSEGI+LK+  S+Y+  +R+++WIK+KP+YL++FGENMDLI+
Sbjct: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502

Query: 483 IGRDPGKKDAFMCALGVTIDDPQ-PRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFC 541
           IGRD GKKD  +C + VT +  +    +++E  + +  D+ D + +T  +  I K +SFC
Sbjct: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISFC 562

Query: 542 TIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRS 601
           TIANG+S  E KEI++ TRG W+ ++   PP + L+FGTKKPVEWI P++S+VLE+K+RS
Sbjct: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622

Query: 602 LDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTS 661
           LD T+    KY  G TL+GGYCR +R DKDWT+CYT+ +   +   +  K N  +     
Sbjct: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLIR 682

Query: 662 NKGRKKRNTTSILGVISPRKKRTPEGEH----SDIFQNLHFCVLSDYLDPYTGNRIDRNT 717
           +  RKK    S  G++       P G      SD+F  L+F ++SDY+      RIDR  
Sbjct: 683 SYSRKKSKIISPAGML-------PNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDRED 735

Query: 718 LTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESA 777
           +  LII  GG+VIYNV+AK      LRI+     +EC  L++RGYD+++ SW+ DC+++ 
Sbjct: 736 ICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAG 795

Query: 778 RLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLH--NMPSGSFS 835
            +L LE  HC  VS EL+ +++ R+D++ DS+E  +  ++L +L+D +++  N  + +  
Sbjct: 796 VILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLL 855

Query: 836 GENLDFELRGLPPLLFFDRSVFIAETK--LSDRIYAKISSETKLFGGQVTHTIEDCNLII 893
             N D  +  +P  LF +R  F+ +    L DR    +  + KL+GG +   +EDCN II
Sbjct: 856 LINKDEGVDSIPIFLFTNRKFFLIKEDILLGDR--DTLIFQIKLYGGSLVTKLEDCN-II 912

Query: 894 IPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           +     +   + L  +R KL       N  + IP  V+  W+ +SIK   Q+  E+Y +L
Sbjct: 913 VGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYPIL 972

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/956 (46%), Positives = 617/956 (64%), Gaps = 27/956 (2%)

Query: 3   EKVEEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKT 62
           E  ++ P NFAPSPDF+WLCDELF K + + T+DR+   K +TV+  EV+  F++LWR T
Sbjct: 30  EVSQKKPQNFAPSPDFRWLCDELFSKLEEI-TEDRQKLGKAVTVKRVEVIMYFIKLWRTT 88

Query: 63  VGNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNER 122
           VG+N YPVL L LPYRD R YNIKD TL+KA+C  L+LPK S TEK+LLNWKQ A R   
Sbjct: 89  VGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTS 148

Query: 123 LSSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCL 182
           LS FCV EI KR+  P  S+R  +T+D LN  LD+L+   S++  G   L+ S  F+ CL
Sbjct: 149 LSKFCVEEIMKRRKEPQGSQR--LTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCL 206

Query: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242
           +NMSF E +YFFDI+LK R+IGG EHK LN WHPDA DY  VVSDL  +++ L+ P++RL
Sbjct: 207 QNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRL 266

Query: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302
              +L++ IG AFAPHLAKRL++SYE++  KL  DF IEEKMDGERIQ+HY++ G +I+F
Sbjct: 267 GKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRF 326

Query: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362
           LSRRGTD+T+LYG     G I+ +LK   +V++C+LDGEMV++D+EK ++LPFG+VKS+A
Sbjct: 327 LSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTA 386

Query: 363 KNFL--SKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVS 420
              L  S   +    Y PL+M FDLVYLNG SL  LPL+ RK YL  IL+     V+I+S
Sbjct: 387 MEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILS 446

Query: 421 FARCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDL 480
             R +   +I  SL  AI +GSEGIILK+ +S Y + +RNDSWIKIKP+Y ++ GE MDL
Sbjct: 447 DVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDL 506

Query: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540
           ++IGRDPGKKD+ MC  G+ + D       + +  +++L ++D +P  PK  R  K +SF
Sbjct: 507 VVIGRDPGKKDSLMC--GLILAD-------ETDGSSVNLASQD-DPLRPK-QRNPKVISF 555

Query: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSR 600
           C IANG+S+AEFKEI++KTRGLW       PPS  L+FGTK P EWIDP+ SLVLEVK+R
Sbjct: 556 CNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKAR 615

Query: 601 SLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFER-DRQYKLPKVNAGESIT 659
           S+D  E + KKY+ G TL G YCRA+R++KDW+TC TV ++E+  R +   K        
Sbjct: 616 SVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQI 675

Query: 660 TSNKGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLT 719
           +  K RK  N + +  +++   + +     S+IFQ L F +LSDY+D     R +++ + 
Sbjct: 676 SPRKQRKLANVSELYPLLADDSRESI--FESNIFQGLQFYILSDYIDS-QKKRYEKDQIG 732

Query: 720 QLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARL 779
            L+    G V++N   +  E   LRII     +EC +L ++GYDI+ PSW+ DC+    L
Sbjct: 733 TLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSL 792

Query: 780 LKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENL 839
           +KLE  HCF  S++L+E S  RVD + DSF   +S T  D L++      P  S + E L
Sbjct: 793 VKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLS-APEEL 851

Query: 840 DFELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDD 899
           D    G+P  LF +  ++ A           +    +LFGG+ + T++ CNL+++  +  
Sbjct: 852 D----GIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFK 907

Query: 900 EDK--IQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           E K   ++++ +R ++AS         RIP +VS  WL   I E   VPEE++  L
Sbjct: 908 EQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/952 (44%), Positives = 606/952 (63%), Gaps = 26/952 (2%)

Query: 6   EEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGN 65
           E  P NFAPSPDF+WLC+ELF + D +    + +  K +TV+  E+++ F++LWR TVG+
Sbjct: 18  ENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG-KAVTVKRVEIITCFIKLWRTTVGD 76

Query: 66  NFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSS 125
           +F+P L L  PYRD R Y+IKD TLIKA+C  L+L + S TE++LLNWKQ A R   LS 
Sbjct: 77  DFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSK 136

Query: 126 FCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSR-GQGSRTLADSSHFKFCLEN 184
           FCV EI KR+  P P ++  +T+D LN  LD+LA   S +   G+  L++S  F+FCL+N
Sbjct: 137 FCVQEISKRRKEPLPERQ--LTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKN 194

Query: 185 MSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRN 244
           +SF+EL+YFFDI+LK R+IGG EHK L  WHPDA  Y  VV+DL  ++KKL+ PSVRL  
Sbjct: 195 LSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDK 254

Query: 245 EDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLS 304
            DL++ IG AFAPHLAKRL++SYE+I  KL  DF +EEKMDGERIQ+HY++ G+ +KFLS
Sbjct: 255 RDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLS 314

Query: 305 RRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKN 364
           RRG D+++LYG + + G I+ YLKL  +V++C+LDGEMV+YD+++++ILPFG+VKS+A +
Sbjct: 315 RRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD 374

Query: 365 FLSKESIS--NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422
            L    +   N  Y PL+M FDLVYLNG SL  +PL+ RK+YL +IL+     V+I+   
Sbjct: 375 ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGI 434

Query: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482
           R  + ++I   +  AI +GSEG+I+K+ +S Y V +RND W+KIKP+Y +  GE MDL++
Sbjct: 435 RACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 483 IGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCT 542
           IGRDPGKKD+ MC L V+  +    +L   EN       ++ +P       I+K VSFC 
Sbjct: 495 IGRDPGKKDSLMCGLLVSDSE---HIL---ENFGPIEHGKEGDP-------IIKCVSFCN 541

Query: 543 IANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSL 602
           +ANG+S+ EFKEI++KTRG W  + +  PP   L+FG+K PVEWIDPK S+V+EVK+RS+
Sbjct: 542 VANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSV 601

Query: 603 DNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSN 662
           +N+E + K+YRAG TL   YCR +R DKDWTTC +V+++++ +       +  +      
Sbjct: 602 ENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAH--NYHRYKRKVHQV 659

Query: 663 KGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLI 722
             R+KRN   I    +   K   + E S IF+ LHF +LSDY+      R +R  +   +
Sbjct: 660 SPRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQR-RRYERGMVAAKV 718

Query: 723 IDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKL 782
           + +GG ++ N+  +      LRI+     +EC  L+ RGYDI+ P W+ DCI +   L +
Sbjct: 719 VKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGI 778

Query: 783 ERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPS--GSFSGENLD 840
           E  HCF  S+ L++ S  RVD+Y DSF   + TT   +L      + PS   S     L 
Sbjct: 779 EPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSS-PSDFSSRISSMLQ 837

Query: 841 FELRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE 900
            +L   P  L     +++    L  + ++ +  + +L+GG V+ T+E  NL+++P+    
Sbjct: 838 DDLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALST 897

Query: 901 DKIQ-VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYS 951
            +    +Q++R K+A      N+  RIP IV  EWL     E   VPEE++S
Sbjct: 898 ARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFS 949

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/953 (43%), Positives = 611/953 (64%), Gaps = 30/953 (3%)

Query: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68
           P NF+PSPDF WLCDELF+K + VA + + +  KP  VR  E+ SNFV LWRKTVGN+ Y
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLG-KPRKVRNLEITSNFVSLWRKTVGNDIY 109

Query: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128
           P L+L+LPY DRR+Y +KDVTL+KA+C ++ LP+ S TE++LL+WKQ A R  +LS+FCV
Sbjct: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169

Query: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSR-TLADSSHFKFCLENMSF 187
            E++KR+  P   KR +I  D++N +LD L + +S+ G+ S  +LA+S  F +CLE+MS+
Sbjct: 170 EELQKRRREPVVPKRMSI--DEVNGMLDKLEH-ESNVGKWSYISLAESPAFNYCLEHMSY 226

Query: 188 IELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDL 247
           +EL++FFDI+LKV I+ G E  LL+ WHPDA  YF VVSDL  V   LY+P+ RL   DL
Sbjct: 227 VELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDL 286

Query: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307
           +++IG AFAPH+A+R+ I YEK+  KLG+DF +EEKMDG+RIQ+HYMDYGN I + SR G
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367
            +YTYLYG ++S G+I+ +LK  E VKECILDGEMV+YD+E Q ILPFGL KS A + ++
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 368 KESISNG--SYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCN 425
            E+  +   +Y PL+  FDL+YLNG  L +  + +RK+YL KIL      V ++S  RC+
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 426 NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR 485
           + E+IT +L AA++ GSEGI+LKK  S+Y V  R+DSWIKIKP+YL+ FGENMDL++IGR
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGR 526

Query: 486 DPGKKDAFMCALGVTIDDPQ--PRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTI 543
           D G+KD+F+CAL VT D  +  P   +   + + D +    +P      +I KF+SFC+I
Sbjct: 527 DKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQP------KIEKFISFCSI 580

Query: 544 ANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLD 603
           ANGISN EFKEID+ TRG W  +D+ KPP+++++FGTK P EWIDPK S+VLEVK+RS+D
Sbjct: 581 ANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640

Query: 604 NTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYK-LPKVNAGESITTSN 662
           N ES    Y+ G TL+  YC+ +R+DK+W+T  TV+E++  R+ +    V+         
Sbjct: 641 NEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDR 700

Query: 663 KGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLI 722
              +KR T  ++G I   K        +D  +  +F V S Y D  +   ID + + + +
Sbjct: 701 SSPRKRRTFHLVGDIDVTKP-----SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAV 755

Query: 723 IDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKL 782
           +  GG  I+N+  +   + +  + C     E   LI+RGYDI+ P W++DC++   +L++
Sbjct: 756 VSCGGTYIHNLRIRASLDKLYILGCKD-TRELKMLIERGYDIIHPEWLMDCVKYGTMLQI 814

Query: 783 ERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENL-DF 841
           E  + ++ S+ELM+ +  + D+Y +S++  ++   L  L +  +    +     + + ++
Sbjct: 815 EPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEY 874

Query: 842 E-LRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE 900
           E L      LF+    +   +  SD +   I S     GG+VT+ +E   +++     D 
Sbjct: 875 ERLLIFKGWLFYILDDYAYHSSWSDIVKWNIES----CGGEVTNDLELATIVVA--VKDC 928

Query: 901 DKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
                LQ +R  + + I   N  + IP IV+ EW+   ++    V E+ Y+ +
Sbjct: 929 FSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/949 (44%), Positives = 587/949 (61%), Gaps = 53/949 (5%)

Query: 11  NFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFYPV 70
           NF+PSP+F+WLCDEL  K    +++   I  KP+TVRY E+++NF++LWR TVGN  YP 
Sbjct: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIG-KPVTVRYLEIITNFIKLWRSTVGNYIYPA 64

Query: 71  LILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCVAE 130
           L L +P+RDRR YN+K+ TLIKA+C YL LPK S TE +LL WKQRA+R  +LS FCV E
Sbjct: 65  LRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEE 124

Query: 131 IRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSFIEL 190
           IRKR+   + + R  IT+D+LN  LD+++   + +  G   L DS  F +CL +M+F+E+
Sbjct: 125 IRKRQKDYEGANR--ITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEM 182

Query: 191 KYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLK 250
           K+FFDI+LK R++ G E+  L AWHPDA DY SVVSDL  ++++LY P+ RLR  DL++ 
Sbjct: 183 KFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSIT 242

Query: 251 IGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDY 310
           I  AF P LAKR ++SYE++  KL  DF IEEKMDGER+QIHY++YG +IK+LSRRG D+
Sbjct: 243 ISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDF 302

Query: 311 TYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKES 370
           +YLYG ++S+G I+  LKL+ NVK+CILDGEM+TYD EK ++LPFGLVKSSA N +  E 
Sbjct: 303 SYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSEL 362

Query: 371 IS---NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427
                  SY PLF+AFDLVYLNG SL +L L +RKDYL+KILT     V+I+ + +  N 
Sbjct: 363 AGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINA 422

Query: 428 ESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDP 487
           E+I  SL  AIS+GSEGI+LK L+S+Y V SRN  WIKIKP+YL+QFGENMDL+IIGR+ 
Sbjct: 423 EAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQ 482

Query: 488 GKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGI 547
           GKKD+F C  G++I DP                  +   E P      +F+SFCTIANG+
Sbjct: 483 GKKDSFFC--GLSISDP------------------NEVAEKP------RFISFCTIANGL 516

Query: 548 SNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTES 607
           SN EFK+I++KT G W  F +  P    L FGTK P EWI P++S+VLEVK+R++D  ES
Sbjct: 517 SNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKES 576

Query: 608 NVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKK 667
             +KYR+G TL  GYC+ +RYDKDW T  + SEFE D +      N  +S   ++ G+K+
Sbjct: 577 EKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFE-DMKDARNFYNKRKSHQVTD-GKKR 634

Query: 668 RNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGG 727
            +  + +G+++  +        S+ F N  F V+SDY D     RI +  L  +I+++GG
Sbjct: 635 ASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGG 694

Query: 728 KVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLERNHC 787
           +++Y        +  L II +    EC  L+     I+ PSW+  CIE         +  
Sbjct: 695 EIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDI 754

Query: 788 FNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELRGLP 847
           F    E    SS    +    F  + +T  L+     HL    +      + D  L  +P
Sbjct: 755 FRGELE----SSMDCSQ----FYTDFNTASLN-----HLLETANRGIKNPDSDLLLPEVP 801

Query: 848 PLLFFDRSVFIAETK-LSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPN--TDDEDKIQ 904
             LF +  + +  ++ + D    ++    K  GG++ H IE+ ++II+ N     ED   
Sbjct: 802 LFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFS 860

Query: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953
           + QKI  K  ++ +   ST RIP +V   W   SIK+N     E+Y  L
Sbjct: 861 LRQKIASK--AVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 129/273 (47%), Gaps = 11/273 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     E  +   N+   LK G    P LAK      E + +  G  F+
Sbjct: 294 DAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFT 353

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H +  G+ +   SR G + T  Y        I  YL   E     ILD
Sbjct: 354 CEYKYDGERAQVHLLPDGS-MNIYSRNGENMTERY----PELHIRDYLADPETTHSLILD 408

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D E+  ILPF ++ +  +  +  + +          AFD++  NG SL++  L 
Sbjct: 409 CEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSLL 465

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456
           +R++YL ++L    G     +    +NLE + K L  ++    EG+++K L    S Y  
Sbjct: 466 ERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEP 525

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIGRDPGK 489
           + R+ +W+K+K  YL+  G+++DL ++G   G+
Sbjct: 526 SKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGR 558

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 113/457 (24%), Positives = 199/457 (43%), Gaps = 65/457 (14%)

Query: 209 KLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYE 268
           +LL        D F  V +   V     +  +   NE  +L+ G    P LAK      E
Sbjct: 355 ELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINE 414

Query: 269 KILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLK 328
            + +  G  F+ E K DGER Q+H ++ G  ++  SR G + T  Y        I  ++K
Sbjct: 415 ILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY----PEIHIGDFVK 469

Query: 329 LNENVKECILDGEMVTYDQEKQMILPFGLVKSSA-KNFLSKESISNGSYHPLFMAFDLVY 387
                K  ILD E V +D+E+Q ILPF ++ +   K+ L+K+            AFD++ 
Sbjct: 470 DRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDV----KVRVCLFAFDILC 525

Query: 388 LNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIIL 447
            N   L++  L +R++ L ++ T   G     +    +NL+ + K L  +++   EG+++
Sbjct: 526 HNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMV 585

Query: 448 KKL---NSRYMVASRNDSWIKIKPQYLKQFGENMDLIII------GRDPGKKDAFMCALG 498
           K L    S Y  + R+ +W+K+K  YL+  G+++DL ++      G+  G    F+  LG
Sbjct: 586 KMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFL--LG 643

Query: 499 VTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGISNAEFKEIDQK 558
              D+                                +F + C I  G S+   +++ +K
Sbjct: 644 CYNDN------------------------------TGEFETCCKIGTGFSDEMLQQLHEK 673

Query: 559 TRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNT---ESNVKKYRAG 615
            +      D   P + Y+   + +P  W +P  SL+ EV +  L  +   ++    Y  G
Sbjct: 674 LKATV--ID--GPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSSAYDKG 727

Query: 616 VTL-FGGYCRAVRYDK---DWTTCYTVSEFERDRQYK 648
           V+L F  + R +R DK   D T+   + E   ++ ++
Sbjct: 728 VSLRFPRFIR-IREDKGVEDATSSEQIIELYENQSHR 763

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 179/409 (43%), Gaps = 67/409 (16%)

Query: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307
           TL+ G    P LAK      E +    G +F  E K DGER Q+H ++ G E++  SR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 308 TDYTYLYGGDTSTGTIACYLKLNEN----------VKECILDGEMVTYDQEKQMILPFGL 357
            + T  Y  +       C +K   N          VK+ ILD E+V +D E++ ILPF +
Sbjct: 411 ENMTERYP-ELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQV 469

Query: 358 VKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVD 417
           + +  +  +  + +          AFDL+YLN   +++  L +R++ L K+     G   
Sbjct: 470 LTTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQ 526

Query: 418 IVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQF 474
             +    ++++ +   L  A+    EG+++K L+   S Y  + R+ +W+K+K  YL   
Sbjct: 527 YATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGV 586

Query: 475 GENMDLIII------GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPET 528
           G+++DL+++      G+  G    F+  LG   +D Q                       
Sbjct: 587 GDSLDLVVMGAYFGKGKRTGSYGGFL--LGCYNEDTQ----------------------- 621

Query: 529 PKASRIVKFVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWID 588
                  +F + C I  G S+    E+      L +  +   PP  Y+   + +P  W  
Sbjct: 622 -------EFETCCKIGTGFSD----EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQ 670

Query: 589 PKESLVLEVKSRSLDNT---ESNVKKYRAGVTL-FGGYCRAVRYDKDWT 633
            K  ++ EV +  L  +   ++   +Y  G++L F  + R +R DKD T
Sbjct: 671 AK--VLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR-IREDKDVT 716

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 166/381 (43%), Gaps = 49/381 (12%)

Query: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303
           N+ + L+ G    P LAK      E + +  G+ F+ E K DGER Q+H    G+ +K  
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384

Query: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363
           SR G D T  Y        +  Y+K     K  I+D E V +DQE+  ILPF ++ +  +
Sbjct: 385 SRNGEDMTERY----PEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423
             +  + +          AFD++ LN   L++   ++R+  L        G  D  +   
Sbjct: 441 KGVELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 424 CNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDL 480
             N + + K L  ++    EG+++K L    S Y  + R+ +W+K+K  YL+  G+++DL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 481 IIIGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSF 540
           +++G   G+        G  +                +LD+E+             F + 
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLLG-------------CYNLDSEE-------------FETC 591

Query: 541 CTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVE-WIDPKESLVLEVKS 599
           C I  G S+   +++  K +        V+ PS  + + +  P + W +P  S++ EV +
Sbjct: 592 CKIGTGFSDEMLQDLYTKLKD-----TTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLT 644

Query: 600 RSLDNTESNVKKYRAGVTLFG 620
             L    S    Y+AG   FG
Sbjct: 645 ADL----SLSPVYKAGFEAFG 661

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 162/374 (43%), Gaps = 41/374 (10%)

Query: 138 PDPSKRQAITLDKLNSILDDLAN--GKSSRGQGSRTLADSSHFKFCLENMSFIELKYFFD 195
           P   K + +T+  + S L  +A   GK S+G+  R +      K  L     +E KY   
Sbjct: 198 PTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLI------KKMLTACQGMEAKYLIR 251

Query: 196 IL-LKVRI--------------IGGHEH-------KLLNAWHPDAVDYFSVVSDLSSVTK 233
            L  K+RI              I  HEH       + ++A      D F  V +   +  
Sbjct: 252 SLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIIN 311

Query: 234 KLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHY 293
              +  +    +   L  G    P LAK      E + +  G  F+ E K DGER Q+H 
Sbjct: 312 AALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHL 371

Query: 294 MDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMIL 353
           M+ G  I+  SR   + T  Y           +L   +  +  I+D E V +D EKQ IL
Sbjct: 372 MEDGT-IRIYSRNSENMTERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKIL 426

Query: 354 PFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCN 413
           PF ++ +  +  +  + +          AFDL+YLNG SL+   L  R+ +L  +L    
Sbjct: 427 PFQVLSTRKRKGVELKDVK---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVP 483

Query: 414 GFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQY 470
           G +   +      L  +   L  ++S   EG+++K L+   S+Y  + R+ +W+K+K  Y
Sbjct: 484 GELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDY 543

Query: 471 LKQFGENMDLIIIG 484
           L+  G+++DL ++G
Sbjct: 544 LEGVGDSLDLAVLG 557

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 132/268 (49%), Gaps = 11/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     E  +   ++  TLK G    P LAK      E + +  G  F+
Sbjct: 356 DAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFT 415

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H +D G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 416 SEYKYDGERAQVHLLDDGT-MRIYSRNGENMTERY----PEIKITDFIQDLDATKNLILD 470

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+E+  ILPF ++ +  +  +    +S+        AFD++  NG  L++  L 
Sbjct: 471 CEAVAWDKEQGKILPFQVLSTRKRKDV---ELSDVKVRVCLFAFDVLCHNGERLINKSLR 527

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456
           +R++ L+K+     G     +    +NL+ + K L  +++   EG+++K L    S Y  
Sbjct: 528 ERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEP 587

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL+  G+++DL ++G
Sbjct: 588 SKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 132/268 (49%), Gaps = 11/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     E  +   ++  TL+ G    P LAK      E + +  G  F+
Sbjct: 356 DAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFT 415

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 416 SEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERY----PEINITDFIQDLDTTKNLILD 470

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+++  ILPF ++ +  +  +    +++        AFD++  N   L++  L 
Sbjct: 471 CEAVAWDKDQGKILPFQVLSTRKRKDVE---LNDVKVKVCLFAFDILCYNDERLINKSLK 527

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456
           +R++YL+K+     G     +    NNL+ + K L  +++   EG+++K L    S Y  
Sbjct: 528 ERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEP 587

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL+  G+++DL ++G
Sbjct: 588 SKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/386 (25%), Positives = 163/386 (42%), Gaps = 65/386 (16%)

Query: 247 LTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRR 306
           + L  G    P LAK      E +       F+ E K DGER Q+H +  G+ ++  SR 
Sbjct: 348 IKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRN 406

Query: 307 GTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFL 366
           G D T  Y        I  YL  +    + ILD E V +D E Q ILPF ++ +  +  +
Sbjct: 407 GEDMTQRY----PELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSV 462

Query: 367 SKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNN 426
             + I          AFD++  N  SL++  L +R+D L  I   C G     +    +N
Sbjct: 463 DLKDIK---VRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSN 519

Query: 427 LESITKSLAAAISVGSEGIILKKL---NSRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483
           L+ +   L  AI    EG+++K L   +S Y  + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 520 LDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVL 579

Query: 484 ------GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKF 537
                 G+  G    F+ A                     + DTE+             F
Sbjct: 580 GAYYGRGKRTGTYGGFLLAC-------------------YNQDTEE-------------F 607

Query: 538 VSFCTIANGISNAEFKEIDQKTRGLWRRFDQV---KPPSEYLQFGTKKPVEWIDPKESLV 594
            + C I  G S       D+  + L+    +     P + ++   + +P  W +P  ++V
Sbjct: 608 ETCCKIGTGFS-------DEMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNP--TMV 658

Query: 595 LEVKSRSLDNTESNVKKYRAGVTLFG 620
            EV +  L    S    Y+AG T++G
Sbjct: 659 FEVLTADL----SLSPIYKAGSTVYG 680

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 136/273 (49%), Gaps = 11/273 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     E  +   ++  TL+ G    P LAK      E + +  G  F+
Sbjct: 446 DAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFT 505

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 506 SEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERY----PEIKITDFIQDLDITKNLILD 560

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+++  ILPF ++ +  +  +    +++        AFD++  N   L+++ L 
Sbjct: 561 CEAVAWDKDQAKILPFQVLSTRKRKDVE---LNDVKVRVCLFAFDILCHNDERLINMSLR 617

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456
           +R++YL+K+     G     +    NNL+ + K L  +++   EG+++K L+   S Y  
Sbjct: 618 ERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEP 677

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIGRDPGK 489
           + R+ +W+K+K  YL+  G+++DL ++G   G+
Sbjct: 678 SKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGR 710

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 123/240 (51%), Gaps = 11/240 (4%)

Query: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307
           TL+ G    P LAK      E + +  G  F+ E K DGER Q+H ++ G  ++  SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNG 442

Query: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367
            + T  Y        I  +++   + K  ILD E V +D+E++ ILPF ++ +  +  + 
Sbjct: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498

Query: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427
              +          AFD++  N   L++  L +R+++L+K+     G     +    NNL
Sbjct: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNL 555

Query: 428 ESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + + K L  +++   EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL ++G
Sbjct: 556 DELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 111/461 (24%), Positives = 196/461 (42%), Gaps = 64/461 (13%)

Query: 201 RIIGGHEH-------KLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGS 253
           + I  HEH        L++A      D F  V +   V     E  +    +   L  G 
Sbjct: 291 KAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGI 350

Query: 254 AFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYL 313
              P LAK      E + +  G  F+ E K DGER Q+H +  G+ ++  SR G + T  
Sbjct: 351 PLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTER 409

Query: 314 YGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKESISN 373
           Y        I+ ++   +     ILD E V +D++K +ILPF ++ +  +  +  E +  
Sbjct: 410 Y----PEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK- 464

Query: 374 GSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLESITKS 433
                   AFD++  N   L++  L +R+ YL +IL    G + + S     +L+ +   
Sbjct: 465 --VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLY 522

Query: 434 LAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPGKK 490
           L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL ++G   G+ 
Sbjct: 523 LDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRG 582

Query: 491 DAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGISNA 550
                  G  +                + DT +             F + C I  G S  
Sbjct: 583 KRTGTYGGFLLG-------------CYNQDTGE-------------FETCCKIGTGFS-- 614

Query: 551 EFKEIDQKTRGLWRRFDQV---KPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNT-- 605
                D+  + L+ +       +P + Y+   + +P  W++P  S++ EV +  L  +  
Sbjct: 615 -----DEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPV 667

Query: 606 -ESNVKKYRAGVTL-FGGYCRAVRYDK---DWTTCYTVSEF 641
            ++    Y  G++L F  + R +R DK   D T+   V EF
Sbjct: 668 YKAGGSSYGKGISLRFPRFIR-IRDDKSVEDATSSEQVIEF 707

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 125/268 (46%), Gaps = 11/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V +   E  +   ++   L  G    P LAK      E + +  G  F+
Sbjct: 325 DAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFT 384

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H +  G+ ++  SR G + T  Y        I+ ++         ILD
Sbjct: 385 CEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERY----PEIRISDFIADPARTHTLILD 439

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+EK  ILPF ++ +  +  ++ E +          AFD++  N   L+  PL 
Sbjct: 440 CEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK---VRVCLFAFDILCYNDEPLITRPLA 496

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456
           +R+  L + L    G + + S     +L+ +   L  A+    EG+++K L    S Y  
Sbjct: 497 ERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEP 556

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL+  G+++DL ++G
Sbjct: 557 SKRSRNWLKLKKDYLQGVGDSLDLCVLG 584

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 128/268 (47%), Gaps = 11/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     +  +   +E  T++ G    P LAK      E + +  G  F+
Sbjct: 325 DAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFT 384

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H +  G  ++  SR G + T  Y        I  +L    +    ILD
Sbjct: 385 SEYKYDGERAQVHLLKDGT-MRIYSRNGENMTERY----PEIQIKDFLADPASTTSLILD 439

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+E+  ILPF ++ +  +  +   +I+         AFD++  N   L++ PL 
Sbjct: 440 CEAVAWDKEQNKILPFQVLTTRKRKDV---NINEVKVRVCLFAFDILLHNDMRLINEPLS 496

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456
           +R++ L ++     G     +    +NL+ + K L  ++    EG+++K ++   S Y  
Sbjct: 497 KRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYEP 556

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL+  G+++DL ++G
Sbjct: 557 SKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 132/278 (47%), Gaps = 17/278 (6%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   + +      +   + +  L+ G    P LAK      E +    G +F+
Sbjct: 323 DAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFT 382

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKE---- 335
            E K DGER Q+H +  G E++  SR G + T  Y        I  +L  +E+  +    
Sbjct: 383 CEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERY----PELHIEDFLVKDESNTDKEVS 437

Query: 336 CILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVD 395
            ILD E+V +D E+  ILPF ++ +  +  +  + +          AFD++Y NG  L+ 
Sbjct: 438 LILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLIT 494

Query: 396 LPLYQRKDYLSKILTKC-NGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN--- 451
             L +R+  L ++ TKC  G     +      L+ I K L  AI    EG+++K L+   
Sbjct: 495 KTLRERRKILHEV-TKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEE 553

Query: 452 SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDPGK 489
           SRY  + R+ +W+K+K  YL   G+++DL ++G   GK
Sbjct: 554 SRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGK 591

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 100/412 (24%), Positives = 181/412 (43%), Gaps = 57/412 (13%)

Query: 249 LKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGT 308
           L+ G    P LAK      E + +  G  F+ E K DGER Q+H ++ G  ++  SR G 
Sbjct: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGE 394

Query: 309 DYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSK 368
           + T  Y       +I  ++   E+ K  ILD E V +D+ +Q ILPF ++ +  +  +  
Sbjct: 395 NMTERY----PEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450

Query: 369 ESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLE 428
           + +          AFD++  NG   ++  L +R++ L+++     G          +++E
Sbjct: 451 KDVK---VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVE 507

Query: 429 SITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR 485
            + K L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL   G+++DL ++G 
Sbjct: 508 ELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGA 567

Query: 486 DPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIAN 545
             G+        G                  L    +DS           +F + C I  
Sbjct: 568 YYGRGKRTGTYGGFL----------------LGCYNQDSG----------EFETCCKIGT 601

Query: 546 GISNAEFKEIDQKTRGLWRRFDQVK---PPSEYLQFGTKKPVEWIDPKESLVLEVKSRSL 602
           G S       D+  + L+ RF +     P + Y+   + +P  W +P  + + EV +  L
Sbjct: 602 GFS-------DEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADL 652

Query: 603 DNT---ESNVKKYRAGVTL-FGGYCRAVRYDK---DWTTCYTVSEFERDRQY 647
             +   ++    Y  GV+L F  + R +R DK   D T+   + E  +D+ +
Sbjct: 653 SLSPVYKAGASTYDKGVSLRFPRFVR-LRDDKSVEDATSSAQIVELYQDQSH 703

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 124/268 (46%), Gaps = 12/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     E  +   ++   L  G    P LAK      E + +  G  F 
Sbjct: 334 DAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFV 393

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H +  G  ++  SR G + T  Y        I  +L  + + +  ILD
Sbjct: 394 SEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERY----PEIDIRDFLS-DPSTESLILD 447

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+E+  ILPF ++ +  +  +  + +          AFDL+  NG  L++  L 
Sbjct: 448 CEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK---VRVCLFAFDLLCHNGEPLINKSLR 504

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456
           +R+D L K+    +G     +     N+E +   L  ++    EG+++K L+   S Y  
Sbjct: 505 ERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEP 564

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL   G+++DL ++G
Sbjct: 565 SKRSRNWLKLKKDYLNGVGDSLDLCVLG 592

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 121/268 (45%), Gaps = 11/268 (4%)

Query: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279
           D F  V +   V     +  +   ++  +L+      P LAK      E   +     F+
Sbjct: 328 DAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFT 387

Query: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  ++    + K  ILD
Sbjct: 388 CEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERY----PEIHIRDFVTDLSHTKSLILD 442

Query: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399
            E V +D+E+  ILPF ++ +  +  +    I+         AFD++  N   L++  L 
Sbjct: 443 CEAVAWDKEQNKILPFQVLSTRKRKDVD---INEIKVRVCLFAFDILLHNDEKLINKSLQ 499

Query: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456
           +R+D L  I  +  G     +     NLE +   L  ++    EG+++K L    S Y  
Sbjct: 500 ERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEP 559

Query: 457 ASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + R+ +W+K+K  YL   G+++DL ++G
Sbjct: 560 SKRSRNWLKLKKDYLAGVGDSLDLCVLG 587

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 97/403 (24%), Positives = 171/403 (42%), Gaps = 66/403 (16%)

Query: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303
           +E  +L+ G    P LAK      E   +     F+ E K DGER Q+H M+ G+ ++  
Sbjct: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIY 393

Query: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363
           SR G + T  Y     T     ++K     K  I+D E V +D+E++ ILPF ++ +  +
Sbjct: 394 SRNGENMTERYPEINVTD----FIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKR 449

Query: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423
             +    I +        AFD++  N   L++  L +R++ L  +  + +G         
Sbjct: 450 KDVD---IKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 424 CNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDL 480
            NNL+ +   L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL   G+++DL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 481 III------GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRI 534
            ++      G+  G    F+  LG    D                               
Sbjct: 567 CVLGAFYGRGKRTGTYGGFL--LGCYNQDTG----------------------------- 595

Query: 535 VKFVSFCTIANGISNAEFKEIDQKTRGLWRRFDQVK---PPSEYLQFGTKKPVEWIDPKE 591
            +F + C I  G S       D+  + L+ R        P + Y+   + +P  W +P  
Sbjct: 596 -EFETACKIGTGFS-------DEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEP-- 645

Query: 592 SLVLEVKSRSLDNT---ESNVKKYRAGVTL-FGGYCRAVRYDK 630
           +L+ EV +  L  +   ++    Y  G++L F  + R +R DK
Sbjct: 646 TLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIR-LREDK 687

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 11/240 (4%)

Query: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307
           +L+ G    P LAK      E + +  G  F+ E K DGER Q+H +  G  ++  SR G
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNG 441

Query: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367
            + T  Y        IA  L         ILD E V +D E+  ILPF ++ +  +  + 
Sbjct: 442 ENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVD 497

Query: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427
              + +        AFD++  N   L++  L +R+  L ++     G     +    +NL
Sbjct: 498 ---LKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554

Query: 428 ESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIG 484
           + + K L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL +IG
Sbjct: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 53/98 (54%), Gaps = 19/98 (19%)

Query: 687 GEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRII 746
            ++ ++F+N   CV+  Y++ YT  +  R  L ++I+ +GGK ++++ AK+    +  I+
Sbjct: 161 SQNGNLFKN---CVI--YINGYT--KPGRLQLHEMIVLHGGKFLHHLSAKKR---VTHIV 210

Query: 747 CDGFNMECNALIKR----GYDILSPSWVLDCIESARLL 780
                     L KR     Y +++P W+ DCI+  RLL
Sbjct: 211 ASNL-----PLKKRIEFANYKVVNPDWITDCIKERRLL 243

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 380 FMAFDLVYLNGTSLVDLPLYQRKDYLSKILTK------------CNGFVDIVSFARCN-- 425
           ++ FD + +NG SLV  P   R  +L K   K            C+ F   +S    N  
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 426 -NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQ 469
            +L  I  +L     V S+G+I   +N+ Y V  ++ + +K KPQ
Sbjct: 204 YDLVKIASTLDKLPHV-SDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 19/97 (19%)

Query: 688 EHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIIC 747
           + S IF+N   CV+  Y++ YT  +  R  L ++I+ +GGK ++ + +K+    +  I+ 
Sbjct: 161 QSSKIFKN---CVI--YINGYT--KPGRLQLHEMIVLHGGKFLHYLSSKKT---VTHIVA 210

Query: 748 DGFNMECNALIKR----GYDILSPSWVLDCIESARLL 780
                    L KR     Y ++SP W++D ++ ARLL
Sbjct: 211 SNL-----PLKKRIEFANYKVVSPDWIVDSVKEARLL 242

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 380 FMAFDLVYLNGTSLVDLPLYQRKDYLSKILTK------------CNGFVDIVSFARCN-- 425
           ++ FD + +NG SLV  P   R  +L K   K            C+ F   +S    N  
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFPFKISMKHMNFS 204

Query: 426 -NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQ 469
            +L  + K+L +   V S+G+I   + + Y +  ++   +K KP+
Sbjct: 205 YDLAKVAKTLDSLPHV-SDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>Skud_15.513 Chr15 (919666..922626) [2961 bp, 986 aa] {ON} YOR346W
           (REAL)
          Length = 986

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 19/98 (19%)

Query: 687 GEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRII 746
            ++  IF+N   CV+  Y++ YT  +  R  L ++I+ +GGK ++ + AK+    +  I+
Sbjct: 160 SQNKKIFKN---CVI--YINGYT--KPGRLQLHEMIVLHGGKFLHYLSAKKT---ITHIV 209

Query: 747 CDGFNMECNALIKR----GYDILSPSWVLDCIESARLL 780
                     L KR     Y ++SP W+ D I   RL+
Sbjct: 210 ASSL-----PLKKRIEFANYKVVSPDWITDSIREGRLM 242

>AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL130W (CEG1)
          Length = 463

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 380 FMAFDLVYLNGTSLVDLPLYQRKDYLSKILTK------------CNGFVDIVSFARCN-- 425
           ++ FD + +NG +LV  P   R  +L K   K            C  F   +S    N  
Sbjct: 144 YLMFDCLAINGRALVQSPTSSRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFS 203

Query: 426 -NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQ 469
            +L+ +  SL     V S+G+I   +++ Y V  ++ + +K KP+
Sbjct: 204 FDLDRVAGSLDKLPHV-SDGLIFTAVDTPYTVGGKDSTLLKWKPE 247

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 686 EGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRI 745
           EG    IF++   C++  Y++ YT     R  L + I+ +GGK I+++ AK+    +  I
Sbjct: 173 EGLPPQIFKD---CII--YINGYTIP--GRLQLHESIVLHGGKFIHHLSAKKK---ITHI 222

Query: 746 ICDGFNMECNALIKRGYDILSPSWVLDCIESARLL 780
           I     ++   L    Y ++ P W++  IES +LL
Sbjct: 223 IASNLTLK-KKLEFEKYKVVKPDWIVKSIESKKLL 256

>TPHA0H02830 Chr8 (670361..673132) [2772 bp, 923 aa] {ON} Anc_7.46
           YOR346W
          Length = 923

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 11/88 (12%)

Query: 692 IFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFN 751
           IF+N   CV+  Y++ YT    DR  L +LI+ +GGK ++++ +K     +  I+     
Sbjct: 125 IFKN---CVI--YINGYTDP--DRLVLHKLIVIHGGKFLHHMTSK---GRVTHIVATNLP 174

Query: 752 MECNALIKRGYDILSPSWVLDCIESARL 779
           ++      + Y +++P W+LD +++  L
Sbjct: 175 LKKRVEFAK-YKVITPEWILDSVKAEVL 201

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 715 RNTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCI 774
           R  L Q+I+ +GGK ++++ AK     +  II     ++   +    Y ++ P+W++D I
Sbjct: 100 RFELHQMIVVHGGKFLHHMSAK---RSVTHIIASNLPLK-KRIEFANYKVVKPNWIVDSI 155

Query: 775 ESARLL 780
           +  +LL
Sbjct: 156 QQKKLL 161

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 16/105 (15%)

Query: 380 FMAFDLVYLNGTSLVDLPLYQRKDYLSKILTK------------CNGFVDIVSFARCN-- 425
           ++ FD + +NG +L   P   R  +L K   K            C  F   +S  + N  
Sbjct: 143 YLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPDRCINFPFKISMKQMNFS 202

Query: 426 -NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQ 469
            +L ++ K+L     + S+G+I   +N+ Y+V +++   +K KP+
Sbjct: 203 YDLVNVYKTLDKLPHL-SDGLIFTPVNTPYVVGAKDSYLLKWKPE 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,226,676
Number of extensions: 4928773
Number of successful extensions: 15181
Number of sequences better than 10.0: 67
Number of HSP's gapped: 15430
Number of HSP's successfully gapped: 67
Length of query: 954
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 835
Effective length of database: 39,836,145
Effective search space: 33263181075
Effective search space used: 33263181075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)