Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0F002901.52ON1125112554970.0
KAFR0D041001.52ON1117116229480.0
TDEL0C064901.52ON1153117028940.0
Suva_2.6871.52ON1128116927460.0
Skud_4.7831.52ON1135117127260.0
Smik_4.7891.52ON1136117127010.0
YDR507C (GIN4)1.52ON1142118726930.0
NCAS0B086001.52ON1117116726660.0
Kpol_2002.461.52ON1123117826100.0
ZYRO0F17402g1.52ON1189122525580.0
KLTH0F01672g1.52ON1164118125250.0
CAGL0K05709g1.52ON1103115225090.0
KLLA0C01650g1.52ON1112115824490.0
TPHA0E036401.52ON1137118824430.0
SAKL0C01716g1.52ON1215122624050.0
NDAI0A006601.52ON1022115623600.0
AFR696C1.52ON1142118123700.0
Skud_3.391.52ON1017113419530.0
YCL024W (KCC4)1.52ON1037113819040.0
Smik_3.541.52ON1032114118800.0
Ecym_10581.52ON116456218200.0
Suva_3.1901.52ON102482817560.0
TBLA0A071501.52ON139151017700.0
Kwal_33.132251.52ON96498916150.0
Ecym_73922.479ON143435110351e-119
SAKL0E02860g2.479ON137745610281e-118
KLTH0D05566g2.479ON112841310111e-118
ABL034W2.479ON142535310071e-115
Suva_11.1232.479ON152640210111e-115
Smik_11.1392.479ON153439110061e-115
Skud_11.1262.479ON15183899971e-114
KLLA0F13552g2.479ON12673539871e-114
TDEL0A025502.479ON13693929901e-113
YKL101W (HSL1)2.479ON15183899951e-113
KNAG0A065402.479ON14323809861e-112
Kwal_26.77882.479ON12673559741e-112
KAFR0D032002.479ON14483839741e-111
TBLA0I011502.479ON17453859751e-110
ZYRO0G03366g2.479ON16163989651e-109
NCAS0A057702.479ON14613879601e-109
CAGL0K08514g2.479ON14893869571e-108
Kpol_431.92.479ON15524729571e-108
NDAI0D027502.479ON15152988425e-93
TPHA0G032002.479ON15343168133e-89
Kwal_33.13222singletonOFF1481206302e-75
TPHA0C004705.611ON6312936574e-73
CAGL0M08910g5.611ON6122816511e-72
NCAS0A080805.611ON6232716494e-72
Kpol_495.145.611ON6242716477e-72
KLLA0A03806g5.611ON6022726432e-71
Suva_2.6515.611ON6332816442e-71
Kpol_1018.655.611ON6012716413e-71
YDR477W (SNF1)5.611ON6332816433e-71
Smik_4.7545.611ON6322816423e-71
TBLA0E033605.611ON6542716418e-71
Skud_4.7515.611ON6342816391e-70
TPHA0D028405.611ON6344716391e-70
KAFR0C058605.611ON6442716382e-70
NDAI0H009405.611ON6852906384e-70
Kwal_47.182335.611ON5982696324e-70
AEL230W5.611ON6082716309e-70
KNAG0B032305.611ON6412766311e-69
SAKL0G06952g5.611ON5992696281e-69
Ecym_55885.611ON6132716291e-69
TDEL0A047805.611ON6212716282e-69
KLTH0G05698g5.611ON5972696262e-69
ZYRO0A05544g5.611ON6312716231e-68
Kwal_26.87098.654ON8292945153e-53
SAKL0H07084g8.654ON9192825165e-53
KNAG0J015908.654ON8053155101e-52
NDAI0J012508.279ON11763095171e-52
KLTH0D10714g8.654ON8722895112e-52
ZYRO0F06842g8.654ON8432945074e-52
NDAI0E023208.654ON9323195077e-52
CAGL0M11396g8.279ON11922885108e-52
TPHA0G017108.654ON8052795012e-51
SAKL0H16632g8.279ON10622905043e-51
CAGL0M02519g8.654ON7563024921e-50
NCAS0C015908.654ON8642934942e-50
TDEL0A060008.654ON7902884922e-50
Kpol_1012.68.654ON6282944833e-50
NDAI0B020708.279ON12583294973e-50
NCAS0B037408.279ON10492884954e-50
NCAS0B014708.654ON7272924875e-50
ACR119W8.654ON9313214925e-50
TPHA0D011408.654ON6222984816e-50
NDAI0E012908.654ON7292944857e-50
KLTH0G13288g8.279ON11423354939e-50
TPHA0J008208.279ON12182884931e-49
Smik_15.4178.654ON8062884861e-49
KAFR0A037308.654ON7882914851e-49
NCAS0B050908.279ON12102934912e-49
Kpol_1072.298.654ON8932844862e-49
AGR058W8.279ON10712934892e-49
CAGL0M02299g8.668ON8932814863e-49
Suva_16.1698.654ON8582954843e-49
TBLA0C046008.279ON13152834893e-49
Ecym_42918.279ON11452964884e-49
TDEL0F040608.279ON11262904884e-49
Smik_4.3678.279ON10662844865e-49
CAGL0J03872g8.654ON6612924756e-49
Skud_16.1408.654ON8652914817e-49
YPL141C (FRK1)8.654ON8652954817e-49
Skud_15.3998.654ON8072834799e-49
TBLA0B039708.654ON12082914841e-48
Suva_2.2838.279ON10894084822e-48
Suva_8.2848.654ON8082884772e-48
KNAG0G021108.279ON11923034822e-48
Skud_4.3838.279ON10652844803e-48
Kpol_1066.468.279ON12252834813e-48
Smik_6.3398.654ON8652954763e-48
KAFR0H025408.654ON8173344753e-48
Ecym_83398.654ON9202814774e-48
YDR122W (KIN1)8.279ON10642844794e-48
KLLA0F19536g8.279ON11042934785e-48
YOR233W (KIN4)8.654ON8002884735e-48
KAFR0B028008.279ON10952884785e-48
KNAG0A030408.654ON6442914659e-48
TDEL0A061408.668ON8614774711e-47
Skud_12.1648.279ON11602884751e-47
YLR096W (KIN2)8.279ON11472884742e-47
Smik_12.1558.279ON11622884742e-47
ZYRO0F07194g8.668ON9382914685e-47
NCAS0C016708.668ON8962784667e-47
ZYRO0D06776g8.279ON12042834671e-46
SAKL0H06754g8.668ON8842774622e-46
Suva_10.1808.279ON11592894652e-46
TBLA0C017508.654ON9812954633e-46
CAGL0B01925g8.279ON9442884613e-46
NDAI0E023908.668ON8833554561e-45
KNAG0H031408.279ON9362834542e-45
TBLA0B038608.668ON9882814482e-44
KNAG0J016708.668ON10092784473e-44
Ecym_24058.668ON8552814433e-44
Kwal_26.87518.668ON8482774424e-44
KLLA0D07348g8.654ON9092914436e-44
KLLA0F11319g8.668ON8432854408e-44
TPHA0G016308.668ON8712784409e-44
ACR133C8.668ON8512844381e-43
KLTH0D11044g8.668ON8492724362e-43
Skud_16.1328.668ON9242824382e-43
YPL150W8.668ON9012824363e-43
SAKL0D07656g1.374ON4322704173e-43
Smik_6.3478.668ON9172814355e-43
Kpol_1072.198.668ON8962794346e-43
NDAI0G053001.374ON4372734131e-42
Kwal_56.224766.31ON6972294262e-42
Suva_16.1608.668ON9182934312e-42
TPHA0O011201.374ON4292994112e-42
NCAS0D006301.374ON4272774103e-42
KLTH0C10912g6.31ON6972294243e-42
NDAI0H035201.374ON4582714123e-42
TPHA0E028206.222ON3842494063e-42
Kwal_0.961.374ON4272714094e-42
KNAG0I014801.374ON4402794104e-42
NCAS0D021006.31ON7262074226e-42
Suva_15.1551.374ON4523044097e-42
KNAG0D010906.222ON3722774038e-42
KLLA0F11143g8.676ON8132764238e-42
Suva_6.781.374ON4452784071e-41
CAGL0F04741g1.374ON4423324071e-41
Skud_16.1298.676ON8273114221e-41
NDAI0C026806.31ON7502074201e-41
SAKL0H06534g8.676ON8042814192e-41
Smik_6.3508.676ON8222864193e-41
KLTH0D11242g8.676ON7952794183e-41
YOL016C (CMK2)1.374ON4473044033e-41
SAKL0E05984g2.352ON5052924064e-41
YPL153C (RAD53)8.676ON8213104174e-41
NDAI0E021108.676ON9032874194e-41
TPHA0J004206.31ON7073084145e-41
Kpol_1065.36.222ON3762893966e-41
CAGL0J11638g6.31ON7462084139e-41
Kpol_1069.131.374ON4272773981e-40
Suva_16.1578.676ON8323164141e-40
YFR014C (CMK1)1.374ON4462793981e-40
Skud_15.1441.374ON4492763981e-40
Skud_6.891.374ON4462803982e-40
KLTH0H11396g1.374ON4372723972e-40
Kwal_26.87968.676ON7962794122e-40
AAR009W1.374ON4532683972e-40
KAFR0G026906.31ON7132234092e-40
KLLA0F23155g1.374ON4272703952e-40
TDEL0B063201.374ON4442873953e-40
KNAG0J017008.676ON8202844103e-40
Smik_15.1531.374ON4423043954e-40
ACL006W6.31ON7082094074e-40
Ecym_30356.31ON7402094074e-40
Skud_13.1546.31ON7052094065e-40
Kpol_1037.206.31ON7042354065e-40
KAFR0H024308.676ON7842814085e-40
Suva_13.1636.31ON7052414057e-40
YMR001C (CDC5)6.31ON7052094057e-40
Smik_13.1596.31ON7052094048e-40
Smik_7.3191.374ON4462803911e-39
NCAS0A088801.374ON4222733901e-39
KNAG0E008506.31ON7112184022e-39
Kwal_56.237178.279ON8582284052e-39
TDEL0G043806.31ON7222294022e-39
SAKL0E01584g6.31ON6952314012e-39
Ecym_12751.374ON4512713892e-39
TDEL0A062208.676ON7942814033e-39
ACR142W8.676ON8372854033e-39
CAGL0L07326g2.352ON5063123913e-39
TBLA0D050101.374ON4342763874e-39
KLLA0C06138g6.31ON7082313994e-39
CAGL0K10604g1.374ON4462773875e-39
NCAS0C013708.676ON7992794005e-39
KLLA0E01585g2.352ON5122923906e-39
TPHA0G016008.676ON8452804006e-39
CAGL0M02233g8.676ON7672953988e-39
TDEL0G028202.352ON4972973879e-39
AFL188C2.352ON4723283861e-38
Kpol_1004.192.352ON4942923871e-38
TBLA0B004906.31ON7873103961e-38
YDL101C (DUN1)2.352ON5133113862e-38
KAFR0I020101.374ON4322773802e-38
KAFR0C044801.374ON4352913802e-38
ZYRO0C07480g6.31ON7742293933e-38
Smik_4.1352.352ON5133143843e-38
NCAS0B044906.222ON3492553734e-38
KAFR0H025108.668ON8792813944e-38
TBLA0B038408.676ON8582803935e-38
Kpol_1072.168.676ON7952813916e-38
TPHA0F024306.31ON7982813872e-37
Ecym_23978.676ON8722803882e-37
Kpol_1023.266.31ON7392103853e-37
Suva_4.1452.352ON5143113764e-37
CAGL0I09504g1.336ON5283143764e-37
Ecym_56242.352ON4542963724e-37
TPHA0C045702.352ON5262953755e-37
TBLA0A020506.222ON4342763697e-37
ZYRO0F07370g8.676ON7622803819e-37
ZYRO0E07018g6.222ON3672583631e-36
Skud_4.1542.352ON5133133721e-36
ZYRO0E05588g1.374ON4712773682e-36
KLTH0F09988g2.352ON4122963642e-36
KAFR0B054108.279ON5392833703e-36
CAGL0G09020g6.214ON3612713584e-36
TBLA0A020306.214ON4032743615e-36
Skud_16.766.214ON3822693595e-36
TDEL0D053203.92ON10572953786e-36
YPL203W (TPK2)6.214ON3802773587e-36
Kwal_23.35902.352ON4992923657e-36
Kwal_56.240916.222ON3812573588e-36
Smik_6.4086.214ON3812693578e-36
KLTH0H04180g6.214ON3532713551e-35
CAGL0E05720g6.222ON3582723551e-35
ZYRO0A07546g2.352ON4942903622e-35
KLTH0H03982g6.222ON3982573562e-35
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0F00290
         (1125 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...  2122   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...  1140   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...  1119   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1062   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1054   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1045   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1041   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...  1031   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...  1009   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   989   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   977   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   971   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   947   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   945   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   931   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    913   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   917   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   756   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   738   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   728   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   705   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   681   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   686   0.0  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   626   0.0  
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   403   e-119
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   400   e-118
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   394   e-118
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   392   e-115
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   394   e-115
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   392   e-115
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   388   e-114
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   384   e-114
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   385   e-113
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   387   e-113
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   384   e-112
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   379   e-112
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   379   e-111
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   380   e-110
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   376   e-109
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   374   e-109
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   373   e-108
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   373   e-108
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   328   5e-93
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   317   3e-89
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   247   2e-75
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   257   4e-73
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   255   1e-72
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   254   4e-72
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   253   7e-72
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   252   2e-71
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   252   2e-71
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   251   3e-71
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   252   3e-71
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   251   3e-71
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   251   8e-71
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   250   1e-70
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              250   1e-70
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   250   2e-70
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   250   4e-70
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   248   4e-70
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   247   9e-70
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   247   1e-69
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   246   1e-69
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   246   1e-69
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   246   2e-69
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   245   2e-69
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   244   1e-68
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   202   3e-53
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   203   5e-53
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   201   1e-52
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   203   1e-52
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   201   2e-52
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   199   4e-52
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              199   7e-52
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   201   8e-52
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   197   2e-51
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   198   3e-51
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   194   1e-50
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    194   2e-50
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   194   2e-50
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   190   3e-50
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             196   3e-50
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   195   4e-50
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    192   5e-50
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   194   5e-50
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   189   6e-50
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   191   7e-50
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   194   9e-50
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   194   1e-49
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   191   1e-49
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   191   1e-49
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             193   2e-49
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   191   2e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   192   2e-49
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   191   3e-49
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   191   3e-49
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   192   3e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   192   4e-49
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   192   4e-49
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   191   5e-49
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   187   6e-49
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   189   7e-49
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   189   7e-49
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   189   9e-49
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   191   1e-48
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   190   2e-48
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   188   2e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   190   2e-48
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   189   3e-48
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   189   3e-48
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   187   3e-48
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   187   3e-48
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   188   4e-48
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   189   4e-48
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   188   5e-48
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   186   5e-48
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   188   5e-48
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   183   9e-48
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   186   1e-47
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   187   1e-47
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   187   2e-47
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   187   2e-47
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   184   5e-47
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   184   7e-47
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   184   1e-46
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   182   2e-46
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   183   2e-46
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   182   3e-46
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   182   3e-46
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   180   1e-45
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   179   2e-45
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   177   2e-44
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   176   3e-44
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   175   3e-44
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   174   4e-44
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   175   6e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   174   8e-44
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   174   9e-44
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   173   1e-43
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   172   2e-43
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   173   2e-43
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   172   3e-43
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   165   3e-43
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   172   5e-43
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   171   6e-43
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   163   1e-42
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   168   2e-42
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   170   2e-42
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   162   2e-42
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   162   3e-42
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   167   3e-42
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              163   3e-42
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   160   3e-42
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   162   4e-42
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   162   4e-42
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     167   6e-42
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   162   7e-42
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   159   8e-42
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   167   8e-42
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   161   1e-41
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   161   1e-41
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   167   1e-41
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   166   1e-41
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   166   2e-41
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   166   3e-41
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   165   3e-41
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   159   3e-41
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   160   4e-41
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   165   4e-41
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   166   4e-41
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   164   5e-41
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   157   6e-41
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   163   9e-41
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   157   1e-40
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   164   1e-40
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   157   1e-40
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   157   1e-40
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   157   2e-40
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   157   2e-40
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   163   2e-40
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   157   2e-40
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   162   2e-40
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   156   2e-40
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   156   3e-40
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             162   3e-40
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   156   4e-40
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   161   4e-40
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   161   4e-40
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   160   5e-40
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   160   5e-40
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   161   5e-40
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   160   7e-40
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   160   7e-40
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   160   8e-40
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   155   1e-39
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   154   1e-39
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   159   2e-39
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   160   2e-39
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   159   2e-39
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   159   2e-39
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   154   2e-39
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   159   3e-39
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   159   3e-39
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   155   3e-39
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   153   4e-39
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   158   4e-39
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   153   5e-39
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   158   5e-39
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   154   6e-39
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   158   6e-39
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   157   8e-39
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   153   9e-39
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   153   1e-38
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   153   1e-38
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   157   1e-38
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   153   2e-38
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   150   2e-38
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   150   2e-38
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   155   3e-38
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   152   3e-38
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    148   4e-38
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   156   4e-38
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   155   5e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   155   6e-38
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   153   2e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   154   2e-37
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   152   3e-37
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   149   4e-37
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   149   4e-37
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   147   4e-37
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   149   5e-37
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              146   7e-37
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   151   9e-37
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   144   1e-36
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   147   1e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   146   2e-36
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   144   2e-36
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   147   3e-36
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   142   4e-36
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   143   5e-36
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   142   5e-36
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   150   6e-36
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   142   7e-36
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   145   7e-36
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   142   8e-36
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   142   8e-36
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   141   1e-35
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   141   1e-35
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   144   2e-35
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   141   2e-35
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   143   2e-35
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   141   2e-35
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   140   3e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   3e-35
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   147   3e-35
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   143   3e-35
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   140   4e-35
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              140   4e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   140   4e-35
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   139   4e-35
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   140   5e-35
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   140   5e-35
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   141   7e-35
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   143   7e-35
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   139   7e-35
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   139   8e-35
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   142   8e-35
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   139   8e-35
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   140   1e-34
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   138   1e-34
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   139   1e-34
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   141   1e-34
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   145   1e-34
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   141   2e-34
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   139   2e-34
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   139   2e-34
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   145   2e-34
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   137   2e-34
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   138   3e-34
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   138   3e-34
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   138   3e-34
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   138   3e-34
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   137   3e-34
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   136   5e-34
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              136   5e-34
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   137   6e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      137   7e-34
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   140   7e-34
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              140   8e-34
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   135   8e-34
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   139   9e-34
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   142   1e-33
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   135   1e-33
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   134   1e-33
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   134   2e-33
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   135   2e-33
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   135   2e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   141   2e-33
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   141   2e-33
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   134   2e-33
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   135   2e-33
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   135   2e-33
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   134   3e-33
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   135   3e-33
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   134   3e-33
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   136   3e-33
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   137   4e-33
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   137   4e-33
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   141   4e-33
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   135   4e-33
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   134   5e-33
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   134   5e-33
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   137   6e-33
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   133   6e-33
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   140   6e-33
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   137   1e-32
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   133   2e-32
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    131   2e-32
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   137   3e-32
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   137   3e-32
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   138   3e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   134   4e-32
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   138   4e-32
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   131   4e-32
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   131   4e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   131   4e-32
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   131   5e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   137   5e-32
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   137   6e-32
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   137   6e-32
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   131   6e-32
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   136   6e-32
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   137   7e-32
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   135   1e-31
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   136   1e-31
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   134   1e-31
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   135   2e-31
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   129   2e-31
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   135   2e-31
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   135   2e-31
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   135   2e-31
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   135   3e-31
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   135   3e-31
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   134   3e-31
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   135   3e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   134   3e-31
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   135   3e-31
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   135   4e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   134   4e-31
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   131   5e-31
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   134   5e-31
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   130   5e-31
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   134   6e-31
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              133   7e-31
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   130   7e-31
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   133   8e-31
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   133   9e-31
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   133   9e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   128   9e-31
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   132   9e-31
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   133   1e-30
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   132   1e-30
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   131   2e-30
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   132   2e-30
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   130   2e-30
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   132   2e-30
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   132   2e-30
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   129   2e-30
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   132   2e-30
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   130   3e-30
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   131   3e-30
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   129   3e-30
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   132   3e-30
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   130   3e-30
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   131   3e-30
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   130   3e-30
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   130   3e-30
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   131   3e-30
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   131   4e-30
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   131   4e-30
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   131   4e-30
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             130   4e-30
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   130   4e-30
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   127   4e-30
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    130   5e-30
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   130   5e-30
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   126   5e-30
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   131   5e-30
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   128   5e-30
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   130   5e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   6e-30
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   130   6e-30
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   130   6e-30
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   130   6e-30
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   129   7e-30
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   122   7e-30
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   129   8e-30
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   129   8e-30
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   128   8e-30
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   129   9e-30
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   130   9e-30
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   130   9e-30
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   128   9e-30
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   130   9e-30
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   130   1e-29
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   129   1e-29
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   130   1e-29
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   127   1e-29
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   124   1e-29
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   129   1e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   129   1e-29
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   130   1e-29
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   129   1e-29
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   129   1e-29
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   129   2e-29
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   129   2e-29
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   129   2e-29
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   127   2e-29
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   129   2e-29
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   129   2e-29
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   129   2e-29
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   128   2e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   127   2e-29
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   127   2e-29
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   125   2e-29
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   129   2e-29
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   124   3e-29
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   127   3e-29
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   129   3e-29
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   128   3e-29
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   128   3e-29
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   128   3e-29
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   120   3e-29
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   128   3e-29
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   128   3e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   128   3e-29
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   127   3e-29
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   125   3e-29
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   127   3e-29
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   125   3e-29
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   128   4e-29
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   127   4e-29
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   127   5e-29
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   124   5e-29
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   126   5e-29
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   120   5e-29
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   127   5e-29
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   126   5e-29
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   127   5e-29
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   127   6e-29
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   124   6e-29
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   126   6e-29
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   125   6e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   125   6e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   125   6e-29
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   124   7e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   124   7e-29
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   127   7e-29
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   127   7e-29
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   127   7e-29
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   125   8e-29
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   125   9e-29
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   127   9e-29
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   127   9e-29
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   126   9e-29
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   127   9e-29
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   125   1e-28
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   126   1e-28
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   125   1e-28
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   123   1e-28
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   126   1e-28
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   124   1e-28
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   126   1e-28
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   125   1e-28
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   123   1e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   124   1e-28
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   126   2e-28
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   125   2e-28
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   125   2e-28
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   125   2e-28
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   125   2e-28
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   122   2e-28
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   125   2e-28
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   124   2e-28
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   126   2e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   125   2e-28
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   124   2e-28
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   125   2e-28
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   122   2e-28
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   124   3e-28
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   122   3e-28
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   124   3e-28
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   125   3e-28
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   124   3e-28
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   124   3e-28
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   124   3e-28
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   124   3e-28
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   124   3e-28
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   124   3e-28
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   125   4e-28
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   124   4e-28
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   124   4e-28
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   121   4e-28
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   123   4e-28
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   125   4e-28
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   121   4e-28
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   122   4e-28
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   124   4e-28
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   124   4e-28
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   124   4e-28
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   121   5e-28
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   124   5e-28
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   124   5e-28
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   123   5e-28
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   124   6e-28
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   123   6e-28
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   123   6e-28
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   123   6e-28
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   123   6e-28
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   123   7e-28
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   117   7e-28
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     124   7e-28
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   121   7e-28
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   122   7e-28
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   123   8e-28
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   123   8e-28
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   123   8e-28
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   124   8e-28
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   124   8e-28
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   122   8e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   122   9e-28
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   124   9e-28
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   124   9e-28
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   120   1e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   123   1e-27
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   121   1e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   123   1e-27
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   122   1e-27
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   123   1e-27
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   123   1e-27
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   122   1e-27
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   121   1e-27
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   122   1e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   122   1e-27
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   123   1e-27
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   121   1e-27
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   122   1e-27
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   123   1e-27
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   121   1e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    122   1e-27
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   120   1e-27
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   115   1e-27
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   115   1e-27
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   122   2e-27
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   115   2e-27
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   120   2e-27
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   121   2e-27
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   122   2e-27
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   122   2e-27
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             121   2e-27
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   122   2e-27
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   122   2e-27
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   121   2e-27
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   122   2e-27
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   122   2e-27
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   122   2e-27
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   121   2e-27
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   122   2e-27
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   122   2e-27
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   120   3e-27
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   120   3e-27
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   119   3e-27
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   120   3e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   121   3e-27
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   121   3e-27
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   117   3e-27
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   121   4e-27
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   122   4e-27
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   121   4e-27
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   121   5e-27
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   121   5e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   119   5e-27
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   118   5e-27
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   120   5e-27
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            120   5e-27
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   120   5e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   5e-27
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   121   6e-27
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   120   6e-27
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   114   6e-27
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   121   6e-27
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   118   7e-27
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   121   7e-27
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   120   7e-27
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   120   7e-27
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   120   8e-27
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   119   8e-27
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   120   8e-27
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   119   8e-27
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             120   8e-27
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   120   9e-27
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   120   9e-27
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   118   9e-27
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              119   9e-27
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   119   9e-27
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   114   1e-26
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   117   1e-26
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      120   1e-26
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   120   1e-26
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   120   1e-26
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   113   1e-26
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   119   1e-26
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   120   1e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   119   1e-26
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   120   1e-26
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   120   1e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   117   1e-26
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    118   1e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   117   2e-26
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   119   2e-26
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   119   2e-26
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   119   2e-26
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   118   2e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   119   2e-26
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   118   2e-26
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   118   2e-26
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   112   2e-26
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   117   2e-26
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   118   2e-26
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   116   2e-26
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   118   2e-26
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   112   2e-26
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   119   3e-26
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                115   3e-26
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   115   3e-26
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    114   3e-26
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   118   3e-26
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   117   3e-26
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   118   3e-26
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   114   3e-26
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   117   3e-26
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   117   3e-26
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   118   4e-26
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   118   4e-26
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   117   4e-26
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   114   5e-26
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   118   5e-26
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   117   5e-26
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   117   5e-26
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   113   5e-26
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   117   5e-26
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   111   5e-26
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   117   6e-26
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   114   6e-26
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   117   6e-26
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   117   6e-26
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   117   7e-26
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   111   7e-26
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   117   7e-26
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   116   7e-26
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   115   8e-26
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   117   8e-26
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   110   8e-26
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   117   9e-26
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   117   9e-26
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   117   9e-26
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   116   9e-26
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   117   9e-26
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   114   9e-26
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   117   1e-25
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   113   1e-25
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   114   1e-25
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   116   1e-25
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   113   1e-25
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   115   1e-25
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   114   1e-25
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   116   1e-25
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   115   1e-25
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   116   1e-25
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   113   1e-25
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   113   1e-25
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   114   1e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   114   1e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   114   1e-25
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   115   1e-25
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   110   1e-25
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   112   1e-25
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   114   1e-25
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   115   1e-25
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   115   1e-25
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   115   2e-25
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   116   2e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   115   2e-25
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   113   2e-25
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   113   2e-25
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   116   2e-25
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   115   2e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   114   2e-25
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   115   2e-25
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   113   2e-25
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   112   2e-25
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   115   2e-25
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   115   2e-25
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   109   2e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   113   3e-25
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   113   3e-25
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   110   3e-25
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   114   3e-25
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   113   3e-25
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   114   3e-25
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   115   3e-25
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   110   3e-25
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   114   3e-25
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   112   4e-25
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   114   4e-25
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   115   4e-25
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   113   4e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   114   4e-25
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   114   4e-25
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   114   4e-25
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    114   4e-25
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   115   4e-25
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   114   4e-25
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   112   5e-25
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   110   5e-25
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   113   5e-25
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   108   5e-25
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   113   5e-25
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   114   5e-25
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    114   6e-25
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   110   6e-25
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   111   7e-25
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   111   7e-25
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   112   7e-25
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   113   7e-25
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   113   8e-25
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   113   9e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   113   9e-25
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   113   1e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   111   1e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   113   1e-24
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   111   1e-24
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   113   1e-24
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   108   1e-24
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   112   1e-24
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   113   1e-24
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   112   1e-24
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   112   1e-24
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   112   1e-24
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   112   1e-24
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   112   1e-24
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   108   1e-24
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   110   1e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   111   1e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   111   2e-24
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   109   2e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   111   2e-24
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   110   2e-24
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   110   2e-24
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   110   2e-24
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              111   2e-24
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   110   2e-24
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   110   2e-24
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   112   2e-24
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   111   2e-24
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   110   2e-24
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   112   2e-24
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   112   2e-24
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   108   2e-24
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   108   2e-24
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   112   2e-24
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   110   3e-24
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   109   3e-24
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...   107   3e-24
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   112   3e-24
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   111   3e-24
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   111   3e-24
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   112   3e-24
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   111   4e-24
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   111   4e-24
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   110   4e-24
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   105   4e-24
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   110   4e-24
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   106   4e-24
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   111   4e-24
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   110   4e-24
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   109   4e-24
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   111   4e-24
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   111   4e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   111   4e-24
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   109   4e-24
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   110   4e-24
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   109   5e-24
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   108   5e-24
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   111   5e-24
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   109   5e-24
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   108   5e-24
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   105   5e-24
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   111   6e-24
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   110   6e-24
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              110   6e-24
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   108   6e-24
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   109   6e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   110   7e-24
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   108   7e-24
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   109   7e-24
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   108   7e-24
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   110   7e-24
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   108   7e-24
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   110   7e-24
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   107   8e-24
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...   106   8e-24
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   108   9e-24
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   110   9e-24
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   104   9e-24
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   106   1e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   109   1e-23
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   109   1e-23
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...   104   1e-23
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   108   1e-23
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   110   1e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   108   1e-23
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   110   1e-23
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   107   1e-23
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   108   1e-23
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   109   1e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   109   1e-23
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   109   1e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   109   2e-23
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   107   2e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   108   2e-23
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   105   2e-23
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   109   2e-23
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   106   2e-23
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...   107   2e-23
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   108   2e-23
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   108   2e-23
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   103   2e-23
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   108   2e-23
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...   103   2e-23
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   107   2e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   107   2e-23
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   105   2e-23
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   107   2e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   108   3e-23
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   108   3e-23
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   107   3e-23
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   105   3e-23
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...   107   3e-23
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   108   3e-23
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   103   3e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   108   3e-23
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   107   4e-23
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   107   4e-23
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   108   4e-23
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   108   4e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   108   4e-23
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   106   4e-23
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   106   5e-23
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   107   5e-23
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   106   5e-23
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   106   5e-23
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   106   5e-23
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...   106   5e-23
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   105   6e-23
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   107   6e-23
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...   102   6e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   107   6e-23
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   107   6e-23
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   107   6e-23
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   107   6e-23
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   107   7e-23
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   103   7e-23
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   105   7e-23
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   107   7e-23
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...   103   8e-23
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   105   8e-23
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...   103   8e-23
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   107   9e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   107   1e-22
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   105   1e-22
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   101   1e-22
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   106   1e-22
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   105   1e-22
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...   105   1e-22
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   107   1e-22
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   105   1e-22
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   107   1e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   104   1e-22
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   104   1e-22
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   106   1e-22
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...   102   2e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   100   2e-22
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   106   2e-22
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             100   2e-22
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   106   2e-22
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...   102   2e-22
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   101   2e-22
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   105   2e-22
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    104   2e-22
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...   104   2e-22
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   103   2e-22
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...   100   2e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   105   2e-22
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...   104   2e-22
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   106   2e-22
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   105   2e-22
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   104   3e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   103   3e-22
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   105   3e-22
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   105   3e-22
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   105   3e-22
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...   100   3e-22
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   105   3e-22
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   105   3e-22
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   105   3e-22
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...   102   3e-22
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   100   3e-22
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   105   3e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   105   3e-22
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   102   4e-22
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   105   4e-22
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...   100   4e-22
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   105   4e-22
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   105   4e-22
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   105   4e-22
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   104   4e-22
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...   100   5e-22
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   100   5e-22
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   105   5e-22
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   104   5e-22
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   104   6e-22
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    104   6e-22
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...   102   6e-22
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   104   6e-22
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   100   6e-22
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...   102   7e-22
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   104   7e-22
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...   100   7e-22
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   100   8e-22
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   102   8e-22
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    98   8e-22
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   103   8e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   102   8e-22
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   103   9e-22
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    97   9e-22
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....   102   9e-22
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   102   1e-21
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    99   1e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   102   1e-21
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   102   1e-21
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    99   1e-21
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...   102   1e-21
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    103   1e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   101   1e-21
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    100   1e-21
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   103   1e-21
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   101   1e-21
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...   102   1e-21
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    99   1e-21
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   103   1e-21
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   103   1e-21
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...   102   2e-21
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   103   2e-21
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   102   2e-21
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...   102   2e-21
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    99   2e-21
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    99   2e-21
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...   101   2e-21
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   100   2e-21
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    98   2e-21
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   103   2e-21
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   103   2e-21
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    99   2e-21
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   102   2e-21
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    99   3e-21
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    97   3e-21
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...   100   3e-21
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...   100   3e-21
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   100   3e-21
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   102   3e-21
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   102   3e-21
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...   101   4e-21
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    98   4e-21
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...   100   4e-21
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...   101   5e-21
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...   100   5e-21
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   100   5e-21
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    98   5e-21
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...   101   5e-21
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...   100   5e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   100   5e-21
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   100   5e-21
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    97   5e-21
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    97   5e-21
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   101   5e-21
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    97   6e-21
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    99   6e-21
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    99   6e-21
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   100   6e-21
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...   100   6e-21
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   101   6e-21
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    97   7e-21
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   100   7e-21
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    96   7e-21
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    97   7e-21
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   100   7e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    99   7e-21
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    97   7e-21
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...   100   8e-21
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    96   8e-21
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   101   8e-21
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    97   8e-21
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    99   8e-21
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   100   8e-21
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    99   9e-21
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    96   1e-20
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    97   1e-20
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    99   1e-20
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   100   1e-20
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   100   1e-20
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    97   1e-20
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    96   1e-20
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    99   1e-20
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    98   1e-20
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    99   1e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    98   1e-20
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   100   1e-20
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    95   1e-20
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    99   1e-20
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        99   1e-20
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     98   2e-20
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    98   2e-20
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    95   2e-20
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    98   2e-20
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   100   2e-20
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...   100   2e-20
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    99   2e-20
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    98   2e-20
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    97   2e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    99   2e-20
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   100   2e-20
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...   100   2e-20
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    98   2e-20
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   100   2e-20
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    96   3e-20
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    96   3e-20
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    97   3e-20
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       99   3e-20
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    98   3e-20
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...   100   3e-20
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    99   3e-20
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    97   3e-20
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    99   3e-20
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    99   3e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      98   3e-20
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    98   3e-20
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    97   4e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    99   4e-20
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    98   4e-20
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    99   4e-20
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    94   4e-20
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    99   4e-20
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    98   5e-20
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    95   5e-20
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    98   5e-20
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    97   5e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    97   6e-20
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    97   6e-20
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    96   6e-20
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    98   7e-20
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    98   7e-20
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    94   7e-20
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    97   7e-20
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    97   8e-20
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    96   8e-20
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    95   8e-20
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    96   9e-20
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    98   1e-19
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    96   1e-19
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     94   1e-19
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    94   1e-19
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    97   1e-19
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    96   1e-19
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    96   1e-19
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    96   1e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    93   1e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    97   1e-19
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    92   1e-19
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    96   1e-19
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    92   2e-19
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    91   2e-19
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    96   2e-19
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    96   2e-19
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    95   2e-19
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    97   2e-19
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    96   2e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    95   2e-19
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    92   2e-19
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      96   3e-19
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    93   3e-19
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    94   3e-19
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    93   3e-19
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    95   3e-19
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    94   3e-19
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    95   3e-19
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    93   4e-19
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    94   4e-19
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    96   4e-19
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    94   4e-19
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    95   5e-19
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    94   5e-19
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    95   5e-19
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    95   5e-19
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    95   5e-19
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    95   5e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    95   5e-19
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    94   5e-19
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    93   6e-19
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    93   6e-19
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    94   6e-19
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    94   6e-19
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    91   6e-19
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    93   6e-19
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    94   6e-19
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    94   6e-19
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    92   6e-19
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    95   6e-19
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    95   7e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    93   7e-19
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    94   7e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    93   7e-19
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    94   7e-19
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    93   7e-19
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    94   7e-19
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    94   7e-19
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    94   7e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    94   7e-19
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    93   8e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    94   8e-19
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    94   8e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    94   8e-19
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    94   9e-19
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    94   9e-19
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    91   1e-18
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    92   1e-18
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    93   1e-18
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    94   1e-18
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    93   1e-18
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    94   1e-18
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    94   1e-18
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    92   1e-18
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    94   1e-18
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    92   1e-18
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    92   1e-18
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    92   1e-18
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    93   1e-18
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     91   1e-18
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    94   1e-18
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    92   1e-18
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    94   1e-18
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    93   1e-18
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    92   1e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    94   2e-18
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    91   2e-18
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    94   2e-18
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    92   2e-18
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    92   2e-18
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    92   2e-18
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    93   2e-18
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    92   2e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    93   2e-18
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    92   2e-18
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    92   2e-18
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    92   2e-18
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    93   2e-18
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    92   2e-18
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    93   2e-18
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    92   2e-18
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    94   2e-18
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    93   2e-18
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    90   2e-18
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    90   2e-18
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    92   2e-18
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    92   2e-18
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    90   2e-18
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    93   2e-18
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    91   3e-18
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    92   3e-18
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    90   3e-18
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    92   3e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    92   3e-18
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    91   3e-18
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    92   3e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    91   3e-18
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    92   3e-18
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    91   3e-18
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    93   3e-18
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    92   3e-18
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    92   3e-18
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    93   4e-18
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    93   4e-18
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    87   4e-18
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    93   4e-18
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    90   4e-18
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    93   4e-18
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     91   4e-18
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    92   4e-18
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    92   4e-18
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    92   4e-18
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    91   4e-18
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    91   4e-18
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    92   5e-18
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    89   5e-18
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    91   5e-18
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    91   5e-18
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    91   5e-18
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    92   5e-18
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    91   5e-18
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    92   5e-18
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    92   6e-18
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    90   6e-18
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    92   6e-18
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    91   6e-18
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    91   6e-18
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    90   6e-18
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    90   6e-18
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    91   6e-18
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    92   6e-18
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    91   6e-18
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    92   6e-18
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    92   6e-18
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    90   7e-18
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    92   7e-18
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    90   7e-18
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    90   7e-18
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    89   7e-18
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    91   7e-18
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    90   7e-18
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    90   7e-18
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    91   7e-18
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    90   7e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    92   8e-18
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    90   8e-18
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    91   9e-18
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    91   9e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    91   9e-18
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    90   9e-18
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     91   9e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    90   9e-18
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    91   1e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    88   1e-17
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    88   1e-17
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    91   1e-17
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    90   1e-17
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    89   1e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    89   1e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               91   1e-17
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    91   1e-17
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    90   1e-17
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    90   1e-17
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    89   1e-17
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    91   2e-17
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    87   2e-17
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    87   2e-17
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    89   2e-17
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    87   2e-17
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    89   2e-17
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    90   2e-17
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    91   2e-17
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    87   2e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    88   2e-17
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    89   2e-17
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    90   2e-17
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    90   2e-17
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    90   2e-17
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    89   2e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    89   2e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    90   2e-17
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    90   2e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    89   2e-17
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    89   2e-17
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    90   2e-17
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    89   3e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    89   3e-17
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    89   3e-17
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    90   3e-17
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    89   3e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    89   3e-17
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    88   3e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    88   4e-17
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    89   4e-17
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    88   4e-17
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              89   4e-17
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    89   4e-17
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    89   4e-17
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    89   5e-17
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    88   5e-17
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    88   5e-17
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    89   5e-17
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    88   5e-17
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    87   5e-17
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    88   5e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    87   5e-17
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    87   5e-17
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    88   6e-17
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    87   6e-17
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    88   6e-17
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    88   7e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    88   7e-17
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    88   7e-17
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    88   7e-17
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    87   7e-17
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    88   8e-17
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    87   8e-17
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              87   8e-17
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    86   9e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    87   9e-17
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    87   1e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    87   1e-16
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    87   1e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     86   1e-16
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    87   1e-16
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     86   1e-16
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    86   1e-16
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    87   1e-16
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    87   1e-16
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    87   1e-16
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    86   1e-16
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    85   1e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    87   2e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    87   2e-16
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    86   2e-16
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    86   2e-16
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    86   2e-16
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    86   2e-16
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    87   2e-16
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    86   2e-16
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    87   2e-16
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    86   2e-16
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    86   2e-16
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    84   2e-16
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    85   2e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    84   2e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    86   2e-16
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    84   2e-16
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    84   2e-16
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    86   2e-16
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    85   2e-16
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    84   2e-16
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    86   3e-16
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    84   3e-16
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    86   3e-16
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    85   3e-16
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             86   3e-16
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    86   3e-16
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    86   3e-16
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               86   3e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   3e-16
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    86   3e-16
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    85   4e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    83   4e-16
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    86   4e-16
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    85   5e-16
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    85   5e-16
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    85   5e-16
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    85   5e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    84   6e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    85   6e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    82   6e-16
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    83   7e-16
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    84   7e-16
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    82   7e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    85   7e-16
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    84   7e-16
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    82   7e-16
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    84   8e-16
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    82   8e-16
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    84   8e-16
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    84   9e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    84   9e-16
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    84   9e-16
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    84   9e-16
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    83   9e-16
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    84   1e-15
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    84   1e-15
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    84   1e-15
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    84   1e-15
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    83   1e-15
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    82   1e-15
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    83   1e-15
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    82   1e-15
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    83   1e-15
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    84   1e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    81   1e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    80   2e-15
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    83   2e-15
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    81   2e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     84   2e-15
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    83   2e-15
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    83   2e-15
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    82   2e-15
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    82   2e-15
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    83   2e-15
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    83   2e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    81   2e-15
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    81   2e-15
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    83   2e-15
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    83   2e-15
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    82   2e-15
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    80   2e-15
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    83   2e-15
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    83   2e-15
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    80   2e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    83   3e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   3e-15
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     82   3e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    81   3e-15
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    82   3e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   3e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    83   3e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    80   3e-15
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    82   3e-15
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    81   3e-15
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    82   3e-15
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    80   3e-15
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    80   3e-15
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    82   4e-15
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    82   4e-15
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    82   4e-15
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    82   4e-15
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    80   4e-15
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    82   4e-15
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    82   4e-15
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    82   4e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    82   4e-15
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    82   5e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    80   5e-15
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      82   5e-15
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    81   5e-15
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    81   5e-15
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    81   5e-15
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    80   5e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     82   5e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    80   6e-15
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    80   6e-15
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    80   6e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    82   6e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    79   7e-15
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    81   7e-15
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    82   7e-15
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    79   7e-15
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    81   7e-15
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    80   8e-15
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    81   8e-15
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              81   8e-15
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    80   8e-15
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    81   8e-15
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    81   8e-15
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    81   8e-15
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    81   9e-15
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    81   9e-15
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    80   9e-15
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    79   1e-14
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    80   1e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     81   1e-14
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    79   1e-14
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    80   1e-14
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    79   1e-14
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              81   1e-14
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    80   1e-14
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    81   1e-14
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    80   1e-14
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    79   1e-14
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    80   1e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    80   1e-14
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    80   1e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    80   1e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    80   1e-14
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    80   1e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    79   1e-14
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    80   2e-14
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    80   2e-14
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    78   2e-14
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    80   2e-14
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    80   2e-14
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    80   2e-14
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    80   2e-14
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    80   2e-14
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    80   2e-14
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    80   2e-14
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    80   2e-14
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    79   2e-14
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    80   2e-14
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      80   2e-14
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    79   2e-14
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    79   2e-14
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    80   3e-14
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    79   3e-14
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    79   3e-14
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    80   3e-14
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    77   3e-14
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    77   3e-14
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    80   3e-14
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    79   3e-14
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    77   3e-14
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    79   3e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   3e-14
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    79   4e-14
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    77   4e-14
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    76   4e-14
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    79   4e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    79   4e-14
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    77   4e-14
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    77   4e-14
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    79   4e-14
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    78   5e-14
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    79   5e-14
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    79   5e-14
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    79   5e-14
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    79   6e-14
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    79   6e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    79   6e-14
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    77   7e-14
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    78   7e-14
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    78   7e-14
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    75   8e-14
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    78   8e-14
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    78   8e-14
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    77   8e-14
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    76   9e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    78   9e-14
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    77   9e-14
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    76   9e-14
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    78   9e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    78   1e-13
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    76   1e-13
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    78   1e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    77   1e-13
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    76   1e-13
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    78   1e-13
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    78   1e-13
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    78   1e-13
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    77   1e-13
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    76   1e-13
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    76   1e-13
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    75   1e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    76   1e-13
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    77   1e-13
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    77   1e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    77   1e-13
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    76   1e-13
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    77   2e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    75   2e-13
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    75   2e-13
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    77   2e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    77   2e-13
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    77   2e-13
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    76   2e-13
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    77   2e-13
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    75   2e-13
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    77   2e-13
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    77   2e-13
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    75   2e-13
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    76   2e-13
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    77   2e-13
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    77   2e-13
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    77   2e-13
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    75   2e-13
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    77   2e-13
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    76   2e-13
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    77   2e-13
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    77   2e-13
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    76   2e-13
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    76   2e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    77   3e-13
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    74   3e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    76   3e-13
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    77   3e-13
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    74   3e-13
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    75   3e-13
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    76   3e-13
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    76   4e-13
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    75   4e-13
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    75   4e-13
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               75   4e-13
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    75   4e-13
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    75   5e-13
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    76   5e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    74   5e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    75   5e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    73   5e-13
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    75   5e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    74   5e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    75   6e-13
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    75   6e-13
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    75   7e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    73   7e-13
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    75   7e-13
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    75   8e-13
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    75   9e-13
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               75   9e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    74   9e-13
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    75   1e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    75   1e-12
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    74   1e-12
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               73   1e-12
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      74   1e-12
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    74   1e-12
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    74   1e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    74   1e-12
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    72   1e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    72   1e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    74   2e-12
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    74   2e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    72   2e-12
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    72   2e-12
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    74   2e-12
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    72   2e-12
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    73   2e-12
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    74   2e-12
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    74   2e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    71   2e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    73   2e-12
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    74   2e-12
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    73   2e-12
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    73   2e-12
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    72   2e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    72   3e-12
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    73   3e-12
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    72   3e-12
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    73   3e-12
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    73   3e-12
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    73   3e-12
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    72   3e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    73   3e-12
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    72   3e-12
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    73   3e-12
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    73   3e-12
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    73   3e-12
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    72   3e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    73   3e-12
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    71   4e-12
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    72   4e-12
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    72   4e-12
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    71   4e-12
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    72   5e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    72   5e-12
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    72   5e-12
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    72   6e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    72   6e-12
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    71   6e-12
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    72   6e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    72   7e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     72   7e-12
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    70   7e-12
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               70   7e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    72   8e-12
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    72   8e-12
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    71   8e-12
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    71   8e-12
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    72   8e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    72   9e-12
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    70   9e-12
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    71   9e-12
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    70   9e-12
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    71   9e-12
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    72   9e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    71   1e-11
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    71   1e-11
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    71   1e-11
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    71   1e-11
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    70   1e-11
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    71   1e-11
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    70   1e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    71   1e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   1e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    70   1e-11
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    70   2e-11
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    70   2e-11
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    69   2e-11
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     70   2e-11
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    70   2e-11
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    70   2e-11
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    70   2e-11
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    70   2e-11
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    70   2e-11
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    70   3e-11
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    69   3e-11
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    70   3e-11
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    70   3e-11
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    70   3e-11
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    69   3e-11
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    70   3e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    69   3e-11
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    69   3e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   4e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       69   4e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    68   4e-11
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    69   4e-11
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    69   4e-11
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    69   4e-11
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    69   4e-11
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    69   5e-11
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    69   5e-11
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    69   5e-11
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    69   5e-11
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    69   6e-11
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    69   6e-11
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    68   6e-11
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    69   6e-11
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    69   7e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     68   7e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    68   7e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    67   7e-11
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    67   7e-11
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    68   8e-11
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    68   8e-11
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    69   8e-11
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             67   9e-11
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    68   1e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    68   1e-10
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    68   1e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    68   1e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    67   1e-10
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    67   1e-10
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    67   1e-10
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    67   2e-10
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    67   2e-10
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    67   2e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    67   2e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   2e-10
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    66   2e-10
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    67   2e-10
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    67   2e-10
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    67   2e-10
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    67   2e-10
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    67   2e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    67   2e-10
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    67   2e-10
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    67   3e-10
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    65   3e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    67   3e-10
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    67   3e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    66   3e-10
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    67   3e-10
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    66   4e-10
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    66   4e-10
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    65   5e-10
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    65   5e-10
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    65   5e-10
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    65   5e-10
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    65   5e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    65   6e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    65   6e-10
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    65   7e-10
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    65   7e-10
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    65   7e-10
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    65   8e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    64   8e-10
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    65   9e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    65   1e-09
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    64   1e-09
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    64   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   1e-09
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               64   1e-09
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   1e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    63   2e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    63   2e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    64   2e-09
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    63   2e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    64   2e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    64   2e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    64   2e-09
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    64   2e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    64   2e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    63   3e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    62   3e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    62   3e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    63   3e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    62   3e-09
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    63   3e-09
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    63   4e-09
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    63   4e-09
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    63   4e-09
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    62   4e-09
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    62   5e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    62   5e-09
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    63   5e-09
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    61   6e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    62   6e-09
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    61   7e-09
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    62   7e-09
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    61   7e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    61   8e-09
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    62   9e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    62   9e-09
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   1e-08
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    62   1e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    61   1e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    61   1e-08
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    62   1e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    60   1e-08
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   2e-08
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    60   2e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    60   2e-08
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    60   2e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    59   2e-08
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    60   3e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    59   3e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    60   3e-08
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    59   3e-08
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    60   3e-08
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    60   4e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    59   4e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    59   5e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    59   5e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    58   5e-08
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    58   6e-08
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    59   7e-08
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    59   8e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    59   9e-08
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    57   1e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    58   1e-07
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    58   1e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    57   1e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    58   2e-07
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    57   2e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    57   2e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    57   2e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    57   2e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    57   3e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   3e-07
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    56   3e-07
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    55   5e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    55   6e-07
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    55   6e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    55   7e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    55   7e-07
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               55   8e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    55   9e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    55   1e-06
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    54   1e-06
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    55   1e-06
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    55   1e-06
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    54   1e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    53   2e-06
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    53   2e-06
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    54   3e-06
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    52   3e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    53   3e-06
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    53   3e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    52   4e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    53   4e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    53   5e-06
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    52   6e-06
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    52   7e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    52   7e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    52   8e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   1e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    51   1e-05
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    50   2e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    50   2e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    50   2e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    51   2e-05
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    51   2e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    50   3e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    50   4e-05
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    49   5e-05
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    49   5e-05
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    49   6e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    49   7e-05
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    46   1e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    48   1e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    47   2e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   2e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    47   2e-04
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    47   2e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     47   3e-04
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    47   3e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    46   3e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    47   3e-04
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     46   4e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    46   4e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    46   6e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    46   7e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    45   8e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    45   8e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    44   8e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   0.001
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    45   0.001
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    45   0.001
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    45   0.001
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    44   0.002
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.002
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    44   0.002
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    44   0.002
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    44   0.002
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    44   0.002
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    44   0.003
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    43   0.003
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     43   0.003
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    44   0.004
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    43   0.004
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    43   0.004
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    43   0.004
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    43   0.004
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    43   0.004
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.006
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    42   0.006
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.007
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    42   0.008
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    42   0.008
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    42   0.008
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    42   0.010
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    42   0.010
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.011
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.012
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    42   0.013
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    41   0.014
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    41   0.015
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    41   0.015
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    41   0.015
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    41   0.015
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    41   0.017
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    41   0.018
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    41   0.021
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    41   0.021
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    41   0.023
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    40   0.026
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    40   0.027
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    40   0.027
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    40   0.030
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    40   0.031
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    40   0.032
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    40   0.036
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    40   0.037
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    40   0.037
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    40   0.038
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.038
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.038
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.041
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    40   0.043
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.044
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    40   0.047
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.047
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    40   0.049
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     39   0.051
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.052
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    39   0.054
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.054
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    37   0.056
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    39   0.060
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    39   0.063
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    39   0.070
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    39   0.070
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.071
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    39   0.080
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    39   0.081
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    39   0.082
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    39   0.084
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    39   0.085
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    39   0.086
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    39   0.086
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    39   0.095
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    38   0.10 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    39   0.11 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    38   0.12 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    39   0.12 
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    38   0.13 
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    38   0.14 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    38   0.14 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.15 
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    38   0.15 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    38   0.15 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    38   0.16 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.21 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    38   0.24 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    37   0.28 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.30 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    37   0.34 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.36 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.37 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.39 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    36   0.46 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.47 
Skud_4.409 Chr4 (728373..733340) [4968 bp, 1655 aa] {ON} YDR150W...    37   0.50 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    36   0.51 
Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W...    37   0.51 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    36   0.58 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    36   0.60 
AFR255W Chr6 (896891..898978) [2088 bp, 695 aa] {ON} Syntenic ho...    36   0.61 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    36   0.64 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    35   0.84 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    35   1.2  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   1.2  
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   1.2  
Skud_6.47 Chr6 (94340..96613) [2274 bp, 757 aa] {ON} YFL023W (REAL)    35   1.3  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    34   2.4  
Suva_10.350 Chr10 complement(611601..612167) [567 bp, 188 aa] {O...    33   2.6  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   2.7  
KAFR0K01730 Chr11 complement(359482..360861) [1380 bp, 459 aa] {...    33   4.8  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   5.2  

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score = 2122 bits (5497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1048/1125 (93%), Positives = 1048/1125 (93%)

Query: 1    MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT 60
            MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT
Sbjct: 1    MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT 60

Query: 61   SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
            SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV
Sbjct: 61   SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120

Query: 121  ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
            ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE
Sbjct: 121  ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180

Query: 181  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL
Sbjct: 181  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240

Query: 241  KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300
            KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN
Sbjct: 241  KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300

Query: 301  LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF 360
            LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF
Sbjct: 301  LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF 360

Query: 361  KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS 420
            KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS
Sbjct: 361  KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS 420

Query: 421  SHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSM 480
            SHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSM
Sbjct: 421  SHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSM 480

Query: 481  ANIQAARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQ 540
            ANIQAARSS            RASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQ
Sbjct: 481  ANIQAARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQ 540

Query: 541  ETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            ETKRTSSNFATLIDEIFEHEKYEQI                                   
Sbjct: 541  ETKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKEREEAERKQKELQEREKQRE 600

Query: 601  XXXXXNETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLR 660
                 NETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLR
Sbjct: 601  RERKENETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLR 660

Query: 661  QRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLG 720
            QRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLG
Sbjct: 661  QRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLG 720

Query: 721  SSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKI 780
            SSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKI
Sbjct: 721  SSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKI 780

Query: 781  SDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATP 840
            SDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATP
Sbjct: 781  SDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATP 840

Query: 841  NSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEAD 900
            NSAGQSEFLF               DGKLY          KKGLRVNLSDRYNKANSEAD
Sbjct: 841  NSAGQSEFLFESVNEEAENTNNTSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSEAD 900

Query: 901  MENKLPILPPLDPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAE 960
            MENKLPILPPLDPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAE
Sbjct: 901  MENKLPILPPLDPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAE 960

Query: 961  NIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLG 1020
            NIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLG
Sbjct: 961  NIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLG 1020

Query: 1021 AEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFE 1080
            AEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFE
Sbjct: 1021 AEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFE 1080

Query: 1081 IIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMITIK 1125
            IIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMITIK
Sbjct: 1081 IIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMITIK 1125

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1162 (55%), Positives = 792/1162 (68%), Gaps = 86/1162 (7%)

Query: 1    MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT 60
            M  +   P+IKGDQ+G WK+GETLGLGSTGKVQLA+NKTTG QAAIKVISK++F +++  
Sbjct: 1    MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQ 60

Query: 61   SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
            S    TTPDALPYGIEREI+IMKLLNH NVLRLYDVWETNSNLYMVLEYAEKGELFNLLV
Sbjct: 61   SS-SLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 119

Query: 121  ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
            E+GPL E EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALETE
Sbjct: 120  EKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 179

Query: 181  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLL
Sbjct: 180  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 239

Query: 241  KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300
            KVQ+G+FEMP DDEIS EAQ+L++KIL V+P +RI ARDILKHPLLQKYPSIKDSKSIRN
Sbjct: 240  KVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRN 299

Query: 301  LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF 360
            LPREDTYL+PL++ NS ID+ ILQNLVVLWHGRD  EI  KLKE GANAEKTLYA+L+RF
Sbjct: 300  LPREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRF 359

Query: 361  KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS 420
            K+D E+EN KNE ++ RQS   S S +PA   ST             R+KNR S+ISV+S
Sbjct: 360  KIDSEKENFKNEQIRKRQSITSSVSRSPAKKASTP-----------QRRKNRISMISVSS 408

Query: 421  SHKRPISFQKLPTL--NSTSSLAAITPSTSARR----KRLSKISGYPVSNVNGSPTPASR 474
            SHK+P SF +L ++  N+ S+ ++ T + ++++    K+LS I+    SN N SPTPA R
Sbjct: 409  SHKKPASFNRLSSVVHNNLSASSSTTTTPASKKFSMNKKLSMIADKSNSN-NSSPTPAHR 467

Query: 475  KKRNSMANIQAARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDE 534
             KR SM N     +             R+SKR+S++ N K G+I +KLI+TYAKLSEDD+
Sbjct: 468  NKRTSMIN-----TDRQSILSKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDD 522

Query: 535  WEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 594
            WEY+E+ETKRTSS+FATLIDEIFEHEKYEQI                             
Sbjct: 523  WEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVRLAKEREEEERRRREEEE 582

Query: 595  XXXXXXXXXXXNETNDRQRIMEEEIENLKKEL--DMMSHEGKTES--RSVSEPLNKKQGG 650
                        +    QR M+EEIENL+ +L  D+  ++ K E   RSVS PL+K    
Sbjct: 583  LHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSK---- 638

Query: 651  VEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAIL 710
             E     LLRQRN +LQTRP SRLDPGLFF S +S T    +   E   + KL TEK IL
Sbjct: 639  -ETVNDNLLRQRNFSLQTRPISRLDPGLFF-SEQSPTEEKPISPDEPVPNKKLDTEKMIL 696

Query: 711  ETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRI 770
            ETIRRSKFLGSSFDI++ELK+A  R      P  V    +  + SD LPK+A+ TA L  
Sbjct: 697  ETIRRSKFLGSSFDINRELKAAEKR---VMQPPTVQKLTTENKSSDELPKHAVGTAAL-- 751

Query: 771  HSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDA 830
            +S   EV KISDI+VPQFTRKSR+F+ S++RLSVLSMYSTRQSF NL D++    +NT+A
Sbjct: 752  NSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDIL----KNTEA 807

Query: 831  AENRGQ-IATPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXXXXXXKKGLRVNLS 889
                GQ   TP+SAG SEF+F               D KLY            G+++N +
Sbjct: 808  GTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNFA 867

Query: 890  DRYNKANSEA-----DMENKLPILPPLDPEIAGLGIYQD----QPEEV------------ 928
            DR+NK   ++     D++NKLP+LPPLD + AGLGIYQ     +P+ +            
Sbjct: 868  DRFNKKEEDSTEPSRDIQNKLPVLPPLDGK-AGLGIYQTSSPIEPQLLERPVKGDKFMET 926

Query: 929  ----NAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQP---PITEKK-KLDAKK 980
                N KP EK+ KS   E   + E    VS ++ +  RK  +    P+ EKK ++ A K
Sbjct: 927  ISSDNEKP-EKEIKSMIPEA--VIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPK 983

Query: 981  QRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYN 1040
            QR     ++ +E   S +F RK S     ++ S  K+K   E  + T ++A Q++ GL  
Sbjct: 984  QR-----ESDQEKKRSVSFFRKFS----GSSISSNKSKAETEKVLVTNIAARQVFDGLRR 1034

Query: 1041 LLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGS 1100
            LL GW  YGLK+++  S  MTI+GKL+S+NILSLRST FEI +   G+ S V I+KKSGS
Sbjct: 1035 LLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGS 1094

Query: 1101 TKAVNRLAGEVKNVLVKEGVMI 1122
            +KAV RL  E++N+  KEGV++
Sbjct: 1095 SKAVLRLTTEIENIFSKEGVLL 1116

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1170 (52%), Positives = 780/1170 (66%), Gaps = 75/1170 (6%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIF--QDSNV 59
            ++N++ PT+KG++IG WK+GETLGLGSTGKVQLAY+++T  QAAIKVISK IF  + S  
Sbjct: 4    MSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVK 63

Query: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
             S V  +TPD+LPYGIEREI+IMKLLNH NVLRLYDVWETNSNLYMVLEYA+KGELFNLL
Sbjct: 64   DSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLL 123

Query: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            VERGPLPE EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALET
Sbjct: 124  VERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALET 183

Query: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL+ALLTGRLPFD+EDGNIRNLL
Sbjct: 184  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLL 243

Query: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
            L+VQ+G++EMP DDEIS +AQ+LI++IL V+P +RI ARDILKHPLLQKYPSI DSKSIR
Sbjct: 244  LQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIR 303

Query: 300  NLPREDTYLHPLAETNSA-IDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLN 358
            NLPREDTYLHPL+E  SA IDENILQNLVVLWHGR+  EI  KL+E GANAEKTLYA+L+
Sbjct: 304  NLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLD 363

Query: 359  RFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISV 418
            RFK D E     N+ +K+ QS  + + + P    +T    S    N +P+++NR S+ISV
Sbjct: 364  RFKSDTE-----NDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISV 418

Query: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNV---NGSPTPASRK 475
            +SSHKRP+SF KL  + S  S+ +   +T ++R  ++  S   +S V   +GSPTPASR 
Sbjct: 419  SSSHKRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRH 478

Query: 476  KRNSMANIQAARSSXX-----------XXXXXXXXXXRASKRVSILPNNKNGTIASKLIS 524
            KR S+ +++  R +                       R + R+S  P+NK G+I +KLIS
Sbjct: 479  KRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLIS 538

Query: 525  TYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXX 584
            TYAKLSEDD+WEY+E+ETKRTSS+FATL D+IFEHEK+EQI                   
Sbjct: 539  TYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKEREE 598

Query: 585  XXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKEL----------DMMSHEGK 634
                                     + QR M+EE+ NL KEL          D     G 
Sbjct: 599  RERREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGA 658

Query: 635  TESRSVSEPLNKK----QGGVEIEVKELLRQRNAALQTRPKSRLDPGLF-FDSAESDTRN 689
               RSVSEPL KK       ++  + +LLRQR  +LQTRP SRLDPG+F  DS+E D   
Sbjct: 659  VNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKD--- 715

Query: 690  PSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSA----SARSDYSRAPG-R 744
               Q    E   KL  +K ILETIRRSKFLGSSFDI+KELK A    + +   S+A   R
Sbjct: 716  ---QYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDR 772

Query: 745  VITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSV 804
            +I+  ++   + +LPKNA A+APL+ H+ Q E RKISDIKVPQFTRKSR F +S+KRLSV
Sbjct: 773  IISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSV 832

Query: 805  LSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPN--SAGQSEFLFXXXXXXXXXXXX 862
            LSMYS++QS+ NL+D++N E+ N      +G   +PN  S  + EFLF            
Sbjct: 833  LSMYSSKQSYTNLADLLNEEASNA-----KGNRDSPNDQSGHEPEFLFENVQEDGEVTGD 887

Query: 863  XXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSE----ADMENKLPILPPLD-PEIAG 917
               DG+LY          +K L++N +DR+  +N E     D   +LP LPPLD  E  G
Sbjct: 888  SSHDGRLYEVPEDSNMTKEK-LKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDGKEAKG 946

Query: 918  LGIYQD------QPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPIT 971
            LGIYQ       +P + N K   +  +++ +ET ++   + +  + + E  ++AP     
Sbjct: 947  LGIYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKED--NAQVERQQEAPLNASI 1004

Query: 972  EKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSA 1031
             K + D  ++     +K   E   + +F RK S  SN  T      +  AE  ++ +V+A
Sbjct: 1005 PKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNG----EFDAE--LYASVAA 1058

Query: 1032 TQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSK 1091
             Q++ GL NLL+GW  YGLK +K   + +T+TGKL+SENILSLRST+FE+++   GKGS 
Sbjct: 1059 KQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSI 1118

Query: 1092 VDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            V  +KKSGSTK + RL  E++ VL+KE V+
Sbjct: 1119 VGFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1169 (52%), Positives = 780/1169 (66%), Gaps = 110/1169 (9%)

Query: 10   IKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV--TSMVDNTT 67
            IK + IG WK+GETLGLGSTGKVQLA NK+TG +AA+KVISK +F   NV  TS+V + T
Sbjct: 11   IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSNT 70

Query: 68   PDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPE 127
            PDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71   PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130

Query: 128  NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETS 187
            NEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALETE KLLETS
Sbjct: 131  NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190

Query: 188  CGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQF 247
            CGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LLLKVQ G+F
Sbjct: 191  CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEF 250

Query: 248  EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTY 307
            E+P DDEIS+EAQ+LISKIL V+P  RI ARDILKHPLLQKYPSI+DSKSIR+LPREDTY
Sbjct: 251  ELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTY 310

Query: 308  LHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQE 367
            L PL+E+NS+ID  ILQNLV+LWHGRDP  IR KL+E GANAEKTLYA+L RFK D ++E
Sbjct: 311  LTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCDTQKE 370

Query: 368  NLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPIS 427
             +K + ++ RQS G S S++P    ST          T  R++NR S+ISV+SS K+PIS
Sbjct: 371  LIKQQQIRKRQSIG-SVSISPPKRTST----------TPQRRRNRESIISVSSSRKKPIS 419

Query: 428  FQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPVSNVN-GSPTPASRKKRNS 479
            F K  T +S SS    TP +S R       +K+LS I       VN  SPTP+SR KR S
Sbjct: 420  FNKF-TASSASSSNLTTPGSSKRLSKNFSSKKKLSTI-------VNQSSPTPSSRNKRTS 471

Query: 480  MANIQ--AARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEY 537
            +AN+     R+S            ++++R+S++P+ K  ++ +KL+STYAKL+EDD+WEY
Sbjct: 472  IANVDKNQKRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEY 531

Query: 538  LEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 597
            +E+ETKRTSSNFATLIDEIFE+EKY+QI                                
Sbjct: 532  IEKETKRTSSNFATLIDEIFEYEKYDQI--------------RKEKEELERKVKEAKALE 577

Query: 598  XXXXXXXXNETNDRQR--IMEEEI----ENLKKELD---------MMSH-EGKTES--RS 639
                     E  +R R  + +EE+    E LKK++D         +++H E K E   RS
Sbjct: 578  ELERRKRKQEEKERARKLLEKEELKRKQEELKKQIDIDISDLEHELINHREEKFEGNIRS 637

Query: 640  VSEPLNKKQGGV---EIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFE 696
            +S P+  ++  +   E ++  +LR+RN +LQTRP SRLDPG+ F S+  +T +P   V  
Sbjct: 638  ISAPMENEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIF-SSPIETEDP---VEP 693

Query: 697  GEVDN-KLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRV----ITAPSN 751
             + +N +L TEK ILETIRRSKFLGSSF+I KELK +        AP R+    I + SN
Sbjct: 694  KKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSDSN 753

Query: 752  LE-RSDVLPKNAIATAPLRIHS--------DQPEVRKISDIKVPQFTRKSRNFSESSKRL 802
             +  S VLPK+A   A L+ ++           E+RKISDI+VPQFTRKSR+FSES+KRL
Sbjct: 754  GKYESLVLPKDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRL 813

Query: 803  SVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXXXXX 862
            SVLSMYST++SF NL D++   + + +  +N+ ++ TP SA  SEFLF            
Sbjct: 814  SVLSMYSTKESFTNLVDILKNGNLDINPQQNQ-RVPTPRSADDSEFLFETVNEEAEYTGN 872

Query: 863  XXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMEN-KLPILPPLD-PEIAGLGI 920
               D +LY          K  L++N +DR+N + +E + +N  LP LPPL+  + AG   
Sbjct: 873  SSNDERLY-DVGDSCIKDKNTLKLNFADRFNGSTNEKETKNLHLPTLPPLNGKDEAGKQG 931

Query: 921  YQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIR--KAPQPPI------TE 972
             + + E+++ +P   K KS   E+  +S  E E  + + +  R  K  +PP+      T 
Sbjct: 932  EEQEKEDLHEQP---KVKSMIPESDSLSHAEKEQKE-REDQQRGGKDLEPPLNKSVQKTR 987

Query: 973  KKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSAT 1032
            +K  D + +      K +K  + + +F RK S  S +   +           ++  VSA 
Sbjct: 988  EKNNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTE----------LYAKVSAK 1037

Query: 1033 QMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKV 1092
            Q++ GL  LLRGW  YGLK++K N  N+T+TGKL+SEN+ SLRST+FE+ I ++GK S V
Sbjct: 1038 QLFNGLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVV 1097

Query: 1093 DIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            + KK SGS K V +L  EV+NVL KEGV+
Sbjct: 1098 EFKKISGSFKTVKKLVKEVENVLNKEGVL 1126

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1171 (51%), Positives = 757/1171 (64%), Gaps = 91/1171 (7%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59
            +   + P IK + IG WK+GETLGLGSTGKVQLA NK+TG +AA+KVISK +F   N+  
Sbjct: 3    VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSG 62

Query: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
            TS+V + TPDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLL
Sbjct: 63   TSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122

Query: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            VERGPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 123  VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182

Query: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            E KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 183  EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242

Query: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
            LKVQ GQFE+P DDE+S+EAQ+LI KIL V+P  RI ARDILKHPLLQKYPSI+DSKSIR
Sbjct: 243  LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIR 302

Query: 300  NLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359
             LPREDTYL PL+E+NS+ID  ILQNLV+LWHGRDP  I+ KLKE GANAEKTLYA+L R
Sbjct: 303  GLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYR 362

Query: 360  FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASVISV 418
            FK D ++E ++ + +K RQS    ++ +P        N+ S    TTP R+KNR S+ISV
Sbjct: 363  FKCDTQKELIRQQQIKKRQSISSVSTSSP--------NKIS----TTPQRRKNRESIISV 410

Query: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPVSNVNGSPTP 471
            TSS K+PISF K  T +S SS    TP +S R       +KRLS I          SPTP
Sbjct: 411  TSSRKKPISFNKF-TASSASSSNLTTPGSSKRLSKNFSSKKRLSTIVN------QASPTP 463

Query: 472  ASRKKRNSMANIQ--AARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKL 529
            ASR KR S+ N+     R+S            R++K++S++P+ K  ++ +KL+STYAKL
Sbjct: 464  ASRNKRTSIINVDKNQRRASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKL 523

Query: 530  SEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXX 589
            + DD+WEY+E+ETKRTSSNFATLIDEIFE+EKYE+I                        
Sbjct: 524  AADDDWEYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRK 583

Query: 590  XXXXXXXXXXXXXXXXNETNDRQRI---MEEEIENLKKELDMMSHEGKTES-RSVSEPLN 645
                                 +Q +   +E +I +L+ EL     E    + RS+S P+ 
Sbjct: 584  RKQEEKEHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPME 643

Query: 646  KKQGGV---EIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNK 702
             ++  +   E+++  +LR+RN +LQTRP SRLDPG+ F S          +  E E   +
Sbjct: 644  SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENE---R 700

Query: 703  LKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPG-----RVITAPSNLERSDV 757
            L TEK ILETIRRSKFLGSSF+I KELK +         P      R+++ PS+   S V
Sbjct: 701  LTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLV 760

Query: 758  LPKNAIATAPLRIHS--------DQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYS 809
            LPK+A   + L  H            E+RKIS+++VPQFTRKSR+FSES+KRLSVLSMYS
Sbjct: 761  LPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYS 820

Query: 810  TRQSFKNLSDMMNFESENTDAAENRGQ-IATPNSAGQSEFLFXXXXXXXXXXXXXXXDGK 868
            +++SF NL D++  ++ N D  + + Q I TP SA  SEFLF               D +
Sbjct: 821  SKESFTNLVDIL--KNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDER 878

Query: 869  LYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMEN-KLPILPPL----------DPEIAG 917
            LY          K  L++N +DR+N + +E + EN  LP LPPL          D ++ G
Sbjct: 879  LY-DVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLG 937

Query: 918  LGIYQDQPEEVNAKPQEKKS----KSKSAETGDISEGEPEVSDLK-AENIRKAPQPPITE 972
            +     QP+  +  PQ   S    K +  E       E +  D K A++I       + +
Sbjct: 938  I-----QPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIEPPLNKSVQK 992

Query: 973  KKKLDAKKQRNDERTKASKENTFSNN--FLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVS 1030
             +  D+  Q      +  K+   S N  F RK S +S+T+ +SV+         ++  VS
Sbjct: 993  TRANDSGPQVKSHPREPKKDRNISGNGSFFRKFS-KSSTSDKSVE---------LYAKVS 1042

Query: 1031 ATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGS 1090
            A Q++ GL  LLRGW  YGLK+IK +  N+T+TGKL+SENI SLRST+FEI I   GK S
Sbjct: 1043 AKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMS 1102

Query: 1091 KVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
             V  KK SG+ KAV +L  EV+NVL KEGV+
Sbjct: 1103 VVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1171 (51%), Positives = 762/1171 (65%), Gaps = 90/1171 (7%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59
            +   + P IK + IG WK+GETLGLGSTGKVQLA NK+TG +AA+KVISKT+F   NV  
Sbjct: 3    VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSG 62

Query: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
            TS+V +TTPDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLL
Sbjct: 63   TSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLL 122

Query: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            VERGPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 123  VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182

Query: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            E KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 183  EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242

Query: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
            LKVQ G+FE+P DDEIS+EAQ+LIS+IL V+P  RI  RDILKHPLLQKYPSIKDSKSIR
Sbjct: 243  LKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIR 302

Query: 300  NLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359
             LPREDTYL PL+E+NS+ID  ILQNLV+LWHGRDP  I+ KL+E GANAEKTLYA+L R
Sbjct: 303  GLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYR 362

Query: 360  FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASVISV 418
            FK D ++E +K + +K RQS             S+     S   +TTP R+KNR S+ISV
Sbjct: 363  FKCDTQKELVKQQQIKKRQS------------ISSLSISPSKKLSTTPQRRKNRESMISV 410

Query: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPVSNVNGSPTP 471
            +SS K+PISF K  T +S SS    TP +S R       +K+LS I          SPTP
Sbjct: 411  SSSRKKPISFNKF-TASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVN------QSSPTP 463

Query: 472  ASRKKRNSMANIQ--AARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKL 529
            ASR KR S+ NI+    R+S            ++ KR+S++P+ K  ++ +KL+STYAKL
Sbjct: 464  ASRNKRASVINIEKNQKRASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKL 523

Query: 530  SEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXX 589
            +EDD+WEY+E+ETKRTSSNFATLIDEIFE+EKYEQI                        
Sbjct: 524  AEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRR 583

Query: 590  XXXXXXXXXXXXXXXXN---ETNDRQRIMEEEIENLKKELDMMSHEGKTES-RSVSEPLN 645
                                +  + ++ +E +I +L++EL     E    + RS+S P+ 
Sbjct: 584  RRQEEKERTRKLLEKEELKMKQEELKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPME 643

Query: 646  KKQGGVE---IEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEV--- 699
             ++  ++    ++  +LR+RN +LQTRP SRLDPG+ F        NP   V+  E    
Sbjct: 644  NEEKNIDHLGTDIDNILRRRNFSLQTRPVSRLDPGIVFS-------NPIETVYPVEPKRS 696

Query: 700  -DNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAP-----GRVITAPSNLE 753
             + +L TEK ILETIRRSKFLGSSF+I KELK +        AP      RV++  +   
Sbjct: 697  ENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGKY 756

Query: 754  RSDVLPKNAIATAPLRI--------HSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVL 805
             S +LPK+A   + L+         H    ++RKIS+++VPQFTRKSR+FSES+KRLS+L
Sbjct: 757  ESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLL 816

Query: 806  SMYSTRQSFKNLSDMMNFESENTDAAENRGQ-IATPNSAGQSEFLFXXXXXXXXXXXXXX 864
            SMYST++SF NL D++  ++ N D    + Q I TP SA  SEFLF              
Sbjct: 817  SMYSTKESFTNLVDIL--KNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSS 874

Query: 865  XDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMEN-KLPILPPL--DPEIAGLGIY 921
             D +LY          K  L++N +DR+N++    + +N  LP LPPL  D E+      
Sbjct: 875  NDERLY-DVGDSTIKDKTALKLNFADRFNESTEYKETDNLHLPSLPPLSGDDEMRKQNSE 933

Query: 922  QD---QPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAP--QPPITEKKKL 976
            +D   QP+  +  PQ       S+ T  + E E E  +++ E+ ++A   +PP      L
Sbjct: 934  EDSLVQPKVKSMIPQS----DSSSHTEKVEEKEGESQEVQEESEKEAKDIEPP------L 983

Query: 977  DAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSV---KKTKLGAEDG---IHTTVS 1030
            +   Q+  E+    +E     + L++     NTT  S    K +K  A D    ++  VS
Sbjct: 984  NKSVQKLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSSASDKLVELYAKVS 1043

Query: 1031 ATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGS 1090
            A Q++ GL  LLRGW  +GLK+IK +  N+T+TGKL+SENI SLRST+FEI I  +G+ S
Sbjct: 1044 ARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMS 1103

Query: 1091 KVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
             V  KK SGS KAV +L  EV+NVL KEGV+
Sbjct: 1104 VVQFKKISGSFKAVKKLVNEVENVLNKEGVL 1134

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1187 (51%), Positives = 749/1187 (63%), Gaps = 116/1187 (9%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59
            I   + P IK + IG WK+GETLGLGSTGKVQLA N +TG +AA+KVISK +F   NV  
Sbjct: 3    INGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSG 62

Query: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
            TS+V +TTPDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLL
Sbjct: 63   TSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122

Query: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            VERGPLPE+EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 123  VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182

Query: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            E KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 183  EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242

Query: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
            LKVQ G+FEMP DDEIS+EAQ+LI KIL V+P  RI  RDILKHPLLQKYPSI+DSKSIR
Sbjct: 243  LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIR 302

Query: 300  NLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359
             LPREDTYL PL+E+NS+ID  ILQNLV+LWHGRDP  I+ KL+E GANAEKTLYA+L R
Sbjct: 303  GLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYR 362

Query: 360  FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASVISV 418
            FK D ++E +K + +K RQS    +                    TTP R++NR S+ISV
Sbjct: 363  FKCDTQKELIKQQQVKKRQSISSVSVSPSKKVS------------TTPQRRRNRESLISV 410

Query: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPVSNVN-GSPT 470
            TSS K+PISF K  T +S SS    TP +S R       +K+LS I       VN  SPT
Sbjct: 411  TSSRKKPISFNKF-TASSASSSNLTTPGSSKRLSKNFSSKKKLSTI-------VNQSSPT 462

Query: 471  PASRKKRNSMANIQ--AARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAK 528
            PASR KR S+ N++    R+S            R+ KR+S++P+ K  ++ +KL+STYAK
Sbjct: 463  PASRNKRASVINVEKNQKRASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAK 522

Query: 529  LSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXX 588
            L+EDD+WEY+E+ETKRTSSNFATLIDEIFE+EKYEQI                       
Sbjct: 523  LAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERR 582

Query: 589  XXXXXXXXXXXXXXXXXNETNDRQRIMEE-------EIENLKKELDMMSHEG-KTESRSV 640
                              E  D +R  EE       +I +L++EL     E      RS+
Sbjct: 583  RRKQEEKERARKLL----EKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSI 638

Query: 641  SEPLNKKQGGV---EIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEG 697
            S P+  ++  +   E+++  +LR+RN +LQTRP SRLDPG+ F S   +      +  E 
Sbjct: 639  SAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTEN 698

Query: 698  EVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPG-----RVITAPSNL 752
            E   +L TEK ILETIRRSKFLGSSF+I KELK +        AP      RV++  ++ 
Sbjct: 699  E---RLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDG 755

Query: 753  ERSDVLPKNAIATAPLRIHS------DQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLS 806
              S +LPK+    + L+  +          +RKIS+I+VPQFTRKSR+FSES+KRLSVLS
Sbjct: 756  YESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLS 815

Query: 807  MYSTRQSFKNLSDMMNFESENTDAAENRGQ-IATPNSAGQSEFLFXXXXXXXXXXXXXXX 865
            MYST++SF NL D++  ++ N D    + Q I TP SA  SEFLF               
Sbjct: 816  MYSTKESFTNLVDIL--KNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSN 873

Query: 866  DGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMEN-KLPILPPL--DPEIAGLGIYQ 922
            D +LY          K  L++N +DR+N +N     +N  LPILPPL  D E+      Q
Sbjct: 874  DERLY-DVGDSTIKDKSALKLNFADRFNGSNEAKQTDNLHLPILPPLNGDNELRK----Q 928

Query: 923  DQPEEVNAKPQEKKSKSKSAETGDIS-----------------EGEPEVSDLKAENIRKA 965
            +  E   A P   K KS   E+G  S                 + + E    K E +   
Sbjct: 929  NSQEGDQAHP---KIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVVDD 985

Query: 966  PQPP-------ITEKKKLDAKKQRNDERTKASKE--NTFSNN--FLRKLSGQSNTTTQSV 1014
             +PP       I EK      K  + +  K  K+  NT   N  F RK S  S+ T +  
Sbjct: 986  MEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKSSDKTME-- 1043

Query: 1015 KKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSL 1074
                      ++  +SA Q++ GL  LLRGW  YGLK+IK +  N+T+TGKL+S+NI SL
Sbjct: 1044 ----------LYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSL 1093

Query: 1075 RSTIFEIIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            RST+FE+ I   GK S V  KK SGS KAV +L  EV+NVL KEGV+
Sbjct: 1094 RSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/1167 (51%), Positives = 751/1167 (64%), Gaps = 110/1167 (9%)

Query: 5    KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQ---DSNVTS 61
            K  PTIKGD IG WK+GETLGLGSTGKVQLA+N+TT  QAAIK+ISK+IF    +SN TS
Sbjct: 9    KAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETS 68

Query: 62   MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
            MV NT PD+LPYGIEREI+IMKLL HANVL LYDVWETNSNLYM+LEYAEKGELFNLLVE
Sbjct: 69   MVANT-PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVE 127

Query: 122  RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
            +GPLPE EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALETED
Sbjct: 128  KGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 187

Query: 182  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
            KLLETSCGSPHYAAPEIVSGIPYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLK
Sbjct: 188  KLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 247

Query: 242  VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNL 301
            VQ+GQFEMP+DDE+S++AQ+LIS+IL V+P +RI  R+ILKHPLLQKYPSIKDSKSI+NL
Sbjct: 248  VQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNL 307

Query: 302  PREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
            PREDTYL PL++ NS ID +ILQNLVVLWHGRD  +I  KLKE GANAEKT+YA+L RFK
Sbjct: 308  PREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK 367

Query: 362  LDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSS 421
            ++ E  + K E +K +QS                + +S+ N +T PRKKNR S +SV+SS
Sbjct: 368  IEAENLSAKQEQVKRKQS---------------IIKKSTANVSTPPRKKNRISTMSVSSS 412

Query: 422  HKRPISFQKLPTLNSTSSLAAI-----------TPSTSAR-------RKRLSK--ISGYP 461
             KRP+SF +LPT+++  +   I           TP ++ R        KRLS   + G+ 
Sbjct: 413  RKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHS 472

Query: 462  VSNVNGSPTPASRKKRNSMANIQAARS--------SXXXXXXXXXXXXRASKRVSILPNN 513
              N N SPTP SR KR S+ N+  + +                     RASKR++ L N 
Sbjct: 473  NGNSN-SPTP-SRSKRISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNG 530

Query: 514  KNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXX 573
            K G+I +KL+STYAKLSEDD WEY+E+ETKRTSS+FATLIDEIFEHEKYEQI        
Sbjct: 531  KRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELA 590

Query: 574  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKEL--DMMSH 631
                                             +  + Q  +++EI NLK +L  +    
Sbjct: 591  RKVREAKEGEARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGA 650

Query: 632  EGKTESRSVSEPLNKKQG-GVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNP 690
            E     RSVS PL ++    +E ++ +L  +RN +LQTRPKSRLDPG+ + +      NP
Sbjct: 651  EPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSNP 710

Query: 691  SLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSA--SARSDYSRAPGRVITA 748
             L     ++D ++  EK ILETIRRS+FLGSS++I+KEL+ A  +A ++ S+   R    
Sbjct: 711  LL----SDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVT 766

Query: 749  PSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMY 808
              N+    V  K AI   PL  +  +  +RKIS+IKVPQFTRKSR+FS S++RLSVLSMY
Sbjct: 767  SQNI----VADKAAIGVIPL--NDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMY 820

Query: 809  STRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXXXXXXXXDGK 868
            ST+QS+ NL D++  +    + A       T  ++ + EF F                 K
Sbjct: 821  STKQSYTNLGDIL--KEGGVNLASEANNTTTSKASTEPEFQFESVNEGTA--------NK 870

Query: 869  LYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMENKLPILPPLDP---EIAGLGIYQDQP 925
            LY               VN  D   K N       KLP LPPL     +  GL IYQ   
Sbjct: 871  LYELQEEPEYTD-----VNKEDGKPKKNV------KLPTLPPLHEKTNQANGLAIYQSSS 919

Query: 926  EEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAP--QPPITEKKKLDAKKQRN 983
            ++ + KP E + KS+S     I E +  +++  + +++K P  +P     KK++  KQR 
Sbjct: 920  DD-DKKPTEPQPKSQSM----IPERQDSINN--SASVKKTPVVEPESQATKKINKPKQRQ 972

Query: 984  DERTKASK---------ENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQM 1034
             ++ +  K         E   + +F RK S  S  +T     TK G +  ++  VSA Q+
Sbjct: 973  PKKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAVSTL----TKNGFDYEVYVNVSAPQL 1028

Query: 1035 YQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDI 1094
            Y+GL  LL+GW  YGLK +K  S  M +TGKL+++NILSLRST+FE+I+  +GK S V  
Sbjct: 1029 YKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGF 1088

Query: 1095 KKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
             K SGS+K V RL  E++ VL +EGV+
Sbjct: 1089 NKISGSSKTVRRLFVEIEKVLRQEGVL 1115

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1178 (50%), Positives = 750/1178 (63%), Gaps = 119/1178 (10%)

Query: 3    TNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQD-SNVTS 61
            +NK   ++KGD IG WK+GETLGLGSTGKVQLAYN++T  QAAIKVISK++F    N +S
Sbjct: 4    SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSS 63

Query: 62   MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
            MV ++TPD+L YGIEREI+IMKLLNH NVLRLYDVWETN+NLYMVLEYAEKGELFNLLVE
Sbjct: 64   MV-SSTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVE 122

Query: 122  RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
            +GPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLD K NIKIADFGMAALETED
Sbjct: 123  KGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED 182

Query: 182  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
            KLLETSCGSPHYAAPEIVSG+PYHG  +DVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLK
Sbjct: 183  KLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242

Query: 242  VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNL 301
            VQ G+FEMP DDEISKEAQ+L+ KILVV+P +RI +R+ILKHPLLQKYPSIKDSK+IRNL
Sbjct: 243  VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNL 302

Query: 302  PREDTYLHPLAET---NSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLN 358
            PREDTYL+PL      ++ ID+ ILQNLVVLWHGR+  +I  KL+E GANAEKTLYA+L 
Sbjct: 303  PREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLY 362

Query: 359  RFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP--RKKNRASVI 416
            RFK+D EQE LKN  +K RQS   +             N  SGN NTT   +KKNR SVI
Sbjct: 363  RFKVDSEQEALKNSQIKKRQSIISNN------------NLKSGNINTTTPQKKKNRNSVI 410

Query: 417  SVTSSHKRPISFQKLPTLNSTSSLAAI------TPSTSAR-RKRLSKISG---YPVSNVN 466
            SV+SSHKRP+S  +L T+ +   + ++      TP +S R    LS   G    P SN +
Sbjct: 411  SVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSN-S 469

Query: 467  GSPTPASRKKRNSMANIQAARS-------------SXXXXXXXXXXXXRASKRVSILPNN 513
            GSPTPA R KR S+ N++ + +             +            R SKR+S+LPN 
Sbjct: 470  GSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNA 529

Query: 514  KNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXX 573
            K G+I +K+ISTYAKLSEDD+WE++E+ETKR SS+FATLIDEIFEHEKYEQI        
Sbjct: 530  KRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEELE 589

Query: 574  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKEL--DMMSH 631
                                                + +  + +E++   K    D + H
Sbjct: 590  RKVRENKEREERQKRQKEVELAAIAREREELQRRLEEEETQITKELQQDTKNFQEDEVVH 649

Query: 632  EGKTESRSVSEPLNKKQGGVEIEVKELLR-QRNAALQTRPKSRLDPGLFFDSAESDTRNP 690
            +     RS+S P+   + G E + +E    QR+ +LQTRP S+LDPG+   S      N 
Sbjct: 650  KN---VRSISSPV---ENGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGS------NK 697

Query: 691  SLQ---VFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSR------- 740
             +Q   + E E+D  + ++K ILETIRRSKFLGSSF+I KELK     ++  R       
Sbjct: 698  PVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKE 757

Query: 741  ---APGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSE 797
                 GR+++  +    + VLPKNA A   L+  S++ E RKISDI+VPQFTRKS+ F++
Sbjct: 758  DRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTD 817

Query: 798  SSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXX 857
            S+KRLSVLS+YS+ QS+ NL++++  +    D   N G      S  + EF F       
Sbjct: 818  SNKRLSVLSIYSSTQSYTNLANVL--KEGGVDIGVNEGSNNVEVSE-EPEFQFETVGTEI 874

Query: 858  XXXXXXXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMENKLPILPPL-DPEIA 916
                                      +++N +DR++ A +  ++  KLP LPPL D +++
Sbjct: 875  ENNKYEEEKEIENENNLSQGA----NIKLNYADRFDTAGNVNEV--KLPTLPPLGDDKVS 928

Query: 917  -GLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRK----APQPPIT 971
             GLGIY                 SKS   G+ S+  P + + K+E   K     P+PP+ 
Sbjct: 929  DGLGIYS----------------SKSGSEGNESKPVPSIKENKSEETLKEKNVEPKPPLN 972

Query: 972  E--KKKLDAKKQR--NDERTKASKENTFSNNFLRKLSG----QSNTTTQSVKKTKLGAED 1023
            +   K  D KK     +   K S +   S +F RK+S     Q++TT   VK        
Sbjct: 973  DVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVK-------- 1024

Query: 1024 GIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIII 1083
             + + VS TQ+Y GL+NLL+GW  YGLK IK N E  +I+ +L+S+NILSLRST  ++++
Sbjct: 1025 -LFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVV 1083

Query: 1084 IREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
              EGK S +  +KKSGS+K + RL  EV+ VL KEGV+
Sbjct: 1084 FSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1225 (48%), Positives = 751/1225 (61%), Gaps = 146/1225 (11%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59
            +  ++ PT++GD++G WK+GETLG GSTGKVQLA N+ T   AA+K ISK IF       
Sbjct: 4    MNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPG 63

Query: 60   TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
             S +  +TPD LPYGIEREI+IMKLLNH NVLRLYDVWETN +LYMVLEYAEKGELFNLL
Sbjct: 64   NSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLL 123

Query: 120  VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            VE GPLPENEA+ FFRQIIIG+SYCHALGIVHRDLKPENLLLD   NIKIADFGMAALET
Sbjct: 124  VENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALET 183

Query: 180  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            EDKLLETSCGSPHYAAPEIVSGIPYHGFASD+WSCGVI +ALLTGRLPFDEEDGNIRNLL
Sbjct: 184  EDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLL 243

Query: 240  LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
            LKVQ+G+FEMP+DDEIS EAQ+L++KIL V+P  RI  R+ILKHPLLQKYP++ D+KSIR
Sbjct: 244  LKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIR 303

Query: 300  NLPREDTYLHPLAETNSA-IDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLN 358
            NLPREDTYLHPL+++ S+ +D+NILQNLVVLWHGR   EI  KLK+ GANAEKTLYA+L 
Sbjct: 304  NLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLA 363

Query: 359  RFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISV 418
            RFK D E+E  + + +K R S                VN    N + +P+K+NRAS I+ 
Sbjct: 364  RFKNDTEREAARQKQIKKRSS---------LNGTGAGVN----NNHVSPKKRNRASTINA 410

Query: 419  TSSHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLS-------KISGYPVSNVNGSPTP 471
            +SSHKRP+S  KL   ++++S +  + +++   KR+S       ++S        GSPTP
Sbjct: 411  SSSHKRPVSLIKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTP 470

Query: 472  ASRKKRNSMANIQAARSSXX-----------XXXXXXXXXXRASKRVSILPNNKNGTIAS 520
            ASR KR S+  I++ ++                        RAS R+S  P NK G++ +
Sbjct: 471  ASRSKRVSI--IESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTT 528

Query: 521  KLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXX 580
            KLISTYAKLSE+D+WEY+E+ETKRTSS+FATLIDEIFEHEK+EQI               
Sbjct: 529  KLISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETK 588

Query: 581  XXXXXXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKELDMMS-HEGKTESRS 639
                                         + Q    +  +    E D+ S ++     RS
Sbjct: 589  EREERERKEREEKELNEKLENDARQKREMEAQEAQGD--DGTDTESDVHSNNQAPNGVRS 646

Query: 640  VSEPLNKKQG----GVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVF 695
            VS PL +K+      V+ +++E+  QR  +LQTRP SRLDPGLF+  AE ++  P  +  
Sbjct: 647  VSAPLERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFY--AE-ESNEP--EAG 701

Query: 696  EGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERS 755
            + E + KL+T+K ILETIRRSKFLGSSFDI KEL++   +   S+ P R  T     E  
Sbjct: 702  DTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQNEELKKKASQ-PHRDRTVSQTNEPY 760

Query: 756  D--VLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQS 813
            D  VLP  A+ATAPLR   DQ E RKIS+I VPQFTRKSR FS+S+KRLSVLSMYST+ S
Sbjct: 761  DTRVLPTQAVATAPLR---DQ-EPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHS 816

Query: 814  FKNLSDMMNFESENTDAAENR----GQIATPNSAGQSEFLFXXXXXXXXX----XXXXXX 865
            + NLS+++N    ++DA++ R     + +      + EF F                   
Sbjct: 817  YNNLSNLLN----DSDASDGRLNSAAEYSDVKGKKEPEFQFEAVREASDEDNGISRLSNN 872

Query: 866  DGKLYXXXXXX--------XXXXKKGLRVNLSDRYNKANSEADMEN--------KLPILP 909
            D +L                   K  +++N +DR++     A   N        KLP LP
Sbjct: 873  DERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLP 932

Query: 910  PLD--PEIAGLGIYQDQPEE----VNAKPQEKKSKSKSAETGDISEGEPEVS----DLKA 959
            PLD   E  GLGIYQ   E     V   P   KSK +   +    E E EV+     +K 
Sbjct: 933  PLDGTSEANGLGIYQSSSESFRDIVEPTP---KSKLQDNSSNPEQEVEEEVAGREGSVKH 989

Query: 960  ENIRKAPQPPITEKKKLDAK-------------------------KQRNDE----RTKAS 990
              I  A +       ++DAK                         K+RN++     T A 
Sbjct: 990  SAIDTASKERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAK 1049

Query: 991  KEN---------TFSN-----NFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQ 1036
             EN         T S+     +F RK S       +S +K   G +  I+TTVSA Q++ 
Sbjct: 1050 GENGRAPLKDITTNSDKKRNVSFFRKFS-------KSNEKDTTGFDGEINTTVSAKQLFL 1102

Query: 1037 GLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKK 1096
            GL NLL GW  YGLK ++ + E MT+TGKL SENILSLRST+FE+++   GK S V  +K
Sbjct: 1103 GLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVSVVGFRK 1162

Query: 1097 KSGSTKAVNRLAGEVKNVLVKEGVM 1121
            KSGS+KA+ RL  EV+ VL+KEGV+
Sbjct: 1163 KSGSSKAMRRLVSEVEKVLLKEGVI 1187

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1181 (47%), Positives = 735/1181 (62%), Gaps = 89/1181 (7%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQD-SNVT 60
            +   T  T+KGD+IG WK+G TLG GSTGKV +A +++TG QAA+K++SK+IF + SN +
Sbjct: 10   VVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSS 69

Query: 61   SMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
            ++V +  PD LPYGIEREI+IMKLLNH NVLRLYDVWETNS+LYMVLEY EKGELFNLLV
Sbjct: 70   TIVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLV 129

Query: 121  ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
            +RGPLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALE++
Sbjct: 130  DRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESK 189

Query: 181  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            DKLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLL
Sbjct: 190  DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 249

Query: 241  KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300
            KVQ+G+FEMP+ +EIS EAQ+LI+KIL V+PA RI +R ILKHPLLQKYPSIKDSKSIRN
Sbjct: 250  KVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRN 309

Query: 301  LPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRF 360
            LPREDTYL+PL   +  ID+ I+ NLVVLWHGRD  EI  KLKE GAN EKT YA+L RF
Sbjct: 310  LPREDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRF 369

Query: 361  KLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTS 420
            K D +QE LK      +Q   Q+  ++P        N      +TTP+KK RA VIS +S
Sbjct: 370  KHDSQQEQLK------QQRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASS 423

Query: 421  SHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVS---NVNGSPTPASRKKR 477
            SHKRP+SF +L + ++ S+    TP++S +R  ++  S   +S   N N SPTPAS  KR
Sbjct: 424  SHKRPVSFSRL-SYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPAS--KR 480

Query: 478  NSMANIQAA---------RSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAK 528
             S+  +  +         +              R SKR+S LP NK G+I +KLI+TYAK
Sbjct: 481  ASLRELDPSAPPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAK 540

Query: 529  LSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXX 588
            +SED++WEY+E+ETKRTS++FATL DEIFEHEKYEQI                       
Sbjct: 541  ISEDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERERR 600

Query: 589  XXXXXXXXXXXXXXXXXNETNDRQRIMEEEI-ENLKKELDMMSHEGKTES-------RSV 640
                              E  + +   + E+ EN+ +E+ ++    +T S       RSV
Sbjct: 601  QREEEERRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSSGVDPNKNRSV 660

Query: 641  SEPL--------NKKQGGVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSL 692
            S P+              ++ ++ +LL +R  +L+TRPKSRLDPG++     +    P+ 
Sbjct: 661  SAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIY-----TLEEVPNS 715

Query: 693  QVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKEL--------KSASARSDYSRAPGR 744
             + +G  D  LKTEK ILETIRRSKFLGSSFDI+KEL        + A+A     +    
Sbjct: 716  DIKDGGRD--LKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRV 773

Query: 745  VITAPSNLERS----DVLPKNAIATAPLRIHSDQ-PEVRKISDIKVPQFTRKSRNFSESS 799
            V  A  N   +      LPKNA AT   +I +D   + RKIS+++VPQFTR+SR+F+ S+
Sbjct: 774  VSNATGNYSENGYEPQTLPKNAAAT---KISNDAGSDPRKISEVQVPQFTRRSRHFTASN 830

Query: 800  KRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXX 859
            KRLSVLSMYST+ SF NL+D +  +++      N    +T     ++EF+F         
Sbjct: 831  KRLSVLSMYSTKASFTNLADHLRGKTDLQSI--NGSPPSTSRMEPETEFMFESVDGEGKE 888

Query: 860  XXXXXXDGKLYXXXX--XXXXXXKKGLRVNLSDRYNKANSEA--DMEN----KLPILPPL 911
                  D +LY            +  +R+N +DR+NK  S     +E+    KLP LPPL
Sbjct: 889  TADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPSLPPL 948

Query: 912  DPE----IAGLGIYQDQPE--EVNAKPQEKKSKSKSAETGDISEGEP-EVSDLKAENIRK 964
            D      + GLG+YQ   +  E     Q K      AE  + +E +P E   +  +++  
Sbjct: 949  DKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPKDVES 1008

Query: 965  APQP--PITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAE 1022
            AP P   + +K     K Q N     A K+N  S  F R+ SG+S+       + + G  
Sbjct: 1009 APAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKS--FFRRFSGKSD------DEKRPGEY 1060

Query: 1023 D-GIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEI 1081
            D    T +  TQM+  L  LL  W  YGLK +  +     I GK++S+N+LSLRST+FEI
Sbjct: 1061 DFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEI 1120

Query: 1082 IIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMI 1122
             I+ +G+GS V   KKSGSTK   +L  E++ +L  +  ++
Sbjct: 1121 SIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALV 1161

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1152 (50%), Positives = 740/1152 (64%), Gaps = 86/1152 (7%)

Query: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
            I++ T   IK +QIG WK+GETLG GSTGKV LA N+TT  QAA+KVISK +F+  N + 
Sbjct: 4    ISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSE 63

Query: 62   MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
               + T +ALPY IE+EI+IMKLLNH NVLRL+DVWETNS+LY+VLEYAEKGELFN+LVE
Sbjct: 64   SNGDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122

Query: 122  RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
            RGPLPENEA+R FRQIIIGISYCH+LG+VHRDLKPENLLLD K NIKIADFGMAALE+ED
Sbjct: 123  RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESED 182

Query: 182  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
            KLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLK
Sbjct: 183  KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242

Query: 242  VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNL 301
            VQ G+FEMP+DDEI+KEAQ+L++++L V+P++RIT R+ILKHPLLQKYPSIKDS+SIRNL
Sbjct: 243  VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNL 302

Query: 302  PREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
            PREDTYL PLA+TNS ID+ ILQNLV+LWHG+D  EI  KL+E GAN EKTLYA+L RFK
Sbjct: 303  PREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362

Query: 362  LDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKN-RASVISVTS 420
             D ++E        NR           +T +STA    S  K  TP+KKN RAS+I+  S
Sbjct: 363  CDTQRE-------ANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASIIA--S 413

Query: 421  SHKRPISFQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPVSNVNGSPTPAS 473
            S KRP+S  K  T  + +S    TP ++ R       RKR+S + G        SPT  S
Sbjct: 414  SSKRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYG-----TRDSPTKTS 468

Query: 474  RKKRNSMANIQAARSSXXXXXXXXXXXXRA---SKRVSILPNNKNGTIASKLISTYAKLS 530
            R +R+S+       +             RA   SKR+S++PN K  ++ +KL++TYAKLS
Sbjct: 469  RSRRSSIITKDFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLS 528

Query: 531  EDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 590
            EDD+WEY+E+ETKRTSS+FATLIDEIFE+EKYEQI                         
Sbjct: 529  EDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREERERKER 588

Query: 591  XXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPL---NKK 647
                            +  D  R M+EEI NLKKEL +   + + + RSVSEPL   +KK
Sbjct: 589  QEKELQERLERERIEKQKEDIARQMDEEISNLKKEL-VGDQDNEDKFRSVSEPLESKSKK 647

Query: 648  QGGVEIEVKELLRQRNAALQTRPKSRLDPGL-FFDSA-ESDTRNPSLQVFEGEVDNKLKT 705
               +E ++  +LR R  +LQTRP SRLDPG+ F D   +S+   P     E E++   +T
Sbjct: 648  IEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELE---ET 704

Query: 706  EKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIAT 765
            E+ ILETIRRSKFLGSSFDI KEL++   R   +  P     AP  L   + LPK   A 
Sbjct: 705  EQKILETIRRSKFLGSSFDIKKELENVK-RHRQTSQPIEKEMAPPAL--PETLPK---AV 758

Query: 766  APLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFES 825
                +  D P +RKISDIKVPQFTRKSR+FS S++RLSVLSMYST++S+ NL+D++    
Sbjct: 759  EKKNVSMD-PSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADIL---- 813

Query: 826  ENTDAAENRGQIA-TPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXXXXXXKKGL 884
            +N    +   Q A TP SA  S+ LF               + +LY              
Sbjct: 814  KNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREE-RLYEVAEESENELANK- 871

Query: 885  RVNLSDRYN------KANSEADMENKLPILPPLDPEIAGLGIYQDQ-----PEEVNAKPQ 933
            +++++D  N      K+  E +   KLP LPPL  E       ++Q     PE + +   
Sbjct: 872  KIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPL-FEDGSTKETKEQSKSMIPENMQSSES 930

Query: 934  EKK-SKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEK---KKLDAKKQRNDERTKA 989
            +K+  K+ S E G ++    +  D+  + + K  +P +T K   +++ A K+RN      
Sbjct: 931  QKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKE-KPTVTMKTTSEQVSADKKRN------ 983

Query: 990  SKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYG 1049
                    +FLRKLS  S+++  +V  T       + T+VS+ Q++ GL NLL+GW  YG
Sbjct: 984  -------MSFLRKLSKGSSSSKDNVDVT-------LSTSVSSKQLFSGLVNLLKGWTKYG 1029

Query: 1050 LKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGSTKAVNRLAG 1109
            LK I  +S + TITGKLA++NILS RST F I+I  + KGS V  +K SGS KAV RL+ 
Sbjct: 1030 LKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLSD 1089

Query: 1110 EVKNVLVKEGVM 1121
            EVK VL KEGV+
Sbjct: 1090 EVKKVLSKEGVL 1101

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1158 (48%), Positives = 729/1158 (62%), Gaps = 100/1158 (8%)

Query: 9    TIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTP 68
            T+KGD IG WK+G TLG+GSTGKV +AYN+T G QAA+K+ISK+IF ++  ++M+    P
Sbjct: 8    TLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIF-NAQGSTMIGGNDP 66

Query: 69   DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
            D LPYGIEREI+IMKLLNH NVLRLYDVWET+ +LYMVLEY EKGELFNLLVERGPLPEN
Sbjct: 67   DVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPEN 126

Query: 129  EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSC 188
            EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+N+K+ADFGMAALE++DKLLETSC
Sbjct: 127  EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLETSC 186

Query: 189  GSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFE 248
            GSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ+G+FE
Sbjct: 187  GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFE 246

Query: 249  MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYL 308
            MP DDEIS EAQ+LI++IL V+P +RI  R+ILKHPLL+KYPSIKDSKSIRNLPREDTYL
Sbjct: 247  MPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTYL 306

Query: 309  HPLA--ETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQ 366
            +PL+    N  +DE ILQNLVVLWHGR+  +I  KL E GAN EKT YA+L+RFK D  Q
Sbjct: 307  NPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHDNYQ 366

Query: 367  ENLKNEHLKNRQSGGQSTSM----APATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSH 422
            + LK + L+ +QS   ++ M     P+ N+S +         TTP+KK R S+I  +SSH
Sbjct: 367  DQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDS-------PVTTPKKK-RTSIIVASSSH 418

Query: 423  KRPISFQKLPTLNST----SSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRN 478
            KRP+S QKL + +S+     S+      T    KR+S++    VSN + SPTPA+ K+ +
Sbjct: 419  KRPVSMQKLSSQHSSPVKNGSIGKRLSKTFPSNKRISQL----VSN-SSSPTPAAHKRVS 473

Query: 479  SMANIQAARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYL 538
             + +  A                R SKR S+LPN K G+I +KLI+TYAKLSED EWEY+
Sbjct: 474  RINDSAAPPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYI 533

Query: 539  EQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 598
            E+ETKRTS +FATL+D+IFEHEKYEQI                                 
Sbjct: 534  EKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAERKERERIEREEQ 593

Query: 599  XXXXXXXNETNDRQR----IMEEEIENLKKELDMM---SHEGKTES-RSVSEPL------ 644
                    +  +RQ+     ME+EI  LK E + +   S E  T + RSVS P+      
Sbjct: 594  ERLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERNTANGRSVSAPIETDRTA 653

Query: 645  NKKQG--GVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNK 702
            NK+    G++ ++ EL+  RN +LQTRP SRLDPG+   +AES       ++     D++
Sbjct: 654  NKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGII--AAES-------RLSANLEDDQ 704

Query: 703  LKTEKAILETIRRSKFLGSSFDISKELKSASA------RSDYSRAPGRVITAPSNLERSD 756
               EK ILETIRRSKFLGS F+++ EL+ A        R +  R      TA   +++  
Sbjct: 705  ASKEKTILETIRRSKFLGSQFNLNVELEKAQKDLVSKERQEQLRKYSEQ-TAKYEVQK-- 761

Query: 757  VLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKN 816
             LPKNA A A LR   D+ E RK+S++KVPQFTR+S++FS S+KR SVLS+YST+ SF N
Sbjct: 762  -LPKNAKAVATLR--DDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTN 818

Query: 817  LSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXX 876
            L D +  ++   +    + + ++   A + EF+F               + KL+      
Sbjct: 819  LVDHLKNDN-YLEPLPGQPEYSSSKVAQEPEFMF-------ETVEELDENSKLFEVPETE 870

Query: 877  XXXXKKGLRVNLSDRYNKANSEADMENKLPILPPLD--PEIA------GLGIYQDQPEEV 928
                    R   +D   ++ ++ D+   LP LPPL    ++A      GLGIY  QP + 
Sbjct: 871  EGKLASAARKESTDARKQSTNDKDI--NLPSLPPLQVSHDVADENGALGLGIY--QPNDQ 926

Query: 929  NAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTK 988
              KP +     +S     I E     SD+    + K  +PP+ +  + +  +++  E   
Sbjct: 927  TQKPHKTMLIDES-----IDENISSTSDVSRTEVVK--KPPLNDVVRKNNNERKPLEEIT 979

Query: 989  ASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAE---DGIHTTVSATQMYQGLYNLLRGW 1045
               EN    +F RK S  S        + KLG E     +   VSA +MY+ L  LL  W
Sbjct: 980  PKVENKRKISFFRKFSQGS--------EKKLGPESFDSQLKAGVSAPKMYKALDRLLNEW 1031

Query: 1046 GSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIII-REGKGSKVDIKKKSGSTKAV 1104
             +YGLK ++ +  +  I+GKL S+NILSLRST F+I ++  EG GS +   KKSGSTK  
Sbjct: 1032 TNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTF 1091

Query: 1105 NRLAGEVKNVLVKEGVMI 1122
            NRL  E++ +L KE V++
Sbjct: 1092 NRLVKEIEKILEKEKVLV 1109

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1188 (48%), Positives = 729/1188 (61%), Gaps = 137/1188 (11%)

Query: 9    TIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQ------------- 55
            T+ G+ IG WK+GETLG GSTGKVQLA N+ T  QAAIK+ISK++F              
Sbjct: 10   TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 56   ---DSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEK 112
               D N  S+  N   +ALPYGIEREI+IMKLLNH NVLRLYDVWETN+NLYMVLEYAEK
Sbjct: 70   AASDVNNGSVQHNQ--EALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEK 127

Query: 113  GELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADF 172
            GELFNLLVE+GPL ENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLD K NIKIADF
Sbjct: 128  GELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADF 187

Query: 173  GMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEED 232
            GMAALETEDKLLETSCGSPHYAAPEIVSG+PY+G  +D+WSCGVIL+ALLTGRLPFDEED
Sbjct: 188  GMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEED 247

Query: 233  GNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
            GNIRNLLLKVQ G+FEMP  DE+S EAQ+LI KIL VNP +RI  R+ILKHPLLQKYP+I
Sbjct: 248  GNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNI 307

Query: 293  KDSKSIRNLPREDTYLHPLAETN---SAIDENILQNLVVLWHGRDPAEIRVKLKEHGANA 349
            KDSK+IR+LPREDTYL+PLA+ N   + IDE+ILQNL VLWHG+D  EI  KLKE GANA
Sbjct: 308  KDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANA 367

Query: 350  EKTLYAMLNRFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-R 408
            EKTLY +L+RFK D E+EN KN  L+ RQS  +            A + SS N+   P R
Sbjct: 368  EKTLYVLLHRFKEDTERENHKNSQLRKRQSLMK------------ASSSSSSNQGNVPRR 415

Query: 409  KKNRASVISVTSSHKRPISFQKLPTLNSTS-------SLAAITPSTSAR--------RKR 453
            +KNR S+ISVTSSHK+P+S+ K+  +  +S       S +  TP++S R         KR
Sbjct: 416  RKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKR 475

Query: 454  LSKISGYPVSNVNGSPTPASRKKRNSMANIQAARSSX-----------XXXXXXXXXXXR 502
             S++  Y  SN + SPTPA R +R+S  N+    S                        R
Sbjct: 476  NSRL--YTQSN-SSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSR 532

Query: 503  ASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKY 562
             SKR S L NNK G++ +K++STYAKL+EDD+WE++E+ETKR SS+FATLIDEIFEHEK+
Sbjct: 533  LSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKF 592

Query: 563  EQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXNETNDRQRIMEE 617
            E+I                                              E    Q  ++E
Sbjct: 593  EKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDE 652

Query: 618  EIENLKKELDMM---SHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAALQTRPKSRL 674
            E   LK E + +   + E    SRSVSEP+  K GG + +      QRN +LQTRP SRL
Sbjct: 653  EARLLKDEFNFVNDETQENPINSRSVSEPV--KNGGTDEK-----GQRNFSLQTRPISRL 705

Query: 675  DPGLFFDSAESDTRNPSLQVFEGEVDNKL--KTEKAILETIRRSKFLGSSFDISKELKSA 732
            DPGL F S   D  N S       VD  L    +K ILETIRRSKFLGSSFDI+KEL +A
Sbjct: 706  DPGLMF-SKLGDVDNNS------SVDENLTMNNQKTILETIRRSKFLGSSFDINKELNNA 758

Query: 733  SARSDYSRA-----------PGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKIS 781
            +      R              R+ +       + VL KNAI    L+  S   E RKIS
Sbjct: 759  NEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRKIS 818

Query: 782  DIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFES-ENTDAAENRGQIATP 840
            +++VPQFTRKS+ FSES+KRLSVLS YS++QS+ NL DM+     E+ D  E+ G     
Sbjct: 819  EVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKENPVEDEDVTEDPG---FN 875

Query: 841  NSAGQSEFLFXXXXX--XXXXXXXXXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKANS- 897
                Q ++L                  D K+              +++N +DR++  NS 
Sbjct: 876  FEDSQYDYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSV-----SMKLNFADRFSNVNSN 930

Query: 898  ---EADMENKLP-ILPPLDPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPE 953
               E+  E+K P IL     E  GLG+Y               SK++  E   +    PE
Sbjct: 931  TKQESSFEDKFPNILSKSGTE--GLGLY---------------SKNEKTEPKPVKSMIPE 973

Query: 954  VSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQS 1013
               + +  + +AP   +  K +  A+ +   +    S++ + +++FLRK+SG+S+ +T +
Sbjct: 974  EDKVNSSPVVEAPLNKVVNKTR--AENKSTSKGPSGSQKVSNTSSFLRKISGKSSNSTVA 1031

Query: 1014 VKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILS 1073
                K   E  ++++V+ TQ++ GL NLL+GW +YGLK +K + +   I GKL+++NILS
Sbjct: 1032 ----KGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILS 1087

Query: 1074 LRSTIFEIIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            LRSTI E+ +  E K S + I+KKSGS+K + RLA E++ VL KEGV+
Sbjct: 1088 LRSTIVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVL 1135

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1226 (46%), Positives = 734/1226 (59%), Gaps = 140/1226 (11%)

Query: 9    TIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIF---QDSNVTSMVDN 65
            T+K D+IG WK+G  LG GS GKV +A ++TTG QAA+K++SK+IF     +N +++V +
Sbjct: 17   TLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGS 76

Query: 66   TTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPL 125
              PD LPYGIEREI+IMKLLNH NVLRLYDVWET SNLYMVLEY EKGELFNLLVERGPL
Sbjct: 77   NDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPL 136

Query: 126  PENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE 185
            PENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALE++DKLLE
Sbjct: 137  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLE 196

Query: 186  TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAG 245
            TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDE++GNIR+LLLKVQ+G
Sbjct: 197  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSG 256

Query: 246  QFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPRED 305
            ++EMP +DEIS EAQ+LI+KIL V+P  RI  R+ILKHPLLQKYPSIKDSKSIRNLPRED
Sbjct: 257  EYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 316

Query: 306  TYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVE 365
            TYL+PL   + +ID+ ILQNLVVLWHGRD  EI  KL E GAN EKT Y +L RFK DV 
Sbjct: 317  TYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHDVH 376

Query: 366  QENLKNEHLK-----------------NRQSGGQSTSMAPATNQSTAVNRSSGNKNTT-- 406
            Q+  + +  +                 +RQSG  S        +  A+ +S+  K+ T  
Sbjct: 377  QQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSP-------KKLAMKKSASRKSITST 429

Query: 407  -------PRKKNRASVISVTSSHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISG 459
                   P+KKNR S+ISV+SSHKRP+SF KL T   + S A  TP +S +R  +S  S 
Sbjct: 430  SLSGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDS-ACGTPGSSTKRMSISLSSS 488

Query: 460  YPVSNV--NGSPTPASRKKRNSMANIQAAR-----------SSXXXXXXXXXXXXRASKR 506
              +S +  N SPTPA+  KR S+ ++ ++            +S            RASKR
Sbjct: 489  KRLSAMGPNTSPTPAN--KRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKR 546

Query: 507  VSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEI-----FEHEK 561
            +S LPN K G+I +KLI+TYAKLSE+D+WEY+E+ETKRTS++FATL D+I     +E  +
Sbjct: 547  LSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIR 606

Query: 562  YEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIEN 621
             E+                                            + +Q+ ++E    
Sbjct: 607  KEKQELERKVREAKEREERERRKRQEEQEEQERKRRAEEERVLRELEDAKQQELQEL--- 663

Query: 622  LKKELDMM-----------SHEGKTESRSVSEPL---NKKQGG-------VEIEVKELLR 660
            + KE+ M+             +G +++R VS P+   + K  G       +  ++ +LL+
Sbjct: 664  MAKEVAMLRADYGEPQTEPEEQGASKNRCVSAPIASSSAKDDGKRDSIARLSGDIDDLLK 723

Query: 661  QRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLG 720
            +R  +LQTRP SRLDPG+    A  +  +   +  +G  +  L+TEK ILETIRRS+FLG
Sbjct: 724  RRTVSLQTRPVSRLDPGIV---AAENLGSVIYEEADGVDETTLRTEKTILETIRRSRFLG 780

Query: 721  SSFDISKELKSAS-------ARSDYSR--APGRVITAPSNLERSDVLPKNAIATAPLRIH 771
            SSFDI KEL+ A        AR    R  +     +A ++   S  LPKNA A   L   
Sbjct: 781  SSFDIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAAAVDTLNDE 840

Query: 772  SDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAA 831
             + PE RKIS+IKVPQFTR+SR+F+ S+KRLSVLSMYST+ SF NL+D +       D  
Sbjct: 841  RN-PEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLK---GGADLQ 896

Query: 832  ENRGQIATPNSAGQS-EFLFXXXXXXXXXXX-XXXXDGKLYXX---XXXXXXXXKKGLRV 886
            E  G   +     Q  EFLF                D +LY             K  +R+
Sbjct: 897  EVSGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRL 956

Query: 887  NLSDRYNKANSEADMENKLPILPPLDPEIA----GLGIYQDQPEEVNAKP---------- 932
            N +DR+N    +   + KLP LPPL+   +    GLGIYQ  PE   A P          
Sbjct: 957  NFADRFNTRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQ-SPERPRADPNPTSMVHEPK 1015

Query: 933  --------------QEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDA 978
                            K ++S++  T    + EP+ + L + +  +A QPP+    + + 
Sbjct: 1016 VFSMIPDDIAGPAKSTKPAESENVPTSATKKSEPK-NALHSADAPEASQPPLNGMMRKNN 1074

Query: 979  KKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGL 1038
             ++  ++ T A+ E   + +F RK S  S          KL      +T+V A QM+  L
Sbjct: 1075 DRKPLEDITPAA-EKKRNRSFFRKFSRSSEEKKSDNFDAKL------NTSVEAVQMFNAL 1127

Query: 1039 YNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIRE-GKGSKVDIKKK 1097
              LL GW  YGLK ++      TITGKL+S+NILSLRST+FEI++  +  KGS V   KK
Sbjct: 1128 GKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKK 1187

Query: 1098 SGSTKAVNRLAGEVKNVLVKEGVMIT 1123
            SGSTK   RL  EV+ VL +E V+ +
Sbjct: 1188 SGSTKTFKRLVKEVEKVLERENVLTS 1213

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1156 (48%), Positives = 708/1156 (61%), Gaps = 187/1156 (16%)

Query: 10   IKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV--TSMVDNTT 67
            +KGD IG WK+G+TLGLGSTGKV+LAYN+TT  QAAIK+ISK+IF    V  +SMV N++
Sbjct: 10   MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNSS 69

Query: 68   PDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPE 127
            PDALPYGIEREI+IMKLL H NVL LYDVWETNS LYM+LEYAEKGELFNLLVERGPLPE
Sbjct: 70   PDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPE 129

Query: 128  NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETS 187
             EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLD K NIKIADFGMAALET+DK+LETS
Sbjct: 130  KEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETS 189

Query: 188  CGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQF 247
            CGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQ+G++
Sbjct: 190  CGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEY 249

Query: 248  EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTY 307
            EMP+DDEISKEAQ+LI +IL V+P +RI  RDILKHPLLQKYPSIKDS+SI+NLPREDTY
Sbjct: 250  EMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTY 309

Query: 308  LHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQE 367
            L+PL+E NS ID++ILQNLV LWHGRD  +I  KL+E GA+AEKT+YA+L RFK++ E+ 
Sbjct: 310  LYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEK- 368

Query: 368  NLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPIS 427
                                              N  ++PR+KNR S+ISV+SSHKRP+S
Sbjct: 369  ---------------------------------MNTCSSPRRKNRISMISVSSSHKRPVS 395

Query: 428  FQKLPTL--NSTSSLAAITPS-TSARRKRLSKISGYPVSNVNGSPTPASRKKRNSMANIQ 484
             +K+ T+  N+  S   ++ S +S +RKR+S I    + + N SPTP SR KR S+ NI 
Sbjct: 396  MKKISTVQNNTPPSNRRLSISLSSTQRKRMSGI----LQHTNSSPTP-SRTKRISVINID 450

Query: 485  AA--RSSXXXXXXXXXXXXRASKRVS---------------ILPNNKNGTIASKLISTYA 527
             +  ++               SK V                 L NNK  +I +KL+STYA
Sbjct: 451  DSENKAPPPVPMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTLVNNKRVSITTKLLSTYA 510

Query: 528  KLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXX 587
            KLSEDD WEY+E+ETKRTSS+FATLIDE+FEHEKYE+I                      
Sbjct: 511  KLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEELERKVRETRVREQRRE 570

Query: 588  XXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKK 647
                                    Q+ ++EEI  LK+  D +    K   RSVS P+ K+
Sbjct: 571  EEERAELQREQLKL----------QQKIDEEISKLKE--DALE---KDNFRSVSAPI-KE 614

Query: 648  QGGVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQ-VFEGEVDNK--LK 704
                +    EL  +R  +LQTRP SRLDPG+ + SA ++   PS + V   E  NK   +
Sbjct: 615  NEDEDENENELRNRRQFSLQTRPVSRLDPGILY-SAPAEI--PSYERVVVNESGNKSSAQ 671

Query: 705  TEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIA 764
             ++ ILETIRRSKFLGSSF+I +EL+ +           R +  P+  +  DV       
Sbjct: 672  QQRKILETIRRSKFLGSSFNIQQELEFSQ----------RNVLVPTKEQVVDV------- 714

Query: 765  TAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFE 824
               +++      +RKIS++K+PQFTRKSR+FS+S+KRLSVLSMYST+QS+ NL  ++   
Sbjct: 715  -DEVKLEGG---LRKISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDG 770

Query: 825  SENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXXXXXXKKGL 884
            +E ++ A+      TP      E LF               D +LY              
Sbjct: 771  TEESEPAKK-----TP------ELLF-----------ESGRDDRLY-------------- 794

Query: 885  RVNLSDRYNKANSEADMEN-KLPILPPL-----------DPEIAGLGIYQDQPEEVNAKP 932
               +S+       + D+E   LP LPPL           + EI GL I+         +P
Sbjct: 795  --EVSEEPEIQEEKEDIETVTLPQLPPLKQSANTNANANETEINGLAIF---------RP 843

Query: 933  QEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKE 992
            +E      + E  DI++   EV     ++ +  P      K++L+ K +R  +    +K 
Sbjct: 844  KE------NIELEDITKEVKEVIP-SQDHGKDKPIAINNPKQRLEVKPERQLDEIAPNKV 896

Query: 993  NTFSN----NFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSY 1048
             T       +F RK S  S T          G +  I+  + + Q+Y GL  LL GW  Y
Sbjct: 897  GTTEKKRNVSFFRKFSNNSATIK--------GYDHEIYVNIGSRQLYTGLRKLLEGWTQY 948

Query: 1049 GLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSK---VDIKKKSGSTKAVN 1105
            GLK ++ ++  M ITGKLA++NILSLRST+FE+++  E KGSK   +   K  GS+K V 
Sbjct: 949  GLKDVRSDNTAMKITGKLANDNILSLRSTLFELLV--EPKGSKYSLIGFTKVQGSSKVVR 1006

Query: 1106 RLAGEVKNVLVKEGVM 1121
            RL  E++ VL KEGV+
Sbjct: 1007 RLFTEIEKVLNKEGVL 1022

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1181 (46%), Positives = 712/1181 (60%), Gaps = 108/1181 (9%)

Query: 4    NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63
            N    +++GD+IG WK+GETLG GSTGKV LA N  TG  AA+KVISK++F ++  ++ V
Sbjct: 5    NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF-NAQGSTFV 63

Query: 64   DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123
             +  PD LPYGIEREI+IMKLLNH NVLRLYDVWET  +LYMVLEY EKGELFNLLV+RG
Sbjct: 64   GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123

Query: 124  PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183
            PLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIK+ADFGMAALE++DKL
Sbjct: 124  PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 183

Query: 184  LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243
            LETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ
Sbjct: 184  LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243

Query: 244  AGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPR 303
            +G++E+P +DEIS EA++LI +IL V P +RI  R+ILKHPLLQKYPSIKDSKSIRNLPR
Sbjct: 244  SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPR 303

Query: 304  EDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363
            EDTYL+PL   +  ID+ ILQNLVVLWHGRD  EI +KLKE GAN EKT YA+L+RFK +
Sbjct: 304  EDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363

Query: 364  VEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHK 423
             EQ+ LK + +  R S   STS +P  N   + +R S N   +  KK R+S I+V+S+HK
Sbjct: 364  NEQQQLKQQQIAKRIS---STSSSPQQNIVKSSSRRSINNILSTPKKKRSSAINVSSAHK 420

Query: 424  RPISFQKLPTLNSTSSLAAITPSTSARRKRLS--KISGYPVSNVNGSPTPASRKKRNSMA 481
            RP+S QKL      +    + P++ ++++ LS  K+S     + + SP+    +KR S+ 
Sbjct: 421  RPVSIQKL------NDCGTLNPTSPSKKRSLSNRKLSAVLAGSNSSSPS----RKRMSVG 470

Query: 482  NIQAARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQE 541
               A                RASKR+S LP +K G+I +K+I+TYAKLSED++WEY+++E
Sbjct: 471  Q-DAPPVPTAVLRDYNKRASRASKRLSFLP-SKRGSITTKIIATYAKLSEDNDWEYIDRE 528

Query: 542  TKRTSSNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 601
             KRTSS+FATLID IFEHEKYEQI                                    
Sbjct: 529  AKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEE 588

Query: 602  XXXXNET-------NDRQRIMEEEIENLKKELDMMSHEGKT------ESRSVSEPLNKKQ 648
                           + Q+ +EE++  LK E+     E +         RS+SEP+ +K 
Sbjct: 589  ERRRRREVEELIRQRELQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKG 648

Query: 649  G---------GVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEV 699
                       ++  +  LL++R  +L+TRP SRLDPG+   S E+      L+  E   
Sbjct: 649  TRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRL-SEENTILEDDLECNE--- 704

Query: 700  DNKLKTEKAILETIRRSKFLGSSFDISKELK--------SASARSDYSR----------- 740
             ++L+ EK ILETIRRSKFLGS +DI KEL+          + R    R           
Sbjct: 705  -DRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQE 763

Query: 741  ----APGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFS 796
                + G  +T+      S +LPKN  A   L+    +P  RK+S++K+PQFTR+S++FS
Sbjct: 764  QRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEP--RKLSEVKIPQFTRRSKHFS 821

Query: 797  ESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNS---AGQSEFLFXXX 853
             SSKRLSVLSMYST+ S+ NL+D +     N D      Q + P S     + EF+F   
Sbjct: 822  ASSKRLSVLSMYSTKVSYTNLADYL-----NNDVQLKSLQPSAPTSIKIPQEPEFMFESA 876

Query: 854  XXXXXXXXXXXXDGKLYXXXXXXXXXXKKGLRVNL-----SDRYNKANSEADMEN-KLPI 907
                        D  L           + G  V L     S+  +K  SE D+   KLPI
Sbjct: 877  GQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPI 936

Query: 908  LPPLDP--EIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKA 965
            LPPLD   +  GLGIYQ       A P+E               G+P +  +  ++I+  
Sbjct: 937  LPPLDHLNKPNGLGIYQ-----APAPPKEPL-------------GQPVMKSMIPDDIKIK 978

Query: 966  PQPPITEKKKLDAKKQRNDERTKASKENTF-SNNFLRKLSGQSNTTTQSVKKTKLGAEDG 1024
              P     ++   ++    + TK   E    +  F    + +  +  +   + K+ ++  
Sbjct: 979  CVPNQLSPRRRATERAPEKKLTKTVPERVIAAETFPPPNTKKKPSFFKKFSREKMHSDCD 1038

Query: 1025 IH--TTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEII 1082
            +   TTV  ++M++ L  LL GW SYGLK ++    + TITGKL+S+NILSLRST FEI+
Sbjct: 1039 VQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIV 1098

Query: 1083 IIREGK-GSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMI 1122
            I+     GS V   KKSGS K   RL  E++ +L KE V++
Sbjct: 1099 ILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLV 1139

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1134 (42%), Positives = 650/1134 (57%), Gaps = 163/1134 (14%)

Query: 15   IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            IG WK+GETLG+GS GKV+LA ++ T ++ A+K+ISK+IF   N      N     LPY 
Sbjct: 18   IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIF---NTEGNYGNHG-SVLPYN 73

Query: 75   IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
            IEREIVIMKLL+H NVL LYDVWETN+NLY++LEYAEKGELFNLLV+RG LPE EA++ F
Sbjct: 74   IEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCF 133

Query: 135  RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            RQIII +SYCHALGIVHRDLKPENLLLD+ YNIK+ADFGMAAL+T+  LLETSCGSPHYA
Sbjct: 134  RQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYA 193

Query: 195  APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
            APEIVSG+PY GF+SDVWSCGVIL+ALLTGRLPFDEE+GNIR LLLKVQ GQFEMP+D E
Sbjct: 194  APEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTE 253

Query: 255  ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAET 314
            ISK+AQ+LISKILVV+PA+RI  RDIL HPLL++Y +IKDSKSI++LPREDTYL+PLA+ 
Sbjct: 254  ISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADA 313

Query: 315  NSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHL 374
             +AID++ILQNLVVLWHGR   EI+ KLK  G N EKTLYA+L RFKL+  +E+ K    
Sbjct: 314  GAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRH 373

Query: 375  KNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQKLPTL 434
            K +++  +  S    T+ S    R   N  +TPRK+   +  +  SS K+  SF      
Sbjct: 374  KTKKTKNRKFS----TSSSLVKGR---NLESTPRKRTSKTHSNNFSSGKKRSSF------ 420

Query: 435  NSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSMANIQAARSSXX--- 491
                    ++P++                 +N SP P    K  S+ N  +  S      
Sbjct: 421  -------ILSPNS-----------------INSSPIPLRNSKGISLRNATSGGSPVVPVI 456

Query: 492  XXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFAT 551
                       +SKR S +PN K+G++ S+L+S Y KL ++D+WE +E++TKRTSSNFAT
Sbjct: 457  LLNSFKRNSKLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFAT 516

Query: 552  LIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETNDR 611
            LIDEIFE E++E                                               R
Sbjct: 517  LIDEIFEPEEFELAKREKVELQRKV----------------------------------R 542

Query: 612  QRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAALQTR-- 669
               M + I +  +  D M  E K  +  VS PL       E   +ELL+  +  L  R  
Sbjct: 543  GSKMSDNIGDRSEFTDGMK-ELKRINAKVSSPLI----NYEFSQQELLQDIDTLLTNRYQ 597

Query: 670  ------PKSRLDPGLFFDSAES--DTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLGS 721
                  P S+LDPGL   +  +  D +  +  + + EV         I+ETI RSKFLGS
Sbjct: 598  LSAYTRPISKLDPGLMPAAGTTPHDIKEQTALIRDTEV--------KIIETIHRSKFLGS 649

Query: 722  SFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKIS 781
              ++    +   ++ D   AP         +E S +     I+T PL I+ D+ EVRKIS
Sbjct: 650  LLNV----REGMSKDDDELAP---------IEESSI-----ISTTPL-IYDDRTEVRKIS 690

Query: 782  DIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPN 841
            D++VP FTRKSR+F+ +S R SVLS+YS+R SFK+LS +   E  ++ +  +    ++  
Sbjct: 691  DVEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSK 750

Query: 842  SAGQSEFLFXXXXXXXXXXXXXXXDGK-----LYXXXXXXXXXXKKGLRVNLSDRYNKAN 896
              G +E L                 G      LY          +    V  SD  +  +
Sbjct: 751  KVGHTESLASVAEHIDDDSYNDHNSGMNSDNVLYDVPEGVDLPQE----VKNSDEQSSCS 806

Query: 897  SEADMENKLPI--LPPLDP----EIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEG 950
              +      P+  LP L        +GLGIYQ +P +V+         + + +T D  E 
Sbjct: 807  LVSSSLEPTPVVELPSLSSFQGKNASGLGIYQREPSKVSL-------PTATIDTSDAVEN 859

Query: 951  -EPEV-SDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSN 1008
             E EV  +LK ++I  A   P       D  K+ N+   +A      S+N          
Sbjct: 860  RETEVKKELKHDSI--ATNLPD------DNVKENNNATAEAPSRIKKSSNV--------- 902

Query: 1009 TTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLAS 1068
            +  +++ K K+  E  IH  +   ++++GL+ LL GW  YGLK +  ++  M I GKL +
Sbjct: 903  SILKNISKGKI-LELEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVN 961

Query: 1069 ENILSLRSTIFEIIIIREGKG-SKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            ++ILSLRST+FEII++  G   S +   KK+GS+K + +LA E++ +L KEGV+
Sbjct: 962  DSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEGVL 1015

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
            kinase of the bud neck involved in the septin checkpoint,
            associates with septin proteins, negatively regulates
            Swe1p by phosphorylation, shows structural homology to
            bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1138 (42%), Positives = 651/1138 (57%), Gaps = 151/1138 (13%)

Query: 15   IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            IG WK+GETLG GSTGKVQLA ++ TG++ A+KVISK+IF ++   S  D+     LPY 
Sbjct: 18   IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS----VLPYN 73

Query: 75   IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
            IEREIVIMKLL+H NVL LYDVWETN+NLY++LEYAEKGELFNLLV+ GPLPE EAI  F
Sbjct: 74   IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF 133

Query: 135  RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            RQIIIGISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  LLETSCGSPHYA
Sbjct: 134  RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYA 193

Query: 195  APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
            APEIVSG+PY GFASDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP D E
Sbjct: 194  APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE 253

Query: 255  ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAET 314
            IS++AQ+LI KILVV+P +RI  RDIL HPLL+KY +IKDSKSI++LPRE+TYL+PLA++
Sbjct: 254  ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADS 313

Query: 315  N----SAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLK 370
            N    ++ID++ILQNLVVLWHGR   +I  KLKE+G N EK LYA+L RFKLD  + + K
Sbjct: 314  NNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDSVRGSNK 373

Query: 371  NEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQK 430
                K +++  +    +   + S+++  ++ +  +TPR+  R S                
Sbjct: 374  KNRNKIKKT--KKNKRSSTLSSSSSLLLNNRSIQSTPRR--RTSKRHSREFSSSRKRSSF 429

Query: 431  LPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSMANIQAARSSX 490
            L + N T S + I   +S R   ++  S    +  +G P P    KRNS       RSS 
Sbjct: 430  LLSSNPTDS-SPIPLRSSKRITHINVASANTQATPSGVPNP---HKRNS-----KKRSS- 479

Query: 491  XXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFA 550
                          KR+S +PN K  ++ SK +S +  L +DD+WEY+E++ KRTSSNFA
Sbjct: 480  --------------KRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFA 525

Query: 551  TLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETND 610
            TLIDEIFE EK+E                                           ++ +
Sbjct: 526  TLIDEIFEPEKFE-------------------------LAKREKAELQRKVQEAKRQSVN 560

Query: 611  RQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAALQ--- 667
             Q+I E+E      E+     E K  +  VS PL       E   +ELL+  +  L    
Sbjct: 561  AQKINEDE---FGSEVSDGMKELKKINDKVSSPL----INYEFSQQELLQDIDTLLTNRY 613

Query: 668  -----TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKL----KTEKAILETIRRSKF 718
                 TRP SRLDPGL           P  +     +  K      TEK I+ETIRRSKF
Sbjct: 614  QLSSYTRPISRLDPGL----------TPVTETLPNNLKEKTALLQDTEKKIIETIRRSKF 663

Query: 719  LGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVR 778
            LGS  ++   L           +PG+   AP  +E S +     ++T PL I++D+ E R
Sbjct: 664  LGSLLNVRGGL-----------SPGKSELAP--IEESPI-----VSTTPL-IYNDRMEPR 704

Query: 779  KISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIA 838
            +ISD++VP FTRKS++F+ ++ R SVLS+Y+ + S K+L++ +  E  +        Q +
Sbjct: 705  RISDVEVPHFTRKSKHFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPP-----QGS 758

Query: 839  TPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXXXXXXXXXKKGLRVNLSDRYNKAN-- 896
            T N +   +                  D K                 V +S  Y+  +  
Sbjct: 759  TDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKN 818

Query: 897  ---------SEADMENKLPILPPLDPEIA-GLGIYQDQPEEVNAKPQEKKSKSKSAETGD 946
                     +E  +  KLP L     + A GLG+YQ +P +V            S  + +
Sbjct: 819  PNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLYQREPSKVTL---------PSLTSNN 869

Query: 947  ISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQ 1006
             S G         ENI    +   TE +K+ A    +D +    K++  + N    +   
Sbjct: 870  SSVG---------ENIEDGAEKG-TESEKIAASLSDDDLKEDNDKKDNDTVNAPTTVKKP 919

Query: 1007 SNTTTQSVKKTKLGA--EDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITG 1064
             N+    +KK   G   E  IH  +   ++Y+GL+ LL GW  YGLK++  N  NM ITG
Sbjct: 920  PNSVL--LKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITG 977

Query: 1065 KLASENILSLRSTIFEIIIIREGKG-SKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            KL +++IL LRST+FEI+++  G G S +   KK+GSTK + +LA E++ +L KEGV+
Sbjct: 978  KLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVL 1035

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (REAL)
          Length = 1032

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1141 (41%), Positives = 646/1141 (56%), Gaps = 162/1141 (14%)

Query: 15   IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            IG WK+GETLG GSTGKVQLA ++ TG + A+KVI K+IF+        D+     LP+ 
Sbjct: 18   IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDS----VLPFN 73

Query: 75   IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
            IEREIVIMKLL+H NVL LYDVWET++NLY++LEYAEKGELFNLLV+RGPLPE EAI+ F
Sbjct: 74   IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133

Query: 135  RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            +QIII ISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  +LETSCGSPHYA
Sbjct: 134  KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193

Query: 195  APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
            APEIVSG+PY GFASDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP + E
Sbjct: 194  APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253

Query: 255  ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAE- 313
            IS +AQ+LI +ILVV+P +RI  RDIL HPLL+KY +IKDSKSI++LPRE+TYL+PLA+ 
Sbjct: 254  ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313

Query: 314  ---TNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLK 370
               T+  ID++ILQNLV+LWHGR   EI  KL+++G N EKTLYA+L RFKL+  +E  K
Sbjct: 314  DNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNK 373

Query: 371  NEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKK-NRASVISVTSSHKRPISFQ 429
                K  ++         +++ S+A N  S   ++ PRK  +R    +  SS KR  SF 
Sbjct: 374  RSRSKINKTKKSKRVSTLSSSSSSAFNHQS--LDSAPRKHASRGHSKNFPSSRKRS-SF- 429

Query: 430  KLPTLNSTSSLAAITP-STSARRKRLSKISGYPVSNVNGSPTPASRKKRNSMANIQAARS 488
                L+S S+  +  P  +S R    S + G    N    P  + + KRNS         
Sbjct: 430  ---ILSSNSTDCSPIPLRSSKRISISSAVPG----NTLQVPDSSLKLKRNS--------- 473

Query: 489  SXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSN 548
                         R+SKR+S +PN   G++ + L+S Y  L +DD+WEY++++TKRTSSN
Sbjct: 474  ------------KRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSN 521

Query: 549  FATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNET 608
            FATLIDEIFE EK+E                                           + 
Sbjct: 522  FATLIDEIFEPEKFE-------------------------LAKREKAELQKKVQEAKRQV 556

Query: 609  NDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAALQ- 667
            +    I +E      K++     +G  E + ++  ++      E   KELL+  +  L  
Sbjct: 557  SKNAPISDE------KDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKELLQDIDTLLTN 610

Query: 668  -------TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKL----KTEKAILETIRRS 716
                   TRP SRLDPGL           P        +  K      TE  I+ETIR+S
Sbjct: 611  RYQLSSYTRPISRLDPGL----------TPVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660

Query: 717  KFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPE 776
            +FLGS  ++ + +   +                + L   +V PK  I+T PL +++DQ E
Sbjct: 661  EFLGSLLNVREGISQDN----------------NQLASIEVSPK--ISTTPL-MYNDQVE 701

Query: 777  VRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQ 836
            +RKISD++VP FTRKS++F+ ++ R SVLS+YS ++S ++L+ +   E  ++        
Sbjct: 702  IRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQ----- 756

Query: 837  IATPNSAGQSEFLFXXXXXXXXXXXXXXXDGK-----------LYXXXXXXXXXXKKGLR 885
              + ++A +SE +                D             LY           +G  
Sbjct: 757  -GSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNGMNNNNILY--DVPECVDSPQGYD 813

Query: 886  VNLSDRYNKANSEADMENKLPILPPLDP----EIAGLGIYQDQPEEVNAKPQEKKSKSKS 941
            +N +       S++     +  LP L        +GLGIYQ          +E   +S  
Sbjct: 814  INDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASGLGIYQ----------RESSRESLP 863

Query: 942  AETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLR 1001
            + T +ISE +    +   + I+      I       A   + D  +   +E++   +FL+
Sbjct: 864  SVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKADSYKGD-ISNIVRESSHG-SFLK 921

Query: 1002 KLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMT 1061
            KLS           K K+  E  +   +S  ++Y+GL+ LL GW  YGLK++  N+ +M 
Sbjct: 922  KLS-----------KGKI-LELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMI 969

Query: 1062 ITGKLASENILSLRSTIFEIIIIREGKG-SKVDIKKKSGSTKAVNRLAGEVKNVLVKEGV 1120
            I+GKL ++ ILSLRST+FEI+I+  G G S +   KK+GSTK + + A E++ +L KEGV
Sbjct: 970  ISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGV 1029

Query: 1121 M 1121
            +
Sbjct: 1030 L 1030

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/562 (62%), Positives = 431/562 (76%), Gaps = 12/562 (2%)

Query: 4   NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63
           N    ++KG +IG W +GETLG+GSTGKV +A N  TG  AA+K+ISK+IF ++  ++ V
Sbjct: 6   NSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF-NAQGSTFV 64

Query: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123
            +  PD LPYGIEREI IMKLLNH NVLRLYDVWET+++LYMVLEY EKGELFNLL+ERG
Sbjct: 65  GSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124

Query: 124 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183
           PLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIK+ADFGMAALE++DKL
Sbjct: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184

Query: 184 LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243
           LETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDE+DGNIR LLLKVQ
Sbjct: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQ 244

Query: 244 AGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPR 303
           +G+FEMP+ DEIS EAQ+LI+KIL V+P+ RI  R+ILKHPLL+KYPSIKDSKSIRNLPR
Sbjct: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304

Query: 304 EDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363
           EDTYL+PL   +  +D  IL+NLVVLWHGRD  EI +KL E G N EKT YA+L+RFK +
Sbjct: 305 EDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYE 364

Query: 364 VEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHK 423
            EQ+ LK + +  R S   S S +P  N   + +R S N+     KK R+S I+V+S+HK
Sbjct: 365 NEQQQLKQQQIAKRIS---SASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAHK 421

Query: 424 RPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRNSMANI 483
           RP+S QK   +   ++   I+PS    +KR   +S   +S +  +P+ +  +KR S+A  
Sbjct: 422 RPVSIQKWGEIGGGNN-GLISPS----KKR--SLSNRKLSAILNTPSSSPSRKRMSIAQ- 473

Query: 484 QAARSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETK 543
            A                R SKR S LP+ K  +I SK+I+TYAKLSED++WEY+++E K
Sbjct: 474 DAPPMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAK 533

Query: 544 RTSSNFATLIDEIFEHEKYEQI 565
           RTSS+FATLID IFEHEKYEQI
Sbjct: 534 RTSSDFATLIDNIFEHEKYEQI 555

 Score =  199 bits (505), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 177/575 (30%), Positives = 259/575 (45%), Gaps = 107/575 (18%)

Query: 612  QRIMEEEIENLKKELDMMSHEGKTES--------RSVSEPLNKKQG--------GVEIEV 655
            QR +E+E+  L+ EL+    E +  S        RSVSEP  +            ++  +
Sbjct: 632  QRSLEDEVAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSI 691

Query: 656  KELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRR 715
              +L +R  ++QTRP SRLDPG+       +      ++     +  L+ EK ILETIRR
Sbjct: 692  NTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILS---ERTLRREKTILETIRR 748

Query: 716  SKFLGSSFDISKELKSASA------------------RSDYSR----APGRVITAPSNLE 753
            S FLGS FDI KELK+A                    R  Y      + G  IT+  +  
Sbjct: 749  SNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGY 808

Query: 754  RSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQS 813
             +  L ++        +  D+ E +K+S++++P+ TR+SR+ S SSKR SVLSMYST  S
Sbjct: 809  DTTSLTRHTTVGV---LRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTS 865

Query: 814  FKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFXXXXXXXXXXXXXXXDGKLYXXX 873
            + NL+D M  + +     +     A+     Q EF+F                       
Sbjct: 866  YTNLADFMKSDVQ----LKPLNDTASSKVTQQPEFMFESTIDNVERISSNDN-----SHI 916

Query: 874  XXXXXXXKKGLRVNLSDRYNKA----------NSEADMEN-----KLPILPPLD---PEI 915
                      +++N +DR+ K           N++ D E      KLP LPPL+      
Sbjct: 917  SSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSP 976

Query: 916  AGLGIYQ-DQPEE------VNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQP 968
             GLGIYQ   P E       +  P E K     A  G   +  P  S  K   IR+    
Sbjct: 977  NGLGIYQHSSPREDFKHAVRSVTPNENKENEDPA--GTTQQKAPLTSVGKELGIRE---- 1030

Query: 969  PITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTT 1028
            P+T+  +    K+R               +F RK S +         K K   +  + TT
Sbjct: 1031 PLTDLAQQGVPKKR--------------PSFFRKFSKE---------KIKPEYDYQLDTT 1067

Query: 1029 VSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGK 1088
            V+ T+M++ L  LL GW SYGLK ++ +     ITGKL+S+NILSLRST F++++     
Sbjct: 1068 VNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNH 1127

Query: 1089 GSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMIT 1123
            GS V   KKSGS K   RL  E++ +L KE V+I+
Sbjct: 1128 GSSVRFTKKSGSKKTFARLVNEIEKILEKEKVLIS 1162

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/828 (48%), Positives = 506/828 (61%), Gaps = 119/828 (14%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           IG W++GETLG GSTG+VQLA ++ TG++ A+KVISKTIF     T         ALPY 
Sbjct: 10  IGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFD----TEDGGGXXXLALPYN 65

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
           IEREIV+MKLL+H NVL LYDVWETN+NLY++LEYAEKGELFNLLV+RGPLPE EA++ F
Sbjct: 66  IEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCF 125

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
           RQIII ISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+ +LLETSCGSPHYA
Sbjct: 126 RQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPHYA 185

Query: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           APEIVSG+PY GFASDVWSCGVIL+ALLTGRLPFDE++GN+R+LLLKVQ GQFEMP+  E
Sbjct: 186 APEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATE 245

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAE- 313
           ISK+AQNLIS+ILVV+P +R+  RDIL HPLL+KY +I+DSKSIRNLPRE+TYL+PLA+ 
Sbjct: 246 ISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADA 305

Query: 314 ---TNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLK 370
              TN+ ID +ILQNLVVLWHGR   EI   LK++G N EKTLYA+L RFK   ++ N +
Sbjct: 306 GNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK---QEANKR 362

Query: 371 NEH-LKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQ 429
           + H +K               + S++ NR SG+                 S +      +
Sbjct: 363 SRHKIKKTTKKNPPYPSMSILSSSSSHNRLSGSTPR-------RRTPKRRSMNFSSSKKR 415

Query: 430 KLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPA---SRKKRNSMANIQAA 486
               L S SS  +  PS +++R      S +  ++ N  P P    +  KRNS       
Sbjct: 416 SSFILASNSSNGSPMPSRNSKRS-----SFFNTASANVPPVPVKLLNSYKRNS------- 463

Query: 487 RSSXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTS 546
                          R+SKR+S +PN K G++ SK +S Y  L ++D+WEY+E++TKRTS
Sbjct: 464 --------------KRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTS 509

Query: 547 SNFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN 606
           SNFATLIDEIFE EK+E                                          N
Sbjct: 510 SNFATLIDEIFEPEKFE----------------LARREKAELQRKVQEAKRGKSDVAKLN 553

Query: 607 ETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAAL 666
           + N  +    + +E LKK            +  VS PL       E   +ELL+  N  L
Sbjct: 554 QENGNETGKSDAMEELKK-----------INNKVSSPL----INYEYSQQELLQDINTLL 598

Query: 667 Q--------TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNK----LKTEKAILETIR 714
                    TRP S+LDPGL           P+ +    ++  K    L TE  ILETIR
Sbjct: 599 TNRCQLSAYTRPISKLDPGLM----------PTPETIPYDIKEKTDLLLDTEMKILETIR 648

Query: 715 RSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLRIHSDQ 774
           +SK L SS ++ KE+       D  R P        ++E S +      +T PL  ++D 
Sbjct: 649 KSKILDSSLNLRKEVS-----RDADRLP--------SVEESPI-----ASTTPLVYNNDS 690

Query: 775 PEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMN 822
            EV KISDI+VP FTRKS+ F+ ++ R SVLS+YS+R SFK LS ++N
Sbjct: 691 KEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRILN 738

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/232 (35%), Positives = 128/232 (55%), Gaps = 33/232 (14%)

Query: 896  NSEADMENKLPILPPLDPEIA-GLGIYQDQPE-EVNAKPQEKKSKSKSAETGDISE-GEP 952
            N+E     KLP L     + A GLGIYQ +P  E + +   +   + +    D+ E GE 
Sbjct: 818  NTEPTTFVKLPSLSSFQEKNASGLGIYQREPSIEPSIESSIEPLPNVTIAIEDVDEDGEN 877

Query: 953  EVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSN-NFLRKLSGQSNTTT 1011
            E+   + ENI  +           +   ++ND+     +E  +SN +FL+K S       
Sbjct: 878  EI---QHENITTSLS---------NDNIKKNDDTKDTIRE--YSNVSFLKKFS------- 916

Query: 1012 QSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENI 1071
                K K+  E  IH  + A ++++GL+ LL GW  YGLK++  ++ NM ITGKL ++NI
Sbjct: 917  ----KGKI-LELEIHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNI 971

Query: 1072 LSLRSTIFEIIII--REGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121
            LSLRST+FEII++  R+ + S +   KK+GSTK + +L  E++ VL KEGV+
Sbjct: 972  LSLRSTLFEIIVLPNRDDR-SLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/510 (66%), Positives = 401/510 (78%), Gaps = 30/510 (5%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           +TNK +  +KG+ +G WK+GETLGLGSTGKVQLAYN +TG QAAIKVISK +F + N  +
Sbjct: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANA 63

Query: 62  MVDNT--TPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
             D+   TPD+LPYGIEREI+IMKLLNH NVLRLYDVWET+SNLYMVLEYAEKGELFNLL
Sbjct: 64  S-DSALLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
           EDKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+IL+ALLTGRLPFDEEDGNIRNLL
Sbjct: 183 EDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLL 242

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299
           LKVQ+GQFEMP +DEIS+EAQ+LISKIL V+P +RI  R+ILKHPL+QKYPSIKDSK+IR
Sbjct: 243 LKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIR 302

Query: 300 NLPREDTYLHPLAETN---SAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAM 356
           NLPREDTYL+PL++ N     ID  ILQNLVVLWHGRD  EI  KLKE GANAEKTLYA+
Sbjct: 303 NLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYAL 362

Query: 357 LNRFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASV 415
           L+RFK D E+E  +   LK RQS  Q T     +N S   + S G    TP ++KNRAS+
Sbjct: 363 LDRFKNDTEKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASM 422

Query: 416 ISVTSSHKRPISFQKLPTLNSTSSL------------AAITPSTSARR----KRLS---- 455
           +SV+S+HKRP+SF +L   + ++ +            + I  S + +R    KR+S    
Sbjct: 423 VSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLS 482

Query: 456 ---KISGYPVSNVNGSPTPASRKKRNSMAN 482
              +IS    +++N SPTP++  KR S+ N
Sbjct: 483 SNKRISQLLANDLNTSPTPSNCTKRMSIIN 512

 Score =  219 bits (557), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 173/512 (33%), Positives = 238/512 (46%), Gaps = 103/512 (20%)

Query: 502  RASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEK 561
            R+ KR S+ PN + G+I +KLISTYA+L+EDD+WE++E+ETKR SSNFATLID IFEHEK
Sbjct: 609  RSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEK 668

Query: 562  YEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETNDRQRIMEEEIEN 621
            YEQI                                         E    Q+ ME +I+N
Sbjct: 669  YEQIRKEKDELERKVRENKKREEEERLVREAIEKEKQIELEK---ERLQLQKEMEGDIDN 725

Query: 622  LKKELDMMSHEGKTES----------------------RSVSEPLNKKQGGVEIEVKELL 659
             K+ +   + EGK E+                      RSVS PL K +   +    +  
Sbjct: 726  AKETV--QTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPF-DYS 782

Query: 660  RQRNAALQTRPKSRLDPGLFFDSAE-SDTRNPSL---QVFEGEVDNKLKTEKAILETIRR 715
            +QRN +L+TRP SRLDPGL + S   S   NPS     +      N++ T+K ILETIRR
Sbjct: 783  KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRR 842

Query: 716  SKFLGSSFDISKELKSAS---------------------------ARSDYSRAPGRVITA 748
            SKFLGSSFD+ KEL+                              ++ +   +  R+++ 
Sbjct: 843  SKFLGSSFDLKKELEMVEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVST 902

Query: 749  PSNLERSDVLPK-NAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSM 807
             ++   +++LPK +A  T  + ++    + R +S+IKVPQFTRKS+ FSES+KRLSVLS+
Sbjct: 903  TNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSL 962

Query: 808  YSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQS-EFLFXXXXXXXXXXXXXXXD 866
            YS+R+SF NL DM+  +  N +  E      +P +  Q  EFLF               D
Sbjct: 963  YSSRESFTNLVDMLKEDGINVEPTER-----SPTTKSQEPEFLFESPSVDTYSRDSSTED 1017

Query: 867  GKLYXXXXXXXXXXKKGLRVNLSDRYNKANSEADMEN----------------------- 903
             K               LR++  DR+N+  S  D E                        
Sbjct: 1018 -KPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDL 1076

Query: 904  ------------KLPILPPLDP-EIAGLGIYQ 922
                        KLP LPPL   +  GLGIYQ
Sbjct: 1077 STPKAKDESNLVKLPALPPLTTKKTDGLGIYQ 1108

 Score =  103 bits (256), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 1029 VSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREG- 1087
            V+A QM++GL  L RGW  YGLK+IK + E++  TGK++SENILS +ST+FE+ II    
Sbjct: 1296 VAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISNSV 1355

Query: 1088 KGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMI 1122
            K   +  KK SGS+K+V RL  EV+NVL KEGV++
Sbjct: 1356 KTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
            Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/989 (41%), Positives = 554/989 (56%), Gaps = 105/989 (10%)

Query: 202  IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQN 261
            +PYHGF SDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQ+GQFEMP+ DEIS EAQ+
Sbjct: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 262  LISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAETNSAIDEN 321
            LI+KIL V+PA RI +R+ILKHPLLQKYPSIKDSKSIRNLPREDTYL+PL   N +IDE+
Sbjct: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 322  ILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHLKNRQSGG 381
            I+ NLVVLWHGRD  EI  +LKE GAN EKT YA+L RFK D  QE LK      +Q   
Sbjct: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLK------QQRRS 183

Query: 382  QSTSMAPA-TNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQKLPTLNSTSSL 440
            Q++ ++P  +N   +V+R S   N TP+KKN+A VIS +SSHKRP+SF +L + N+ S+ 
Sbjct: 184  QASHISPKRSNMRNSVSRRSIT-NVTPKKKNKAPVISASSSHKRPVSFNRL-SFNNGSNT 241

Query: 441  AAITPSTSARRKRLSKISGYPVS---NVNGSPTPASRKKRNSMANIQAA---------RS 488
            A   P+++++R  ++  S   +S   N N SPTP    KR+SM ++ A+         + 
Sbjct: 242  AHTPPTSASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKD 299

Query: 489  SXXXXXXXXXXXXRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSN 548
                         R SKR+S LP NK G+I +KLI+TYAK+S+D++WEY+E+ET+RTS++
Sbjct: 300  YNKSAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSAD 359

Query: 549  FATLIDEIFEH--------EKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            FATL DEIFEH        EK E                                     
Sbjct: 360  FATLCDEIFEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQREMELQHQMRL 419

Query: 601  XXXXXNETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEP------LNKK--QGGVE 652
                     + Q ++E+EI  LK+ ++          RSVS P      ++K+   G ++
Sbjct: 420  EEESRRRQRETQELIEQEIALLKQSVNPQGPSDSNHVRSVSAPAESVLKVDKRGSTGNLD 479

Query: 653  IEVKELLRQRNAALQTRPKSRLDPGLFFDSAESD--TRNPSLQVFEGEVDNKLKTEKAIL 710
             ++  LL +R  +L+TRPKSRLDPG++  S E D  ++N             L TEK IL
Sbjct: 480  NDIMALLNRRTFSLETRPKSRLDPGIY-TSEEEDFGSKNHGAD---------LSTEKTIL 529

Query: 711  ETIRRSKFLGSSFDISKELK----------SASARSDYSRAPGRVITA--PSNLERSDVL 758
            ETIRRSKFLGSSFDI+KEL           + + R D  R      TA    N   S  L
Sbjct: 530  ETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGNGYESQTL 589

Query: 759  PKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLS 818
            PK  + +A         E RKIS+++VPQFTR+SR+F+ S+KRLSVLSMYST+ SF NL+
Sbjct: 590  PKRKMGSA----MEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLA 645

Query: 819  DMMNFESENTDAAENRGQIATPNSAG----QSEFLFXXXXXXXXXXXXXXXDGKLYXXXX 874
            D +         A+ +    +P SA     ++EF+F               D +LY    
Sbjct: 646  DHLK------GKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAE 699

Query: 875  XXXXX-XKKGLRVNLSDRYNKANSEADMEN------KLPILPPLDPE----IAGLGIYQD 923
                   K  +++N +DR+N+  S    +       KLP LPPLD      ++GLG+YQ 
Sbjct: 700  TKDAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGLYQA 759

Query: 924  --QPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLK--AENIRKAPQPPITE-----KK 974
              +P   +A+P  K       E+   +E    V++ +  A+N    P  P+       KK
Sbjct: 760  TAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKK 819

Query: 975  KLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAED-GIHTTVSATQ 1033
              DA ++   + T A  E   + +F RK S + +   +S      G  D    T +  TQ
Sbjct: 820  NTDADRKPLSDITPAV-EKKANKSFFRKFSSKGSDEKKS------GDYDFRFKTVIEETQ 872

Query: 1034 MYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVD 1093
            M+  L  LL  W  YGLK +  +     I GKL+S+NILSLRST+F I ++  G+GS V+
Sbjct: 873  MFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVE 932

Query: 1094 IKKKSGSTKAVNRLAGEVKNVLVKEGVMI 1122
              KKSGS K   +L  E++ +L  +  ++
Sbjct: 933  FTKKSGSNKTFKKLVKEIEKILESKKALV 961

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  403 bits (1035), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 256/351 (72%), Gaps = 14/351 (3%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K      NV    +NT   +LP
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK-----RNVRH--NNTQLTSLP 111

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL++H NV+ LY+VWE    LY+VLEY E GELF+ L+ RG LPE EA+ 
Sbjct: 112 YGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVH 171

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSP 191
           +F+QI+ G+SYCH   I HRDLKPENLLLD K  ++KIADFGMAALET DKLLETSCGSP
Sbjct: 172 YFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSP 231

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N++ LLLKVQ+G+++MP+
Sbjct: 232 HYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMPQ 289

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPL 311
           +  IS EA++LI+KIL+V+PA RIT  ++L+HPLL KY   + SKS  NL   D+  + +
Sbjct: 290 N--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNIV 346

Query: 312 A-ETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
             E+   IDE+IL NL +LWHG     +  KL + G   EK  Y++L R++
Sbjct: 347 VLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  400 bits (1028), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/456 (46%), Positives = 290/456 (63%), Gaps = 35/456 (7%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K + + +N  S   N     LP
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNA-SKKSNAANGNLP 114

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL++H N++ LY+VWE  S L++VLEY E GELF+ LV +G LPE EA+ 
Sbjct: 115 YGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVH 174

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSP 191
           +FRQII G++YCH   I HRDLKPENLL+D K + IKIADFGMAALET +KLLETSCGSP
Sbjct: 175 YFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSP 234

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQ+G++ MP+
Sbjct: 235 HYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMPQ 292

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPL 311
           +  IS EAQ+LISKIL+V+P  RIT  ++L+HPL+ KY   +         + ++ LH L
Sbjct: 293 N--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARS--------KSNSDLHLL 342

Query: 312 AET--------NSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363
           + T           ID +IL NL +LWHG     I  +L +HG   EK  Y++L +++ +
Sbjct: 343 SRTPQLVTLQSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ-E 401

Query: 364 VEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNR---------SSGNKNTTPRKKNRAS 414
            +  +++N+          + +  P      AV           S  +   +P+K     
Sbjct: 402 RQNPSVENDSFVETTVSVSTGTPTPTPAAEDAVGAPKLLQKSQFSIPSLKVSPKKMKDGY 461

Query: 415 VISVTSSHKRPISFQKLPTLNSTSSLAAITPSTSAR 450
           V+S +   K+ +S + LP    ++S  +I PS S R
Sbjct: 462 VVSSSRVFKKSVSKRSLP---HSTSKKSIPPSVSKR 494

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  394 bits (1011), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/413 (51%), Positives = 272/413 (65%), Gaps = 46/413 (11%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D IG WK+G+TLG GS+G+V+LA N  TG  AA+K++ KT            ++ P+ALP
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT-----------KSSRPNALP 101

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL++H NV+ LY+VWE    L++VLEY + GELF+ LV RG L E EAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIH 161

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSP 191
           +FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQAG+++MP+
Sbjct: 222 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMPQ 279

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPL 311
              IS EAQ+LIS+ILVV+P +RIT  DIL HPL+ KY   K SKS       ++ LH L
Sbjct: 280 --AISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKS-------NSDLHIL 329

Query: 312 AETNSAI---------DENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKL 362
           + T+  I         D  ILQNL +LWHG     I  +L E     EKT Y++L    L
Sbjct: 330 SHTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLL----L 385

Query: 363 DVEQENLKNEHLKNRQSGGQSTSM-APATNQSTAVNRSSGNKNTTPRKKNRAS 414
             +Q  LK        +G +S  + AP   Q +  +  S    ++P K++ AS
Sbjct: 386 AYQQRQLK--------AGPKSPPVNAPKILQKSQFSVPSIKSQSSPHKEHVAS 430

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  392 bits (1007), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 247/353 (69%), Gaps = 17/353 (4%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D +G WK+G+TLG GS+G+V+LA N  +G  AAIK++ K      NV       T  ALP
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPK-----RNVRHNQKQVT--ALP 108

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL+ H N++ LY+VWE  S LY+VLEY E GELF+ L+ RG LPE EAI 
Sbjct: 109 YGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH 168

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSP 191
           +F+QI+ G+SYCH   I HRDLKPENLLLD K   +KIADFGMAALET ++LLETSCGSP
Sbjct: 169 YFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSP 228

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N+R LLLKVQ G+++MP 
Sbjct: 229 HYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPS 286

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHP- 310
           +  +SKEA++LISKILVV+P +RIT   IL+HPLL KY +    K     P E     P 
Sbjct: 287 N--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEERPK 342

Query: 311 LAETNSA--IDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
           + + +S   IDE IL NL +LWHG     +  KL + G   EK  YA+L R++
Sbjct: 343 VLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  394 bits (1011), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 273/402 (67%), Gaps = 48/402 (11%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK---------- 51
           +T K++     D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K          
Sbjct: 65  VTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNN 124

Query: 52  -TI---FQDSNVTSMVDNTTPDAL-----------PYGIEREIVIMKLLNHANVLRLYDV 96
            T+   +  S VTS V  ++P  +           PYGIEREIVIMKL++HANV+ L++V
Sbjct: 125 GTVPNSYSSSMVTSNV--SSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEV 182

Query: 97  WETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKP 156
           WE  S LY+VLEY + GELF+ LV RG LPE EAI +F+QI+ G+SYCH+  I HRDLKP
Sbjct: 183 WENKSELYLVLEYVDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKP 242

Query: 157 ENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCG 215
           ENLLLD K   IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG
Sbjct: 243 ENLLLDKKNKKIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCG 302

Query: 216 VILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERI 275
           ++L+ALLTG LPF+  D NI+ LLLKVQ+G+++MP +  +S EA+NLISKILV++P +RI
Sbjct: 303 IVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRI 358

Query: 276 TARDILKHPLLQKYPSIKDSKSIRNLP-------REDTYLHPL---------AETNSAID 319
           T ++IL+HPL++KY ++  +K +R +        + ++ LH L           T + ID
Sbjct: 359 TTQEILEHPLIKKYDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEID 418

Query: 320 ENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
           E+IL++L +LWHG     I  KL +   + EK  Y++L R+K
Sbjct: 419 ESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  392 bits (1006), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/391 (50%), Positives = 266/391 (68%), Gaps = 48/391 (12%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK--------------TIFQDSN 58
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K                +  S 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 59  VTSMVDNTTPDAL-----------PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVL 107
           VTS V  ++P  +           PYGIEREIVIMKL++H NV+ L++VWE  S LY+VL
Sbjct: 136 VTSNV--SSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVL 193

Query: 108 EYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YN 166
           EY + GELF+ LV +G LPE EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   
Sbjct: 194 EYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRR 253

Query: 167 IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRL 226
           IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG L
Sbjct: 254 IKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHL 313

Query: 227 PFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           PF+  D NI+ LLLKVQ+G+++MP +  +S EA++LISKILV++PA+RIT ++ILKHPL+
Sbjct: 314 PFN--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLI 369

Query: 287 QKYPSIKDSKSIRNLPRE-------DTYLHPLAETN---------SAIDENILQNLVVLW 330
           +KY  +  +K +R + R+       ++ LH L   +         S IDE+IL++L +LW
Sbjct: 370 KKYDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILW 429

Query: 331 HGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
           HG     I  KL +   + EK  Y++L ++K
Sbjct: 430 HGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  388 bits (997), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/389 (50%), Positives = 266/389 (68%), Gaps = 44/389 (11%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK-----------TI---FQDSN 58
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K           T+   +  S 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 59  VTSMVDNTT---------PDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEY 109
           +TS V + +             PYGIEREIVIMKL++HANV+ L++VWE  S LY+VLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 110 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIK 168
            + GELF+ LV +G LPE EAI +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 169 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPF 228
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           +  D NI+ LLLKVQ+G+++MP +  +S EA++LISKILV+NP +RIT ++IL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 289 YPSIKDSKSIRNLPRE-------DTYLHPLAETNSA---------IDENILQNLVVLWHG 332
           Y ++  +K IR + R+       ++ LH L   + +         IDE+IL++L +LWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 333 RDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
                I  KL +   + EK  Y++L ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  384 bits (987), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 246/353 (69%), Gaps = 19/353 (5%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D +G WK+G+TLG GS+G+V+LA N  TG  +AIK++ K   + + +           LP
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ---------LP 118

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL++H NV+ LY+VWE  S LY+VLEY E GELF+ LV +G LPE+EAI 
Sbjct: 119 YGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIH 178

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLD-TKYNIKIADFGMAALETEDKLLETSCGSP 191
           +F+QI+  ++YCH   I HRDLKPENLLLD  K +IKIADFGMAALET DKLLETSCGSP
Sbjct: 179 YFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCGSP 238

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N++ LLLKVQ+G+++MP+
Sbjct: 239 HYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMPQ 296

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKS---IRNLPREDTYL 308
              +S EA++LIS+ILVV+P  RIT   IL+H LL KY     SKS   +  L R    +
Sbjct: 297 --WLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPNIV 354

Query: 309 HPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
              +E +  IDE IL NL +LWHG     +  +L + G   EK  Y++L  ++
Sbjct: 355 SFSSERD--IDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQ 405

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  385 bits (990), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 261/392 (66%), Gaps = 47/392 (11%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK----------------TIFQD 56
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K                +   +
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 57  SNVTSMVDNTTPDAL-----------PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYM 105
           S+ TS + NTT +             PYGIEREIVIMKL++HANVL LY+VWE  S LY+
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 106 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKY 165
           VLEY + GELF+ LV RG L E EA+ +F+QII G+SYCHA  I HRDLKPENLLLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 166 N-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTG 224
           + IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 225 RLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHP 284
            LPF+  D +I+ LLLKVQ+G+++MP++  +SKEAQ+LI+KIL VNPA+R+T  +IL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 285 LLQKYPSIKDSKSIRNL------PREDTYLHPLAETNSA---------IDENILQNLVVL 329
           L+ KY S+  +K  + L       + +  LH L    +          ID+ IL NL +L
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQIL 429

Query: 330 WHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
           WHG     I  KL +   + EK  Y++L ++K
Sbjct: 430 WHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  387 bits (995), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/389 (50%), Positives = 265/389 (68%), Gaps = 44/389 (11%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK-----------TI---FQDSN 58
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K           T+   +  S 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 59  VTSMVDNTT---------PDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEY 109
           VTS V + +             PYGIEREIVIMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 110 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIK 168
            + GELF+ LV +G LPE EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 169 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPF 228
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           +  D NI+ LLLKVQ+G+++MP +  +S EA++LISKILV++P +RIT ++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 289 YPSIKDSKSIRNLPRE-------DTYLHPLAETNSA---------IDENILQNLVVLWHG 332
           Y  +  +K +R + ++       ++ LH L   + +         IDE+IL++L +LWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 333 RDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
                I  KL +   + EK  Y++L ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  384 bits (986), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 258/380 (67%), Gaps = 39/380 (10%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT---------IFQDSNVTSM- 62
           D +G WK+G+TLG GS+G+V+LA N   G  AAIK++ K             + N T++ 
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 63  ----VDNTTPDALP---YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGEL 115
               ++NT+   +P   YGIEREIVIMKL++H NV+ L++VWE  ++L++VLEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 116 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN-IKIADFGM 174
           F+ LV +G LPE EA+ +F+QII G+++CH+  I HRDLKPENLLLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 175 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN 234
           AALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKD 294
           IR LLLKVQ+G+F +P +  IS EAQ+LI+KILVVNP +RI   DILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 295 SK-------SIRNLPREDTYLHPLAETN------SAIDENILQNLVVLWHGRDPAEIRVK 341
            K       S  NL  E    H L   N      + IDE+IL+NL +LWHG     I  K
Sbjct: 379 VKFNQVPNPSATNLNSE----HMLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAK 434

Query: 342 LKEHGANAEKTLYAMLNRFK 361
           L ++  +AEK  Y++L ++K
Sbjct: 435 LLQYPMSAEKIFYSLLWQYK 454

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  379 bits (974), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/355 (54%), Positives = 246/355 (69%), Gaps = 33/355 (9%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           D IG WK+G+TLG GS+G+V+LA N  TG  AAIK++ KT            ++   +LP
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKT-----------KSSRTGSLP 101

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREI+IMKL++H NV+ LY+VWE    L++VLEY + GELF+ LV RG LPE EAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH 161

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-YNIKIADFGMAALETEDKLLETSCGSP 191
           +FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQAG+++MP+
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMPQ 279

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPL 311
              +S  AQ+LIS+ILVV+P +RI+  +IL HPLL KY + K SKS       ++ LH L
Sbjct: 280 --SVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKS-------NSDLHIL 329

Query: 312 A---------ETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAML 357
           +         ++ S +D  ILQNL +LWHG     I   L +     EKT Y++L
Sbjct: 330 SHSKPQISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLL 384

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  379 bits (974), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/383 (51%), Positives = 259/383 (67%), Gaps = 41/383 (10%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT-IFQDSNVTSMV-------- 63
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ KT IF+  N  S          
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 64  --------DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGEL 115
                   ++T     PYGIEREIVIMKL++H NV+ LY+VWE  S L++VLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 116 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN-IKIADFGM 174
           F+ LV RG L E EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 175 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN 234
           AALE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKD 294
           I+ LLLKVQ+G+F+MP++  IS EA++LIS+ILVV+P +RI   DIL HPL++KY   +D
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---ED 379

Query: 295 SKSIRN-------LPREDTYLHPLAETNSA---------IDENILQNLVVLWHGRDPAEI 338
           +K+  N         + ++ LH L +   +         IDE+IL+NL +LWHG     I
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELI 439

Query: 339 RVKLKEHGANAEKTLYAMLNRFK 361
             KL +   + EK  Y++L ++K
Sbjct: 440 ISKLLQTPMSEEKLFYSLLLQYK 462

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  380 bits (975), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 247/385 (64%), Gaps = 44/385 (11%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIF-----QDSNVTSMV---- 63
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K        QDS   S+     
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 64  -------DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELF 116
                  + T P    YGIEREIVIMKL++H NV+ LY+VWE  S LY+VLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 117 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN-IKIADFGMA 175
           + LV RG LPE EA+ +F+QII G++YCHA  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNI 235
           ALE  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+IL+ALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYP----- 290
           + LLLKVQ+G + MP D  +S +A++LISKILVV+P +R+T  +IL H L+ KY      
Sbjct: 306 KKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 291 --------SIKDSKS------IRNLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPA 336
                   S+   KS      I NL   D  L    +    ID +IL NL +LWHG    
Sbjct: 364 NRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCD----IDTSILSNLQILWHGESKH 419

Query: 337 EIRVKLKEHGANAEKTLYAMLNRFK 361
            I  KL +   N EK  Y++L ++K
Sbjct: 420 AIIDKLLQPNMNEEKLFYSLLLKYK 444

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  376 bits (965), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/398 (49%), Positives = 256/398 (64%), Gaps = 53/398 (13%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQ-DSNVTSMVDNTTPD-- 69
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K   + D    S   +T  D  
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 70  ----------------------------ALPYGIEREIVIMKLLNHANVLRLYDVWETNS 101
                                       A PYGIEREIVIMKL++H+N+L LY+VWE  S
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 102 NLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 161
            LY+VLEY + GELF+ LV RG L E EA+ +F+QI+ G+SYCH+  I HRDLKPENLLL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 162 DTK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYA 220
           D K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+A
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 221 LLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDI 280
           LLTG LPF+  D NI+ LLLKVQ+G+F MP++  +S EA++L+SKILVVNP +RI   +I
Sbjct: 336 LLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 281 LKHPLLQKYPS----IKDSKSIRNLP----REDTYLHPLAETNS---------AIDENIL 323
           L HPLL KY      +K   S+  +     + ++ LH L  +NS          ID++I+
Sbjct: 392 LNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIV 451

Query: 324 QNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
            NL +LWHG     I  KL +   + EK  Y++L  +K
Sbjct: 452 SNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  374 bits (960), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 261/387 (67%), Gaps = 48/387 (12%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK-------------TIFQ---- 55
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K             + F     
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 56  -DSNVTSMVDNTTP---------DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYM 105
            +SN++++   T+P            PYGIEREIVIMKL++H NV+ LY+VWE  S LY+
Sbjct: 156 SNSNISTLA--TSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYL 213

Query: 106 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTK- 164
           VLEY + GELF+ LV +G L E EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K 
Sbjct: 214 VLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKN 273

Query: 165 YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTG 224
            +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG
Sbjct: 274 KSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTG 333

Query: 225 RLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHP 284
            LPF+  D NI+ LLLKVQAG+F MP    +S EAQ+LIS+ILV++P++RIT   IL HP
Sbjct: 334 HLPFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHP 389

Query: 285 LLQKY-PSIKDSKSIRNLPREDTYLH--------PLAETN-SAIDENILQNLVVLWHGRD 334
           L+ KY P+ K+  S     + ++ LH        P++ T+ + ID +IL+NL +LWHG  
Sbjct: 390 LILKYEPAGKNMVS----GKSNSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTS 445

Query: 335 PAEIRVKLKEHGANAEKTLYAMLNRFK 361
              I  KL +   + EK  Y++L ++K
Sbjct: 446 RELIIAKLLQTPMSEEKLFYSLLWQYK 472

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  373 bits (957), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/386 (49%), Positives = 252/386 (65%), Gaps = 40/386 (10%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQ----------------- 55
           D +G WK+G+TLG GS+G+V+LA N   G  AAIK++ K  +                  
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSG 147

Query: 56  -----DSNVTSMVDNTTPDAL-PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEY 109
                 SN    + N T  AL PYGIEREIVIMKL++H NV+ L +VWE  S LY+VLEY
Sbjct: 148 TDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEY 207

Query: 110 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN-IK 168
            + GELF+ LV +G L E EA+ +F QII G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 208 VDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIK 267

Query: 169 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPF 228
           IADFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALLTG LPF
Sbjct: 268 IADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

Query: 229 DEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           +  D NI+ LLLKVQAG+F++P    ++ +A++LI++ILV NP +R+T  +IL HPL++K
Sbjct: 328 N--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEKRLTINEILNHPLIKK 383

Query: 289 Y---PSIKDSKSIRNLPREDTYLHPLAETNSA---------IDENILQNLVVLWHGRDPA 336
           Y   P+     ++    + ++ LH L     A         ID++IL++L +LWHG    
Sbjct: 384 YRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQ 443

Query: 337 EIRVKLKEHGANAEKTLYAMLNRFKL 362
            +  +L   GA  EK  Y++L ++KL
Sbjct: 444 RLVERLLVEGATEEKLFYSLLFQYKL 469

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  373 bits (957), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/472 (43%), Positives = 283/472 (59%), Gaps = 72/472 (15%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK--------------------- 51
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K                     
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 52  ---TIFQDSNVTSMVDNTTPDAL-------PYGIEREIVIMKLLNHANVLRLYDVWETNS 101
              +   ++  T    NT   A+       PYGIEREIVIMKLL+H NV+ LY+VWE N+
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 102 NLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 161
            LY+VLEY + GELF+ LV +G L E+EA+ +F+QII GISYCH+  I HRDLKPENLLL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 162 DTKYN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYA 220
           D K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD+WSCG+IL+A
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 221 LLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDI 280
           LLTG LPF+  D NI+ LL+KVQ G+++MP    IS+EA+NLIS+ILVV+P++RI+   I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQI 384

Query: 281 LKHPLLQKY---------------------PSIKDSKSIRNLPREDTYLHPLAETNSAID 319
           L HPLL KY                      S  D   + N+P+    +   A   S ID
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRAR--SDID 442

Query: 320 ENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHLKNRQS 379
           E+IL+NL +LWHG     I  KL +   + EK +Y++L ++K    Q N K+    +  S
Sbjct: 443 ESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK----QINFKSSKAPSISS 498

Query: 380 GGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRPISFQKL 431
              + S++    +++   R++ N          A+ IS+   +  P+ F K+
Sbjct: 499 ASVNISVSAQDTETSTNTRTNSNS---------ATDISIPFVNTEPLQFNKI 541

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  328 bits (842), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 166/298 (55%), Positives = 214/298 (71%), Gaps = 13/298 (4%)

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREIVIMKL++H NV+ LY+VWE  S LY++LEY + GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLL-LDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           +F+QII G+SYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQAG+++MP+
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY-PSIKDSKSIRNLPREDTYL-- 308
           +  +S EA++LIS+ILVV+P++R+T  +IL HPL+ KY  S K    ++     D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 309 -----HPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361
                +    +   IDE+IL+NL +LWHG     I  KL +   + EK  Y++L ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (76%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK 51
           D +G WK+G+TLG GS+G+V+LA N  TG  AAIK++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  317 bits (813), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 160/316 (50%), Positives = 217/316 (68%), Gaps = 33/316 (10%)

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           YGIEREIVIMKL++H NV+ LY+VWE  + LY+VLEY + GELF+ LV +G L E EA+R
Sbjct: 205 YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVR 264

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN-IKIADFGMAALETEDKLLETSCGSP 191
           +F+QII G+ YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+  + LL+TSCGSP
Sbjct: 265 YFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSP 324

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           HYA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D +I+ LL+KVQ G+++MP 
Sbjct: 325 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP- 381

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYP---SIK--------------- 293
            + +SK+A++LIS+IL+VNP  R+T   IL+HPL+ KY    S+K               
Sbjct: 382 -NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNN 440

Query: 294 --------DSKSIRNLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEH 345
                   D   ++N+P + T +  L   N  ID++IL+NL +LW+G     +  KL + 
Sbjct: 441 LMRGKSNTDLAILQNIP-DKTDIIQLRSRND-IDDSILRNLQILWNGVPRETLISKLIQD 498

Query: 346 GANAEKTLYAMLNRFK 361
             + EK +Y++L ++K
Sbjct: 499 PVSEEKLIYSLLWQYK 514

 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT 52
           D IG WK+G+TLG GS+G+V+LA NK TG  AAIK++ K+
Sbjct: 91  DMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKS 130

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  247 bits (630), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 113/120 (94%), Positives = 118/120 (98%)

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           MKLL+HANVLRLYDVWETNSNLYMVLEY EKGELFNLLVERGPLPENEA+RFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 142 SYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 201
           SYCHALGIVHRDLKPENLLLD K+NIKIADFGMAALE++DKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  257 bits (657), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 193/293 (65%), Gaps = 23/293 (7%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LA++ TT  + A+K+I+K +   S++            
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR--------- 74

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA+  ELF+ +V+R  + ENE  
Sbjct: 75  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGR 130

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGSP
Sbjct: 131 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSP 190

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY LL  RLPFD+E  +I  L   +  G + +P 
Sbjct: 191 NYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP- 247

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPL----LQKY--PSIKDSKSI 298
            + +S+ A +LI K+L+VNP  RIT  DI++ P     L +Y  PS KD+  I
Sbjct: 248 -NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFKVDLPEYLVPSEKDAIKI 299

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  255 bits (651), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 187/281 (66%), Gaps = 17/281 (6%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           ++NK +    G ++G++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++  
Sbjct: 23  VSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQG 82

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
                        IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+
Sbjct: 83  R------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 129

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
           R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+ 
Sbjct: 130 RNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 189

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   
Sbjct: 190 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 247

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282
           +  G + +P+   +S  A +LI ++L+VNP  RI+  +I++
Sbjct: 248 ISNGVYTLPK--FLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  254 bits (649), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 127/271 (46%), Positives = 183/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++            
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 90

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+EA 
Sbjct: 91  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEAR 146

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 147 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 206

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 207 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK 264

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S+ A  LI K+L+VNP  RI+ ++I++
Sbjct: 265 --FLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  253 bits (647), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 183/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LA++ TTG + A+K+I++ +   S++            
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR--------- 86

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H +++RLYDV ++   + M++EYA   ELF+ +V+R  + ENEA 
Sbjct: 87  ---IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEAR 142

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           +FF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGSP
Sbjct: 143 KFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSP 202

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP- 259

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
            + +S  A +LI K+L+VNP  RI+  +I++
Sbjct: 260 -NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  252 bits (643), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 182/272 (66%), Gaps = 17/272 (6%)

Query: 11  KGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDA 70
           +G  IG +++ +TLG GS GKV+LAY+ +TG + A+K+I+K +   S++           
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR-------- 79

Query: 71  LPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEA 130
               IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  +PE EA
Sbjct: 80  ----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEA 134

Query: 131 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGS 190
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 135 RRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 194

Query: 191 PHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMP 250
           P+YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P
Sbjct: 195 PNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIP 252

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILK 282
             + +S+ A +LI K+L+VNP  RIT  +I++
Sbjct: 253 --NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  252 bits (644), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 185/281 (65%), Gaps = 17/281 (6%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           + N  +    G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++  
Sbjct: 38  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQG 97

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
                        IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+
Sbjct: 98  R------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 144

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
           R  + E+EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+ 
Sbjct: 145 RDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 204

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   
Sbjct: 205 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 262

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282
           +  G + +P+   +S  A +LI ++L+VNP  RI+  +I++
Sbjct: 263 ISNGVYSLPK--FLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  251 bits (641), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 127/271 (46%), Positives = 184/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TT  + A+K+I+K I   S++            
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR--------- 86

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++  ++ MV+EYA+  ELF+ +V+R  + ENEA 
Sbjct: 87  ---IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEAR 142

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           +FF+QII  + YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+   L+TSCGSP
Sbjct: 143 KFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSP 202

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD  D +I  L   +  G + +P+
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLPK 260

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S  A NLI ++L+VNP  RI+  +I++
Sbjct: 261 --FLSPGAANLIKRMLIVNPLNRISMNEIME 289

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  252 bits (643), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 183/281 (65%), Gaps = 17/281 (6%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           + N  +    G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++  
Sbjct: 39  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQG 98

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
                        IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+
Sbjct: 99  R------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 145

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
           R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+ 
Sbjct: 146 RDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 205

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   
Sbjct: 206 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 263

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282
           +  G + +P+   +S  A  LI ++L+VNP  RI+  +I++
Sbjct: 264 ISNGVYTLPK--FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  251 bits (642), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 183/281 (65%), Gaps = 17/281 (6%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           + N  +    G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++  
Sbjct: 39  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQG 98

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
                        IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+
Sbjct: 99  R------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 145

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
           R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+ 
Sbjct: 146 RDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 205

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   
Sbjct: 206 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 263

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282
           +  G + +P+   +S  A  LI ++L+VNP  RI+  +I++
Sbjct: 264 ISNGVYTLPK--FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  251 bits (641), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 183/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TTG + A+K+I++ +   S++            
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR--------- 88

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA+  ELF+ +V+R  + E EA 
Sbjct: 89  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQEAR 144

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 145 RFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 204

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 205 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLPR 262

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S+ A +LI K+L+VNP  RI+  +I++
Sbjct: 263 --FLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  250 bits (639), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 183/281 (65%), Gaps = 17/281 (6%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           + N  +    G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++  
Sbjct: 40  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQG 99

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
                        IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+
Sbjct: 100 R------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 146

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181
           R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+ 
Sbjct: 147 RDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 206

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   
Sbjct: 207 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 264

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282
           +  G + +P+   +S  A  LI ++L+VNP  RI+  +I++
Sbjct: 265 ISNGVYTLPK--FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  250 bits (639), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 166/471 (35%), Positives = 256/471 (54%), Gaps = 45/471 (9%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TT  + A+K+I+K +   S++   V        
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGRV-------- 113

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
               EREI  ++LL H ++++LYDV ++   + MV+EYA   ELF  +V+R  + ENEA 
Sbjct: 114 ----EREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEAR 168

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           +FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 169 KFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSP 228

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD  D +I  L   +  G + +P+
Sbjct: 229 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLPK 286

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ-KYPSIKDSKSIRNLPREDTYLHP 310
              +S+ A NLI K+L+VNP  RI+  +I+     +  +P         +   E   L  
Sbjct: 287 --FLSEGAANLIKKMLIVNPLNRISMTEIIHDEWFKVDFPEYLLESQANSTSEE---LMK 341

Query: 311 LAETNSAIDENILQNLVVLWHGRDPAEI----RVKLKEHGANAEKTLYAML-NRFKLDVE 365
            A  ++ ID+ ++  L  +  G D  EI    R ++ E   +   ++ + + N + L  E
Sbjct: 342 KANKDNQIDDRLVDALSKIM-GYDKNEIYNCLRTEIAEDSNSPNSSMVSEIKNAYTLLKE 400

Query: 366 QENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHKRP 425
            E +   H  N       +   P+  Q T    + GN +TTP ++            + P
Sbjct: 401 NEQIMESHADNSNFDTILSQTLPSFQQRTL---NKGN-STTPDEE------------RTP 444

Query: 426 ISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKK 476
           +   +   +N  +S  AI P++  +  R + +S   + N N  P  + + K
Sbjct: 445 MFLTQ--HMNEGNSGVAILPTSLPQLHRANMLSSGLLQNSNIHPLVSKKSK 493

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  250 bits (638), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 183/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K I   S++            
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR--------- 93

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + +V+E+A   ELF+ +++R  + ENEA 
Sbjct: 94  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEAR 149

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 150 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSP 209

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 210 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK 267

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S  A +LI ++L+VNP  RI+  +I++
Sbjct: 268 --FLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  250 bits (638), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 130/290 (44%), Positives = 189/290 (65%), Gaps = 18/290 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++            
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 105

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA 
Sbjct: 106 ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEAR 161

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 162 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 221

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 222 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK 279

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ-KYPSIKDSKSIRN 300
              +S+ A +LI ++L+VNP  RI+  +I++    +   P    S+ +RN
Sbjct: 280 --FLSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  248 bits (632), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 179/269 (66%), Gaps = 17/269 (6%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           +IG +++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++              
Sbjct: 27  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 75

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
            IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA RF
Sbjct: 76  -IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRF 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L TSCGSP+Y
Sbjct: 134 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
           AAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+  
Sbjct: 194 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLPK-- 249

Query: 254 EISKEAQNLISKILVVNPAERITARDILK 282
            +S  A NLI ++L+VNP  RIT  +I++
Sbjct: 250 FLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  247 bits (630), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 182/271 (67%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG +++ +TLG GS GKV+LA++ +TG + A+K+I+K +   S++            
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------- 83

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA 
Sbjct: 84  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEAR 139

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 140 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 199

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 200 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK 257

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S+ A NLI ++L+VNP  RIT  +I++
Sbjct: 258 --FLSQGAANLIKRMLIVNPLNRITIHEIME 286

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 181/276 (65%), Gaps = 17/276 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TT  + A+K+I+K +   S++            
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR--------- 89

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + +V+E+A   ELF+ +++R  + E EA 
Sbjct: 90  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEAR 145

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 146 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSP 205

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWSCGVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 206 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK 263

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
              +S  A NLI K+L+VNP  RI+  +I K    Q
Sbjct: 264 --FLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  246 bits (628), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 180/269 (66%), Gaps = 17/269 (6%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           +IG +++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++              
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR----------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
            IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+EA RF
Sbjct: 77  -IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRF 134

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+Y
Sbjct: 135 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNY 194

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
           AAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+  
Sbjct: 195 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK-- 250

Query: 254 EISKEAQNLISKILVVNPAERITARDILK 282
            +S  A NLI ++L+VNP  RIT  +I++
Sbjct: 251 FLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  246 bits (629), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/271 (46%), Positives = 180/271 (66%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG +++ +TLG GS GKV+LAY+ +T  + A+K+I+K +   S++            
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA 
Sbjct: 88  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEAR 143

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 144 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 203

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 204 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK 261

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S  A NLI K+L+VNP  RIT  +I++
Sbjct: 262 --FLSPGAANLIKKMLIVNPLNRITIHEIME 290

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  246 bits (628), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 180/271 (66%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G +IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++            
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------- 86

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + E EA 
Sbjct: 87  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEAR 142

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 143 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 202

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK 260

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S  A  LI ++L+VNP  RI+  +I++
Sbjct: 261 --FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  245 bits (626), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 179/269 (66%), Gaps = 17/269 (6%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           +IG +++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++              
Sbjct: 26  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 74

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
            IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + E EA RF
Sbjct: 75  -IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRF 132

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+Y
Sbjct: 133 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNY 192

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
           AAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+  
Sbjct: 193 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLPK-- 248

Query: 254 EISKEAQNLISKILVVNPAERITARDILK 282
            +S  A NLI ++L+VNP  RIT  +I++
Sbjct: 249 FLSPGAANLIKRMLIVNPLNRITIHEIME 277

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  244 bits (623), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 180/271 (66%), Gaps = 17/271 (6%)

Query: 12  GDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71
           G  IG++++ +TLG GS GKV+LAY+ TTG + A+K+I+K +   S++            
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------- 95

Query: 72  PYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAI 131
              IEREI  ++LL H ++++LYDV ++   + MV+EYA   ELF+ +V+R  + E EA 
Sbjct: 96  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEAR 151

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP
Sbjct: 152 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 211

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE 251
           +YAAPE++SG  Y G   DVWS GVILY +L  RLPFD+E  +I  L   +  G + +P+
Sbjct: 212 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK 269

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              +S+ A  LI ++L+VNP  RI+  +I++
Sbjct: 270 --FLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  202 bits (515), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 167/294 (56%), Gaps = 38/294 (12%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN------QAAIKVISKTIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L ++KT+ +      Q AIK+I +                 
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR----------------- 79

Query: 69  DALPYGIEREIVI------MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
           D +P   E+EI I      +K LNH N++RL +V + +  + +VLEYA  GE +  + ++
Sbjct: 80  DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKK 139

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETED 181
             L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E+
Sbjct: 140 RRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPEN 199

Query: 182 KLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DG-NI 235
           +L++TSCGSP YAAPE +V+  PY    +DVWSCGVILYA+L G LP+D++    DG +I
Sbjct: 200 ELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDI 259

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
             L   +     + P  D I+   ++L+ +IL+ +P  RIT    LKH  LQ +
Sbjct: 260 GKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  203 bits (516), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 163/282 (57%), Gaps = 15/282 (5%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            G + +G TLG G  GKV+L ++KTTG+    K ++  + +   V    D          
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKEV------K 94

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
           I REI  +K L H N++RL +V + +  + +VLEYA  GE +  + ++  L E+ A R F
Sbjct: 95  IYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAACRLF 154

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETSCGSPHY 193
            Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       +++L++TSCGSP Y
Sbjct: 155 AQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCGSPCY 214

Query: 194 AAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQAGQF 247
           AAPE +V+  PY    +D+WSCGVI+YA+L G LP+D++  N     I  L   +     
Sbjct: 215 AAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPL 274

Query: 248 EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           + PE   I+   ++L+ +ILV NP +R+  R + +H  LQ +
Sbjct: 275 KFPE--YINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 178/315 (56%), Gaps = 23/315 (7%)

Query: 11  KGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDA 70
           K    G + +G TLG G  GKV++ +    GN+    V  +   +     S+ ++ + + 
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEV 94

Query: 71  LPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEA 130
               I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + +R  L E+ A
Sbjct: 95  ---KIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKEHVA 151

Query: 131 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETSCG 189
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ++++L+ TSCG
Sbjct: 152 CRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTTSCG 211

Query: 190 SPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DG-NIRNLLLKVQ 243
           SP YAAPE+V S  PY G  +D+WSCG+IL+A+L G LP+D++    DG +I  L   + 
Sbjct: 212 SPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYYIT 271

Query: 244 AGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPS-----------I 292
               + PE   I+   ++L+ +ILV +P  R+T R+I  H  L+K+             I
Sbjct: 272 HTALKFPE--YITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWDRI 329

Query: 293 KDSKSIRNLPREDTY 307
             SK+I  LP+ + +
Sbjct: 330 SQSKNITRLPKHNKH 344

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  203 bits (517), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 183/309 (59%), Gaps = 25/309 (8%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT--IFQD------SNVTSMVDNT 66
           +G W   ET+G GS GKV+LA N+ T    AIK++++   IF        S+ T+ +   
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 67  TPDALPYG--IEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGE 114
             D L     +E+EI           + ++L H ++ RL++++  +++ YM+ EY   G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 115 LFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGM 174
           L + +++ G L E+ A  F RQI+  + Y HA  IVHRDLK EN+++ +  NIKI DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 175 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN 234
           + L  + K L+T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIK 293
           +  L  K++ G+   P+   +S E  +L+S +LVV+P +R T   ++KH  + K Y SI 
Sbjct: 334 V--LHEKIKQGRVFYPQ--FLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 294 DSKSIRNLP 302
           D+   + +P
Sbjct: 390 DAHLPKRVP 398

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  201 bits (511), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 168/289 (58%), Gaps = 28/289 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN------QAAIKVISK-TIFQDSNVTSMVDNTT 67
            G + +G TLG G  GKV++ ++KT+ +      Q AIK+I + TI ++S          
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKE------- 89

Query: 68  PDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPE 127
                  I REI  +K LNH N++RL +V + +  + +VLEYA  GE +  + ++  L E
Sbjct: 90  -----VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 144

Query: 128 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLET 186
           + A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E++L++T
Sbjct: 145 SAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKT 204

Query: 187 SCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DG-NIRNLLL 240
           SCGSP YAAPE +V+  PY    +D+WSCGVI+YA+L G LP+D++    DG +I  L  
Sbjct: 205 SCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYR 264

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            +     + P  D I+   ++L+  ILV +P +RIT    L H  LQ +
Sbjct: 265 YITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  199 bits (507), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 169/294 (57%), Gaps = 38/294 (12%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN------QAAIKVISKTIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L ++K   +      Q AIK+I +                 
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR----------------- 78

Query: 69  DALPYGIEREIVI------MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
           D++P   E+E+ I      +K L+H N+++L +V + +  + +VLEYA  GE +  +  +
Sbjct: 79  DSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRK 138

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETED 181
             L E  A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 139 RRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHN 198

Query: 182 KLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DGN-I 235
           +L++TSCGSP YAAPE +VS  PY    SDVWSCGVILYA+L G LP+D++    DGN I
Sbjct: 199 ELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDI 258

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
             L   +     + PE   I+  +++L+ +ILV +P +RIT R I KH  L+ +
Sbjct: 259 VRLYYYITRTPLKFPE--YITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  199 bits (507), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 175/319 (54%), Gaps = 38/319 (11%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKT----------TGNQAAIKVISK-TIFQDSNVTSMV 63
            G + +G T+G G  GKV+L ++K              Q AIK+I +  I +DS      
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKDS------ 119

Query: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123
                 +    I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  +  + 
Sbjct: 120 ------SKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKK 173

Query: 124 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDK 182
            L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++
Sbjct: 174 RLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNE 233

Query: 183 LLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IR 236
           L++TSCGSP YAAPE+V S  PY    +D+WSCG+ILYA+L G LP+D++ GN     I 
Sbjct: 234 LMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDIS 293

Query: 237 NLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSK 296
            L   +     + P  D I+   ++L+ KILV +P  RIT + I KH  L+ + +     
Sbjct: 294 RLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPHTAF---- 347

Query: 297 SIRNLPRE-DTYLHPLAET 314
            +   P E DT +HP + T
Sbjct: 348 -LSITPEEWDTIMHPKSNT 365

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  201 bits (510), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 171/288 (59%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W   ET+G GS GKV+LA ++ TG   AIK++++     + ++ N    V+N     
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 71  LPYGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++  H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R +   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+ E P+   +S E  +L+SK+LVV+P+ R + + +++HP + K
Sbjct: 343 KIKRGKVEYPQ--HLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  197 bits (501), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 162/279 (58%), Gaps = 15/279 (5%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            G + +G TLG G  GKV+L + KTT      K ++  + +   + +  +  T       
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKET------K 90

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
           I REI  +K L H N+++L +V + +  + +VLE+A  GE +  + ++  L E  A R F
Sbjct: 91  IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKETPACRLF 150

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETSCGSPHY 193
            Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++TSCGSP Y
Sbjct: 151 AQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKTSCGSPCY 210

Query: 194 AAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DG-NIRNLLLKVQAGQF 247
           AAPE +V+  PY    +DVWSCG+ILYA+L G LP+D++    DG +I  L L +     
Sbjct: 211 AAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTAL 270

Query: 248 EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           + PE   I+   ++L+ KILV +P +R+  R+I KH  L
Sbjct: 271 KFPE--YINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  198 bits (504), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 167/290 (57%), Gaps = 22/290 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +G W   ET+G GS GKV+LA ++ T    AIK++++     S V      T P +    
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAA--KSFVHKQQQMTPPKSEQEA 133

Query: 75  IER----------------EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNL 118
           +ER                E  + ++L H ++ RL+++   +++ YM+ EY   G+L + 
Sbjct: 134 LERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 193

Query: 119 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALE 178
           +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ T   IKI DFG++ + 
Sbjct: 194 IIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMY 253

Query: 179 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNL 238
              K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L
Sbjct: 254 DPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--L 311

Query: 239 LLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
             K++ G+ E P+   +S E  +L+SK+LVV+P++R T + ++ H  +Q+
Sbjct: 312 HEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  194 bits (492), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 167/302 (55%), Gaps = 40/302 (13%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNK--------TTGN------------QAAIKVISKTIF 54
            G + +G TLG G  GKV+LA++K        T GN            Q AIK+I +   
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI 104

Query: 55  QDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGE 114
                      T   +    I REI  +K L+H N+++L +V + +  + +VLEYA  GE
Sbjct: 105 -----------TKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGE 153

Query: 115 LFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGM 174
            +  +  +  L EN A R F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG 
Sbjct: 154 FYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGF 213

Query: 175 A-ALETEDKLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE- 231
                 ++ +++TSCGSP YAAPE +VS  PY    +D WSCG+IL+A+L G LP+D++ 
Sbjct: 214 VNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDP 273

Query: 232 ---DG-NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
              DG +I  L   +     + PE   I+   ++L+ KILV++P +RI  R I KHP L+
Sbjct: 274 KNPDGHDISRLYNYILNTPLKFPE--YINPVPRDLLRKILVIDPKKRINIRSIEKHPWLE 331

Query: 288 KY 289
            +
Sbjct: 332 SH 333

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 164/293 (55%), Gaps = 32/293 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTT----------GNQAAIKVISK-TIFQDSNVTSMV 63
            G + +G TLG G  GKV+L + K +            Q AIK+I + TI +DS+     
Sbjct: 45  FGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKE--- 101

Query: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123
                      I REI  +K L H N+++L +V + +  + +VLEYA  GE +  +  + 
Sbjct: 102 ---------IKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKK 152

Query: 124 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDK 182
            L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  +   +  +
Sbjct: 153 RLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGE 212

Query: 183 LLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IR 236
           L++TSCGSP YAAPE +VS  PY    +D+WSCGVILYA+L G LP+D++ GN     I 
Sbjct: 213 LMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDIS 272

Query: 237 NLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            L   +     + P  D I+   ++L+ +IL+ +P  RIT + I KH  L+ +
Sbjct: 273 RLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  194 bits (492), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 165/288 (57%), Gaps = 27/288 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTG-----NQAAIKVISK-TIFQDSNVTSMVDNTTP 68
            G + +G TLG G  G+V+L ++K T       Q AIK+I + TI ++S+          
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKE-------- 92

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
                 I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + ++  L E 
Sbjct: 93  ----IKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEA 148

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETS 187
            A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++TS
Sbjct: 149 VACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTS 208

Query: 188 CGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DGN-IRNLLLK 241
           CGSP YAAPE +VS  PY    +D+WSCGVILYA+L G LP+D++    DGN I  L   
Sbjct: 209 CGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQY 268

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           +     + PE   I+   ++L+ +IL  +P  RI+ R I KH  ++ +
Sbjct: 269 ITRTPLKFPE--YITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  190 bits (483), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 162/294 (55%), Gaps = 28/294 (9%)

Query: 11  KGDQIGSWKMGETLGLGSTGKVQLAYNK--------TTGNQAAIKVISKTIFQDSNVTSM 62
           K    G + +G T+G G  GKV+  +++        T G Q AIK+I +    +     +
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQEL 107

Query: 63  VDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
                       + REI  +KLL+H N+++L DV + +  + +VLEYA  GE +  L  +
Sbjct: 108 -----------KVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRK 156

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETED 181
             L E  A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T +
Sbjct: 157 KRLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNN 216

Query: 182 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DG-NI 235
           KL++T CGSP YAAPE+V S  PY    +D+WS GVILYA+L G LP+D++    DG NI
Sbjct: 217 KLMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNI 276

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
             L   +     + P  D I   A++LI KILV+ P  R+    + +H  L+ +
Sbjct: 277 MRLYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/329 (32%), Positives = 185/329 (56%), Gaps = 27/329 (8%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W   ET+G GS GKV+LA +  T    AIK++++     + ++ ++    +      
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIAE 220

Query: 71  LPYGIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 221 RQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 280

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 281 QHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFDN 340

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   DVWS G++LY L+ G++PFD+E+ ++  L  
Sbjct: 341 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHE 398

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300
           K++ G+ E P  + +S E  +L+SK++VV+PA+R + R +++HP + +     D   +  
Sbjct: 399 KIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRG---YDFPPLSY 453

Query: 301 LPREDTYLHPLAETNSAIDENILQNLVVL 329
           LPR       +  T  AID N+L+ +  L
Sbjct: 454 LPRR------IPLTPEAIDNNVLREMFRL 476

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  195 bits (495), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 166/288 (57%), Gaps = 23/288 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT--IFQDSNVTSMVDN-TTPDAL 71
           +G W   ET+G GS GKV+LA N+ T    AIK++++   IF      +  +  T P + 
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLSE 127

Query: 72  PYGIE----------------REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGEL 115
              IE                RE  + ++L H ++ RLY++   +++ YM+ EY   G+L
Sbjct: 128 KEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQL 187

Query: 116 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA 175
            + +++ G L E+ A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG++
Sbjct: 188 LDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGLS 247

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNI 235
            L  +   L+T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ N+
Sbjct: 248 NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV 307

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
             L  K++ G+   P+   +S E  +L+SK+LVV+P +R T   ++ H
Sbjct: 308 --LHEKIKQGKVFYPQ--FLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  192 bits (487), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 161/292 (55%), Gaps = 29/292 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTT---------GNQAAIKVISKTIFQDSNVTSMVD 64
           + G + +G TLG G  GKV++ ++ T+           Q AIK+I +   +  +   M  
Sbjct: 34  KFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEM-- 91

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
                     I REI  +K L H N++RL +V + +  + +VLEYA  GE +  +  +  
Sbjct: 92  ---------KIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRR 142

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKL 183
           L E  A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ I DFG       +++L
Sbjct: 143 LKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNEL 202

Query: 184 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE+V +  PY    +D+WSCG+ILY +L G LP+D++  N     I  
Sbjct: 203 MKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVR 262

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           L   +     + PE   I+   ++L+  ILV NP  R+++R I KH  L  +
Sbjct: 263 LYHYITKTPLKFPE--YITPLPRDLLRHILVSNPVRRMSSRHIKKHEWLSPH 312

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  194 bits (492), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 121/321 (37%), Positives = 171/321 (53%), Gaps = 45/321 (14%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKT----TGNQAAIKVISKTIFQDSNVTSMVDNTTPDA 70
            G + +G TLG G  GKV+L ++K          AIK+I +                 D 
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR-----------------DT 84

Query: 71  LPYGIEREIVI------MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
           +P   E+EI I      +KLL+H N++RL +V + +  + +VL+YA  GE +  + ++  
Sbjct: 85  VPKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRR 144

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLL 184
           L E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L+
Sbjct: 145 LKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLM 204

Query: 185 ETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
            TSCGSP YAAPE +VS  PY    +DVWSCGVILYA+L G LP+D++  N     I  L
Sbjct: 205 RTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKL 264

Query: 239 LLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY-------PS 291
              +     + PE   I    ++L+ +ILV NP  R+T  DI +H  LQ +       PS
Sbjct: 265 YQYITHTSLKFPE--YIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPHAQFLMWSPS 322

Query: 292 IKDSKS---IRNLPREDTYLH 309
             D+K+     NL R+ + +H
Sbjct: 323 DWDAKAKAETNNLFRQPSAVH 343

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  189 bits (481), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 110/298 (36%), Positives = 169/298 (56%), Gaps = 38/298 (12%)

Query: 11  KGDQIGSWKMGETLGLGSTGKVQLAY----NKTTGN--------------QAAIKVISKT 52
           K  + G + +G+TLG G  GKV+L Y    N  T N              Q AIK+I + 
Sbjct: 52  KQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRD 111

Query: 53  IFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEK 112
               S  + +            + REI  +K+L H N+++L +V + +  + +VLEYA  
Sbjct: 112 TLSASKESEI-----------KLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASG 160

Query: 113 GELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADF 172
           GE +  +  +  L E++A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ I DF
Sbjct: 161 GEFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDF 220

Query: 173 GMAALETE-DKLLETSCGSPHYAAPEIVSGI-PYHGFASDVWSCGVILYALLTGRLPFDE 230
           G     T+ +KL+ T CGSP YAAPE+V+ + PY+   +D+WSCGVILYA+L G LP+D+
Sbjct: 221 GFVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDD 280

Query: 231 EDGNIRN-----LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           +  NI       L   ++    + PE   I+   ++L+ ++L ++PA+R++ + IL+H
Sbjct: 281 DPKNINGTDIVKLYKYIENQPLKFPE--YINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  191 bits (485), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 161/294 (54%), Gaps = 28/294 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTT--------GNQAAIKVISKTIFQDSNVTSMVDN 65
           + G++ +G TLG G  GKV+L ++  +          Q AIK+I +   +  +   +   
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEI--- 98

Query: 66  TTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPL 125
                    I REI  +KLL H N++RL +V + +  + +VLE+A  GE +  L  +  L
Sbjct: 99  --------KIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRL 150

Query: 126 PENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLL 184
            E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L+
Sbjct: 151 KEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELM 210

Query: 185 ETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           + SCGSP YAAPE+V S  PY     D+WSCG+ILYA+L G LP+D++  N     I  L
Sbjct: 211 KRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKL 270

Query: 239 LLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
              +     + P    IS  A++LI KIL  NP+ RI+   I KH  L+ + S 
Sbjct: 271 YQYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  194 bits (493), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 107/335 (31%), Positives = 179/335 (53%), Gaps = 39/335 (11%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +G W   ET+G GS GKV+LA ++ T    AIK++++         +++   +    P  
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRA------TKALIHKESQQPPPRT 234

Query: 75  IE--------------------REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGE 114
            E                    RE  + ++L H ++ RL+++   +++ YM+ EY   G+
Sbjct: 235 QEEVLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 294

Query: 115 LFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGM 174
           L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ T   IKI DFG+
Sbjct: 295 LLDYIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGL 354

Query: 175 AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN 234
           + +    K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ +
Sbjct: 355 SNMFNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSS 414

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKD 294
           +  L  K++ G+ E P+   +S E  +L+SK+LVV+P++R T + ++ H  +Q+      
Sbjct: 415 V--LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRG----- 465

Query: 295 SKSIRNLPREDTYLHPLAETNSAIDENILQNLVVL 329
                + P      H +  T  A+D  ++Q +  L
Sbjct: 466 ----YDFPAPSYIPHRVPLTADALDPTVIQEMYRL 496

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  194 bits (493), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 168/288 (58%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI--FQDSNVTSMVDNTTPDALP 72
           +G W   ET+G GS GKV+LA +  T    AIK++++    F     +     +  +AL 
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEALE 210

Query: 73  Y--GIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 211 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYII 270

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y H   IVHRDLK EN+++ T  +IKI DFG++ L   
Sbjct: 271 QHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYDS 330

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   D+WS GV+LY L  G++PFD+E+ ++  L  
Sbjct: 331 KKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LHE 388

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+ + P+   +S E  +L+SK+LVV+P +R + + I+ HP + +
Sbjct: 389 KIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 161/288 (55%), Gaps = 27/288 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTG-----NQAAIKVISK-TIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L + K +       Q AIK+I + TI +D++          
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKE-------- 94

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
                 I REI  +K L H N++ L +V + +  + +VLE+   GE +  +  +  L E+
Sbjct: 95  ----VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKES 150

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETS 187
            A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       +++L+ TS
Sbjct: 151 SACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNTS 210

Query: 188 CGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLK 241
           CGSP YAAPE +VS  PY    +DVWSCGVILYA+L G LP+D++  N     I  L   
Sbjct: 211 CGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQY 270

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           +     + PE   I+   ++L+ +ILV NP  R++ R I +H  L+ +
Sbjct: 271 ITQTPLKFPE--YITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 164/291 (56%), Gaps = 27/291 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAY---NKTT--GNQAAIKVISK-TIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L +   N++T    Q AIK+I + +I QD            
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRDSILQDREKE-------- 82

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
                 I REI  +K L H N++RL +V + +  + +VLEYA  GE +  + ++  L E 
Sbjct: 83  ----IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEP 138

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETS 187
            A + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++TS
Sbjct: 139 IACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKTS 198

Query: 188 CGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRN-----LLLK 241
           CGSP YAAPE +V+  PY    +DVWSCG+IL+A+L G LP+D++  N R      L   
Sbjct: 199 CGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNY 258

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           +     + P    IS   ++L+ KILV NP +R++ R+I  H  L+ + S 
Sbjct: 259 ITTSPLKFP--SYISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 171/293 (58%), Gaps = 21/293 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI--FQDSNVTSMVDNTTPDALP 72
           +G W   ET+G GS GKV+LA +  T    AIK++++ +  F     +     T  + L 
Sbjct: 159 LGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLE 218

Query: 73  YG--IEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 219 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 278

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ T   IKI DFG++ +   
Sbjct: 279 QHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDR 338

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 339 KKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 396

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK---YP 290
           K++ G+ + P  + +S E  +L+SK+LVV+P  R + + +++HP + +   YP
Sbjct: 397 KIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 163/284 (57%), Gaps = 18/284 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAY--NKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
            G + +G TLG G  GKV+L +  N T+  + + +V  K I +D     +V N+  +   
Sbjct: 41  FGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDK----IVKNSEKEI-- 94

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
             I REI  +K L H N+++L +V + +  + +VLEYA  GE +  +  +  L E    R
Sbjct: 95  -KIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETAGCR 153

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETSCGSP 191
            F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG       ++ L++TSCGSP
Sbjct: 154 LFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSCGSP 213

Query: 192 HYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDE-----EDGNIRNLLLKVQAG 245
            YAAPE+V S  PY    +D+WSCG+ILYA+L G LP+D+     E  +I  L   +   
Sbjct: 214 CYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRT 273

Query: 246 QFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
             + PE   IS   ++L+ ++LV +P +R+  R I +H  L+ +
Sbjct: 274 SLKFPE--YISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 167/293 (56%), Gaps = 26/293 (8%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W   ET+G GS GKV+LA ++ T    AIK++   +K+      +  +    T + L
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEEL 110

Query: 72  PYGIER----------------EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGEL 115
              +ER                E  + ++L H ++ RL+++   +++ YM+ EY   G+L
Sbjct: 111 ---LERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 167

Query: 116 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA 175
            + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ +   I+I DFG++
Sbjct: 168 LDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS 227

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNI 235
            +    K L T CGS ++AAPE++   PY G   D+WS GV+LY L+ G++PFD+E+ ++
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
             L  K++ G+ E P+   +S +  +L+SK+LVV+P +R T + ++ H  +QK
Sbjct: 288 --LHEKIKQGKVEYPQ--HLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  191 bits (486), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 148/281 (52%), Gaps = 26/281 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K+   D NV              
Sbjct: 38  EVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS---DPNVV------------- 81

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  ++  + +LY+V  T + ++M LEY    EL++ L+ +  LP  E    
Sbjct: 82  ---REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAEL 138

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y
Sbjct: 139 FAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVY 198

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++   PY GF  D+WS GVILY LL G LPFDE+D      LL  Q    + P  D
Sbjct: 199 MAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVID 253

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           E     EAQNLI ++L  +P ER     IL HP LQ Y ++
Sbjct: 254 ERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 161/295 (54%), Gaps = 30/295 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN----------QAAIKVISKTIFQDSNVTSMVD 64
            G + +G TLG G  GKV+L + K   N          Q A+K+I +    +     +  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEV-- 95

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
                     I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + ++  
Sbjct: 96  ---------KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRR 146

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKL 183
           L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L
Sbjct: 147 LKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNEL 206

Query: 184 LETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE +VS  PY    +D+WSCGVILYA+L G LP+D++  N     I  
Sbjct: 207 MKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGR 266

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           L   + +   + P  D I    ++L+ +ILV +P  RI  + I KH  L+ + S 
Sbjct: 267 LYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 166/283 (58%), Gaps = 18/283 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI--FQDSNVTSMVDNTTPDALP 72
           +G W   ET+G GS GKV+LA +  T    AIKV+++    F     T     T  + L 
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEILE 239

Query: 73  Y--GIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 240 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 299

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y H+  IVHRDLK EN+++ T   IKI DFG++ L   
Sbjct: 300 QHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYDT 359

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            + L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 360 TRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 417

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           K++ G+ + P+   +S E  +L+SK+LVV+P +R T R +++H
Sbjct: 418 KIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  192 bits (488), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 166/296 (56%), Gaps = 32/296 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP-- 72
           +G W   ET+G GS GKV+LA ++ T    AIK++++         S +       LP  
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRA------TKSFIHKQQQQQLPPP 165

Query: 73  ----------YGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEK 112
                       +E+EI           + ++L H ++ RL+++   +++ YM+ EY   
Sbjct: 166 SNEEELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSG 225

Query: 113 GELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADF 172
           G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ +   I+I DF
Sbjct: 226 GQLLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDF 285

Query: 173 GMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEED 232
           G++ L    K L T CGS ++AAPE++   PY G   D+WS GV+LY L+ G++PFD+E+
Sbjct: 286 GLSNLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDEN 345

Query: 233 GNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
            ++  L  K++ G+ E P+   +S +  +L+SK+LVV+P +R T + ++ H  +QK
Sbjct: 346 ASV--LHEKIKQGKVEYPQ--HLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  192 bits (488), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 167/290 (57%), Gaps = 32/290 (11%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +G W   ET+G GS GKV+LA ++ T    AIK++++     +N     + + P   P  
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRA----TNAFLHKEQSLP---PPK 127

Query: 75  IEREIV---------------------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKG 113
            E EI+                     + ++L H ++ RL+++   +++ YM+ EY   G
Sbjct: 128 KEEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 187

Query: 114 ELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFG 173
           +L + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++ T   IKI DFG
Sbjct: 188 QLLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFG 247

Query: 174 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG 233
           ++ L  + K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ 
Sbjct: 248 LSNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENS 307

Query: 234 NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           ++  L  K++ G+ E P+   +S E  +L+SK+LVV+P  R + + +++H
Sbjct: 308 SV--LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  191 bits (486), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 166/284 (58%), Gaps = 20/284 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W+  ET+G GS GKV+LA ++ T    A+K++   +K       +     N   D L
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQ-DVL 173

Query: 72  PY--GIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           ++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 294 SRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
            K++ G+ E P+   +S E  +L+SK+LVV+P  R T + +++H
Sbjct: 352 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  187 bits (475), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 165/292 (56%), Gaps = 30/292 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKT--TG--------NQAAIKVISKTIFQDSNVTSMVD 64
            G + +G TLG G  GKV+L + +T  TG         Q AIK+I +         ++V 
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRD--------TIVK 92

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
           N+  +     I REI  +K L H NV+RL +V + +  + +VLEYA  GE +  +  +  
Sbjct: 93  NSEKEI---KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRR 149

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKL 183
           L E+ A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ I DFG       +++ 
Sbjct: 150 LKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEY 209

Query: 184 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE+V S  PY    +DVWSCG+ILYA+L G LP+D++  N     I  
Sbjct: 210 MKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGK 269

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           L   +     + PE   I+   ++L+ KILV +P +R+  + I +H  L+ +
Sbjct: 270 LYQYITRTPLKFPE--YITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  189 bits (481), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 165/291 (56%), Gaps = 22/291 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI------KVISKTIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L + K   N +A       +V  K I +D+    + +N   
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDT----ISNNYKK 93

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
           +     I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + ++  L E 
Sbjct: 94  EV---KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKET 150

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLLETS 187
            A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L++TS
Sbjct: 151 NACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 188 CGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLK 241
           CGSP YAAPE+V S  PY    +D+WSCGVILYA+L G LP+D++  N     I  L   
Sbjct: 211 CGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYNY 270

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           + +   + P  D I    ++L+ +ILV +P +R+  + I KH  L  + S 
Sbjct: 271 INSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSHFSF 319

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  189 bits (481), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 162/295 (54%), Gaps = 30/295 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN----------QAAIKVISKTIFQDSNVTSMVD 64
            G + +G TLG G  GKV+L + K   N          Q AIK+I +    +     +  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEV-- 95

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
                     I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + ++  
Sbjct: 96  ---------KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRR 146

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKL 183
           L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L
Sbjct: 147 LKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNEL 206

Query: 184 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE+V S  PY    +D+WSCGVILYA+L G LP+D++  N     I  
Sbjct: 207 MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGR 266

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           L   + +   + P  D I    ++L+ ++LV +P +RI  + I KH  L+ + S 
Sbjct: 267 LYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  189 bits (479), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 158/283 (55%), Gaps = 17/283 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKT-TGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
            G + +G TLG G  GKV+L + K  + N+   +V  K I +DS +    D         
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDS-IKKDADKEV------ 95

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
            I REI  +K L H N++ L +V + +  + +VLE+   GE +  +  +  L E+ A R 
Sbjct: 96  KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRL 155

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED-KLLETSCGSPH 192
           F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ED +L+ TSCGSP 
Sbjct: 156 FAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRTSCGSPC 215

Query: 193 YAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQAGQ 246
           YAAPE +VS   Y    +DVWSCGVILYA+L G LP+D++  N     I  L   +    
Sbjct: 216 YAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTP 275

Query: 247 FEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            + PE   I+   ++L+ +ILV NP  R++ R I +H  L+ +
Sbjct: 276 LKFPE--YITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 161/291 (55%), Gaps = 38/291 (13%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN------QAAIKVISKTIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L + K + N      Q AIK+I +                 
Sbjct: 69  FGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR----------------- 111

Query: 69  DALPYGIEREIVI------MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
           DA+  G E+EI I      +K L H N++RL +V + +  + +VLEYA  GE +  + ++
Sbjct: 112 DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKK 171

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETED 181
             L E+ A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N+ I DFG         
Sbjct: 172 RRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFSKFS 231

Query: 182 KLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DGN-I 235
           +L++TSCGSP YAAPE+V S  PY    +D+WSCG+IL+A+L G LP+D++    DGN I
Sbjct: 232 ELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDI 291

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             L   +     + PE   IS  A++L+  IL+  P +R T + ILKH  L
Sbjct: 292 AKLYKYITTTPLKFPE--YISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 211/408 (51%), Gaps = 51/408 (12%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W+  ET+G GS GKV+LA +  T    A+K++   +K       +     N   D L
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQ-DVL 186

Query: 72  PY--GIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 187 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 246

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           ++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 247 IQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 306

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 307 SRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 364

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHP-------------LL 286
            K++ G+ E P+   +S E  +L+SK+LVV+P  R T + +++H              L 
Sbjct: 365 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGPPPSYLP 422

Query: 287 QKYP---SIKDSKSIRNLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLK 343
           ++ P    I D+  ++ + R + ++  + ET S +   I     VL   R    +  K++
Sbjct: 423 KRIPLTMEILDTNVLKEMYRLE-FIDDVEETRSVLASIITDPTYVLL-SRQYWALAAKIR 480

Query: 344 EHGANAE-------------KTLYAMLNRFKLDVEQENLKNEHLKNRQ 378
               N+E             +  + ML+ + L  E  N KN  ++N+Q
Sbjct: 481 AESNNSENIPNITESFEDPTRAYHPMLSIYYLTSEMLNRKNAKIQNQQ 528

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  188 bits (477), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 161/288 (55%), Gaps = 27/288 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTG-----NQAAIKVISK-TIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L ++K +       Q AIK+I + TI +D++          
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKE-------- 94

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
                 I REI  +K L H N++ L +V + +  + +VLE+   GE +  +  +  L E+
Sbjct: 95  ----VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKES 150

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED-KLLETS 187
            A R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ I DFG      ED +L+ TS
Sbjct: 151 SACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRTS 210

Query: 188 CGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLK 241
           CGSP YAAPE +VS   Y    +DVWSCGVILYA+L G LP+D++  N     I  L   
Sbjct: 211 CGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQY 270

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           +     + PE   I+   ++L+ +ILV NP  R++ R I +H  L+ +
Sbjct: 271 ITQTPLKFPE--YITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 172/303 (56%), Gaps = 19/303 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W   ET+G GS GKV+LA +  T    AIK++++     + ++ N+           
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 71  LPYGIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ T   IKI DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E  ++  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIR 299
           K++ G  E P  + +S E  +L+SK+LVV+P  R + + +++HP + + Y  I  S   +
Sbjct: 344 KIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSYLPK 401

Query: 300 NLP 302
            +P
Sbjct: 402 RIP 404

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  189 bits (480), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 166/284 (58%), Gaps = 20/284 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W+  ET+G GS GKV+LA ++ T    A+K++   +K       +     N   D L
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQ-DVL 173

Query: 72  PY--GIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           ++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 294 SRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
            K++ G+ E P+   +S E  +L+SK+LVV+P  R T + +++H
Sbjct: 352 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  189 bits (481), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 166/283 (58%), Gaps = 18/283 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W   ET+G GS GKV+LA +  T    AIK++++     + ++ ++ +  ++     
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIME 201

Query: 71  LPYGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 202 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 261

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A RF R I   + Y HA  IVHRDLK EN+++ T   IK+ DFG++ L   
Sbjct: 262 QHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYDN 321

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 322 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 379

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           K++ G+ E  +   +S E  +L+SK+LVV+P  R + + ++ H
Sbjct: 380 KIKQGKVEYSQ--HLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  187 bits (476), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 161/295 (54%), Gaps = 30/295 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN----------QAAIKVISKTIFQDSNVTSMVD 64
            G + +G TLG G  GKV+L + K+  +          Q A+K+I +    +     +  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKEV-- 95

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
                     I REI  +K L+H N+++L +V + +  + +VLEYA  GE +  + +R  
Sbjct: 96  ---------KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRR 146

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKL 183
           L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + ++L
Sbjct: 147 LKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNEL 206

Query: 184 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE+V S  PY    +D+WSCGVILYA+L G LP+D++  N     I  
Sbjct: 207 MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGR 266

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           L   +     + P  D I    ++L+ +ILV +P  RI  + I KH  L+ + S 
Sbjct: 267 LYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPHFSF 319

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  187 bits (475), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/334 (34%), Positives = 175/334 (52%), Gaps = 58/334 (17%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN-------------------------QAAIKVI 49
            G + +G T+G G  GKV+L ++K+  N                         Q AIK+I
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 50  SK-TIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLE 108
            + TI +D                  I REI  +K L H N+++L +V + +  + +VLE
Sbjct: 118 RRDTISKDPRRE------------IKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLE 165

Query: 109 YAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIK 168
           YA  GE +  +  +  L E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N+ 
Sbjct: 166 YASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLI 225

Query: 169 IADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRL 226
           I DFG      T ++L++TSCGSP YAAPE+V S  PY     D+WSCG+IL+A+L G L
Sbjct: 226 ITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYL 285

Query: 227 PFDEE-----DGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDIL 281
           P+D++       NI  L   +     + PE   I+   ++L+ +IL+ +P +R+  R IL
Sbjct: 286 PWDDDPENPSGENIAKLYFYITTTPLKFPE--YITAIPRDLLRRILIADPKKRVDLRYIL 343

Query: 282 KH-------PLL----QKYPSIKDSKSIRNLPRE 304
           KH       P L    +++ +I  S+SI  LP+ 
Sbjct: 344 KHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  188 bits (477), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 159/281 (56%), Gaps = 15/281 (5%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
            G + +G TLG G  GKV+L ++ +   + +  V  K + +D+    +  ++  +     
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDT----IPKHSEKEV---K 114

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
           I REI  +K LNH N++RL +V + +  + +VL+YA  GE +  + ++  L E  A R F
Sbjct: 115 IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 174

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L++TSCGSP YA
Sbjct: 175 AQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSPCYA 234

Query: 195 APE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDE-----EDGNIRNLLLKVQAGQFE 248
           APE +V+  PY    +DVWSCGVILYA+L G LP+D+     E  +I  L   +     +
Sbjct: 235 APELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSALK 294

Query: 249 MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            PE   I    ++L+ +ILV NP  R++  +I  H  L+ +
Sbjct: 295 FPE--YIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  189 bits (479), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 166/284 (58%), Gaps = 20/284 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W+  ET+G GS GKV+LA ++ T    A+K++   +K       +     N   D L
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQ-DVL 175

Query: 72  PY--GIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           ++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYD 295

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 296 SRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 353

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
            K++ G+ E P+   +S E  +L+SK+LVV+P  R T + +++H
Sbjct: 354 EKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  188 bits (478), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 166/293 (56%), Gaps = 28/293 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W   ET+G GS GKV+LA ++ T    AIK++   +K+     N   +    T + L
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQN--QLPPPKTEEEL 152

Query: 72  PYGIER----------------EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGEL 115
              +ER                E  + ++L H ++ RL+++   +++ YM+ EY   G+L
Sbjct: 153 ---MERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 209

Query: 116 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA 175
            + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ T   IKI DFG++
Sbjct: 210 LDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLS 269

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNI 235
            L    K L T CGS ++AAPE++   PY G   D+WS GV++Y L+ G++PFD+E+ ++
Sbjct: 270 NLYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV 329

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
             L  K++ G+ E P+   +S E  +L+SK+LVV+P +R + + +  H  +Q+
Sbjct: 330 --LHEKIKKGKVEYPQ--HLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  186 bits (473), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 161/288 (55%), Gaps = 27/288 (9%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN-----QAAIKVISK-TIFQDSNVTSMVDNTTP 68
            G + +G TLG G  GKV+L + K + +     Q AIK+I + TI +D++          
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKE-------- 94

Query: 69  DALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN 128
                 I REI  +K L H N++ L +V + +  + +VLE+   GE +  +  +  L E+
Sbjct: 95  ----IKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKES 150

Query: 129 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED-KLLETS 187
            A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG      ED +L++TS
Sbjct: 151 SACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTS 210

Query: 188 CGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLK 241
           CGSP YAAPE +VS   Y    +DVWSCGVILYA+L G LP+D++  N     I  L   
Sbjct: 211 CGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKY 270

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           +     + PE   I+   ++L+ +ILV NP  RI  + I +H  L+ +
Sbjct: 271 ITQTPLKFPE--YITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  188 bits (478), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 166/288 (57%), Gaps = 22/288 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK----------TIFQDSNVTSMVD 64
           +G W   ET+G GS GKV+LA +  T    AIK++++          ++    N   M++
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEMLE 157

Query: 65  NTTPDALPYGIER------EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNL 118
                 L   I R      E  + ++L H ++ RL+++   +++ YM+ EY   G+L + 
Sbjct: 158 RQ--KKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 215

Query: 119 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALE 178
           +++ G L E+ A +F R +   + Y HA  IVHRDLK EN+++ T   IKI DFG++ + 
Sbjct: 216 IIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVF 275

Query: 179 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNL 238
              K L T CGS ++AAPE++   PY G   D+WS GV+LY L+ G++PFD+E+ ++  L
Sbjct: 276 DTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--L 333

Query: 239 LLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             K++ G+ E P  + +S E  +L+SK+LVV+P +R     +++HP +
Sbjct: 334 HEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  183 bits (465), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 159/291 (54%), Gaps = 33/291 (11%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNK--TTGN---------QAAIKVISK-TIFQDSNVTSM 62
            G + +G TLG G  GKV++ + +  T GN         Q AIK+I + TI ++S+  + 
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVRNSDKETK 106

Query: 63  VDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
                       I REI  +K L H N++ L ++ + +  + +VLEYA  GE +  +  +
Sbjct: 107 ------------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRK 154

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETED 181
             L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E+
Sbjct: 155 RRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNEN 214

Query: 182 KLLETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGN-----I 235
            L++TSCGSP YAAPE +VS   Y G   D+WSCGVILYA+L G LP+D++  N     I
Sbjct: 215 VLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDI 274

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             L   + A   + P  D ++   ++L+ +ILV +P  R T   I  H  L
Sbjct: 275 SKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  186 bits (471), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 141/477 (29%), Positives = 222/477 (46%), Gaps = 73/477 (15%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA +K T  +  +K   K    D NV              
Sbjct: 33  EVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDKN---DPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  ++  + RLY+V  T + ++M LEY    EL+  L+    +  +E  R 
Sbjct: 77  ---REVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  I Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  Y
Sbjct: 134 FAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEED-----GNIRNLLLKVQAGQFE 248
            APE+     Y GF  D+W+ GVILY ++ G +PFDE+D       I N          E
Sbjct: 194 MAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEAKTKWKIVN----------E 243

Query: 249 MPE--DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY--PSI-KDSKSIRNLPR 303
           MPE  +D +S +A++LI ++L  +P ER +   IL HP LQ Y  P + K  K +R   R
Sbjct: 244 MPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRR 303

Query: 304 EDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363
              + H      S ++  +L+ L  +  G D   ++  +++   +A   L+ +L   +L 
Sbjct: 304 GSVHFH------SKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLLVERELA 355

Query: 364 VEQEN--------------LKNEHLKNRQSGGQSTSMAPATNQ--STAVNRSSGNKNTTP 407
           +E++                 N  +     G    S+    +   +  +NR    K+ TP
Sbjct: 356 LEKQERPRRSRSVLSVRKVFDNSLVSVESKGSNDKSLGQQLDSKITAPLNRILSKKSETP 415

Query: 408 RKKNRASVISVT--SSHKRPISFQKLPTLNSTSSLAAITPSTSARRKR--LSKISGY 460
                 S++S +   S   P+   ++ T NS       +  TS  +KR   SK+S +
Sbjct: 416 ------SLVSPSPKKSPWEPLIVDRMTTFNSNQGAEGTSTGTSTPKKRNIFSKVSKF 466

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  187 bits (475), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 169/288 (58%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W+  ET+G GS GKV+L  ++ T     IK++++     + +   + S  +      
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 71  LPYGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+ + P    +S EA +L+++++V++P +R T ++++ HP + +
Sbjct: 341 KIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 170/288 (59%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W+  ET+G GS GKV+L  ++ T     IK++++     + +  ++ S  + +    
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 71  LPYGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+ + P    +S E  +L+++++VV+P  R T +++++HP + +
Sbjct: 334 KIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 168/288 (58%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W+  ET+G GS GKV+L  ++ T     IK++++     + +  ++ S  +      
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 71  LPYGIEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y H+  IVHRDLK EN+++ +   IKI DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G   D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+ + P    +S EA +L++K++VV+P  R T + ++ HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  184 bits (468), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 153/291 (52%), Gaps = 22/291 (7%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA +K T  +  +K   K+   D N+              
Sbjct: 33  EVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS---DPNLV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T + ++M LEY    EL+  L+    +P +E  + 
Sbjct: 77  ---REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 134 FAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS GVILY ++ G +PFDE+D       +      F    D+
Sbjct: 194 MAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDN 250

Query: 254 EISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPRE 304
            +S EA++LI ++L   P+ER T   IL HP LQ Y  I  S++ + + R+
Sbjct: 251 FVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  184 bits (466), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 151/278 (54%), Gaps = 22/278 (7%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKSSDK---NDPNIV------------- 77

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  ++  + +LY+V  T + ++M LEY    EL++ ++    +P +E ++ 
Sbjct: 78  ---REVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQL 134

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+ G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y
Sbjct: 135 FAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVY 194

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS GVILY ++ G +PFDE+D       +  Q  Q     ++
Sbjct: 195 MAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NEN 251

Query: 254 EISKEAQNLISKILVVNPAERITARDILKHPLLQKYPS 291
            ++ +A++LI ++L  NP +R T   ILKHP LQ + S
Sbjct: 252 IVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 164/283 (57%), Gaps = 18/283 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +G W   ET+G GS GKV++A +  T    AIK+I++     + ++  +    +      
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALE 196

Query: 71  LPYGIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               +E+EI           + + L H ++ RL+++   +++ YM+ EY   G+L + ++
Sbjct: 197 RQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 256

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ T   IKI DFG++ +   
Sbjct: 257 QHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDP 316

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 317 RTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 374

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           K++ G+ + P+   +S E  +L+SK+LVV+P +R + + +++H
Sbjct: 375 KIKQGKVDYPQ--HLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  182 bits (462), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 150/277 (54%), Gaps = 22/277 (7%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           IG++K+ + +G GS GKV LA ++ T  +  +K  +K    D NV               
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKN---DPNVV-------------- 76

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
             RE+   +  +  ++ +LY+V  T S ++M LEY    EL+  L+ +  +   E+ + F
Sbjct: 77  --REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLF 134

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            QI+  + Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  Y 
Sbjct: 135 AQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYM 194

Query: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           APE++    Y GF  D+WS GVILY ++ G +PFDEED       +  +   +    DD 
Sbjct: 195 APELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDV 251

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPS 291
           +SK+A++LIS++L  +P++R     +L HP LQ Y S
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  183 bits (465), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 165/289 (57%), Gaps = 20/289 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVI---SKTIFQDSNVTSMVDNTTPDAL 71
           +G W+  ET+G GS GKV+L  +  T     IK++   SK      +      N   + L
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNEN-ELL 162

Query: 72  PYG--IEREIV----------IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                +E+EI           + ++L H ++ RL+++   +++ YM+ EY   G+L + +
Sbjct: 163 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 222

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
           ++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 223 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFD 282

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
             K L T CGS ++AAPE++   PY G   D+WS G++LY L+ G++PFD+E+ +I  L 
Sbjct: 283 SKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 340

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
            K++ G+ + P    +S +A +L+++++VV+P +R T +++  HP + +
Sbjct: 341 EKIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  182 bits (463), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 158/295 (53%), Gaps = 38/295 (12%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGN-------QAAIKVISKTIFQDSNVTSMVDNTT 67
            G + +  TLG G  GKV+L ++K +         Q AIK+I ++               
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRS--------------- 125

Query: 68  PDALPYG------IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
              LP G      + REI  +K L H N+++L DV + +  + +VLEYA  GE +  +  
Sbjct: 126 -SILPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQR 184

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETE 180
           +  L E  A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        
Sbjct: 185 KKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQT 244

Query: 181 DKLLETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEE----DGN- 234
           ++L+ T CGSP YAAPE+V S  PY    +D+WSCG+ILYA+L G LP+D++    DGN 
Sbjct: 245 NELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGND 304

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           I  L   +     + PE   I    ++L+ KILV N  +RI  R I+ H  L+ +
Sbjct: 305 IARLYYYITTTPLKFPE--YIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  182 bits (461), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 160/288 (55%), Gaps = 18/288 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT----IFQDSNVTSMVDNTTPDA 70
           +  W   ET+G GS GKV+LA NK +    AIK++ +     + +   +    D      
Sbjct: 64  LSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKE 123

Query: 71  LPYGIEREI----------VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
               + +EI           + ++L H NV +LY++   +++ YM  E+   G+L + ++
Sbjct: 124 RQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYII 183

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L EN A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +   
Sbjct: 184 QHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDP 243

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L+T CGS ++AAPE++   PY G   DVWS GV+LY L+ G++PFD+E  N   L  
Sbjct: 244 RKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHE 301

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K++ G+   P+   +S +  +L+SKILVV+P +R T + ++ H  + K
Sbjct: 302 KIKKGKVTYPQ--FLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  180 bits (456), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 188/355 (52%), Gaps = 35/355 (9%)

Query: 6   TTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDN 65
           T+P +K  ++G++K+ + +G GS GKV LA ++ T  +  +K  +K+   D N+      
Sbjct: 28  TSPDLK--EVGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS---DPNIV----- 77

Query: 66  TTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPL 125
                      RE+   +  ++  + +LY+V  T S ++M  EY    +L++ ++    +
Sbjct: 78  -----------REVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRV 126

Query: 126 PENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE 185
           P +  I  F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LE
Sbjct: 127 PSSACIELFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLE 186

Query: 186 TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAG 245
           T CG+  Y APE++    Y GF  D+WS GVILY +L G +PFDE+D       +     
Sbjct: 187 TICGTTVYMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDETKTEWKI----- 241

Query: 246 QFEMP--EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPR 303
             EMP   D  +S++A++L+ K+L  +P ER + ++IL HP LQ Y S+   K+ R L +
Sbjct: 242 MNEMPVFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRK 301

Query: 304 E-DTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAML 357
           + +  +H     +S ++  +L+NL     G D   ++V +++  ++     + +L
Sbjct: 302 QRNGTIH----FHSKLERKLLKNLKRT--GFDTQAMKVSVQKRKSDLLSATWTLL 350

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 156/283 (55%), Gaps = 18/283 (6%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT--IFQDSNVTSMVDNTTPD--- 69
           +G W    T+G GS GKV+LA ++      A+K++++    F     ++    +  D   
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIKE 174

Query: 70  ---------ALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120
                    A      RE  + ++L+H N+ +LY +   +++ YM+ EY   G+L + ++
Sbjct: 175 RERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYII 234

Query: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180
           + G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ L   
Sbjct: 235 QHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFDP 294

Query: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L T CGS ++AAPE++   PY G   D+WS GVILY L+ G++PFD+E+ N   L  
Sbjct: 295 RAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LHE 352

Query: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           K++ G+   P    +S E  +L++K+L VNP  R T ++I+ H
Sbjct: 353 KIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 151/281 (53%), Gaps = 26/281 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++++   +G GS GKV LA++  T  +  +K  +K+   D NV              
Sbjct: 33  EVGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS---DPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +      + +LY++  T + ++M LEY    EL+  L+    +P +E  R 
Sbjct: 77  ---REVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y
Sbjct: 134 FAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  DVWS GVILY LL G +PFDEE    +N   K+     EMP  D
Sbjct: 194 MAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFD 248

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
              +  +A +L+SK+L  +P +R + +++L+HP LQ Y ++
Sbjct: 249 STLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  176 bits (447), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 150/278 (53%), Gaps = 28/278 (10%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +G++K+ E +G GS GKV LA ++ T  +  IK    ++  D N+               
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK---SSVKNDPNIV-------------- 85

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
             RE+   +   +  + +LY++  T S ++M LEY    EL++ +++   +P  E I+ F
Sbjct: 86  --REVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLF 143

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  Y 
Sbjct: 144 SQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYM 203

Query: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEED-GNIRNLLLKVQAGQFEMPEDD 253
           APE+    PY GF  D+WS GVILY +L+G +PFDE+D    +  ++       E PE +
Sbjct: 204 APELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIIN------EEPEYN 257

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
              ++ E ++L+ K+L  +   R + R+IL+H  LQ Y
Sbjct: 258 SKFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  175 bits (443), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 150/281 (53%), Gaps = 26/281 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA +K T  +  +K   K   +D NV              
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEK---KDPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T S ++M LEY    EL++ L+++  +P +E  + 
Sbjct: 77  ---REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  Y
Sbjct: 134 FAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE-- 251
            APE++    Y G+  D WS G+ILY +L G +PFDEED  +  L +       EMP   
Sbjct: 194 MAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGLKI-----MNEMPPIV 248

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           D   +  A++LI K+L   P+ER +   +L+HP LQ Y +I
Sbjct: 249 DAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  174 bits (442), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 148/277 (53%), Gaps = 24/277 (8%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA +  T  +  +K+ SK    D NV              
Sbjct: 33  EVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK---NDPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +++++ +LY+V  T + ++M LEY    EL+  L+ +  +P  E    
Sbjct: 77  ---REVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSEL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  Y
Sbjct: 134 FSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPED- 252
            APE++   PY G+  D WS G+ILY ++ G +PFDE D     +  K +   +    D 
Sbjct: 194 MAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD----EVKTKYKIVHYNPTYDN 249

Query: 253 DEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           D I    + LIS++L  +P +R +   +L+HP LQ Y
Sbjct: 250 DYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  175 bits (443), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 159/291 (54%), Gaps = 35/291 (12%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQA---AIKVISKTIFQDSNVTSMVDNTTPDAL 71
            G + +G TLG G  GKV+L ++K+  +++   AIK+I +                 D +
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR-----------------DTI 95

Query: 72  PYGIEREIVI------MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPL 125
           P   E+E+ I      +K L H N++ L +V + +  + +VL YA  GE +  + ++  L
Sbjct: 96  PKNSEKEVKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRL 155

Query: 126 PENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMA-ALETEDKLL 184
            E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      + + L+
Sbjct: 156 KEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLM 215

Query: 185 ETSCGSPHYAAPE-IVSGIPYHGFASDVWSCGVILYALLTGRL-----PFDEEDGNIRNL 238
           +TSCGSP YAAPE +V+   Y    +DVWSCGVILYA+L G L     P + +  +I  L
Sbjct: 216 KTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKL 275

Query: 239 LLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
              +     + PE   I+   ++++ +ILV +P++RIT   ILKH  LQ +
Sbjct: 276 YNYITKTSLKFPE--YINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  174 bits (440), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 152/285 (53%), Gaps = 24/285 (8%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           +IG++K+ + +G GS GKV LA ++ T  +  +K  +K   +D NV              
Sbjct: 33  EIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK---RDPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T S ++MVLEY    EL+  L++   L   E+ + 
Sbjct: 77  ---REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y
Sbjct: 134 FSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS G+ILY ++ G +PFDE+D    ++  K++    E+  + 
Sbjct: 194 MAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD----DIKTKLKIVNDELDFNQ 249

Query: 254 E-ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKS 297
           E IS +A +LI  +L  NP ERI+   +L HP LQ +  +   K+
Sbjct: 250 EWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKT 294

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  174 bits (440), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 150/278 (53%), Gaps = 26/278 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K  SKT   D NV              
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT---DPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +H  + +LY++  T + ++M LEY    EL++ L+    +P +E  R 
Sbjct: 77  ---REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  Y
Sbjct: 134 FAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS GVILY L+ G +PFDEED   R     +     E P+ +
Sbjct: 194 MAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDYN 248

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           E   +  +  LI  +L+ +P +R +  +ILKH  L+ Y
Sbjct: 249 EKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 150/284 (52%), Gaps = 32/284 (11%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++++ + +G GS GKV LA +K T  +  +K  +K+   D NV              
Sbjct: 33  EVGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS---DPNVV------------- 76

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +   +  + +LY+V  T + ++M LEY    EL++ L+ +  +P +E  R 
Sbjct: 77  ---REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRL 133

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y
Sbjct: 134 FAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVY 193

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPE-- 251
            APE++    Y G+  D WS G+ILY +L G +PFDE+D         V+ G   M E  
Sbjct: 194 MAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD--------TVRTGLKIMHEEP 245

Query: 252 ---DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
              D+  S +A++LI ++L  N A+R    ++L+HP LQ Y ++
Sbjct: 246 AVLDEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 149/272 (54%), Gaps = 22/272 (8%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +G++++ + +G GS GKV LA ++ T  +  +K+ SK    D NV               
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSKN---DPNVV-------------- 76

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
             RE+   +  ++  + +LY+V  T ++++M LEY    EL+  L+ +  +P +E    F
Sbjct: 77  --REVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLF 134

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            QI+  + Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  Y 
Sbjct: 135 SQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYM 194

Query: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           APE++   PY G+  D WS G+ILY ++ G +PFDEED +I+     V    F   +D+ 
Sbjct: 195 APELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNF 251

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLL 286
           I    ++LI ++L  +P++R +   +L+HP +
Sbjct: 252 IDANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 147/282 (52%), Gaps = 28/282 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK---NDPNIV------------- 80

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T S ++M LEY    EL++ L+    +   E    
Sbjct: 81  ---REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGEL 137

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFE---MP 250
            APE++    Y GF  D WS GVILY L+TG LPFD++D       +  +  +++   +P
Sbjct: 198 MAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIP 257

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           +D      A++LIS++L  NP ER +   +L+HP LQ Y S+
Sbjct: 258 DD------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  172 bits (436), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 148/282 (52%), Gaps = 28/282 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK---NDPNIV------------- 80

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T S ++M LEY    EL++ L+    +   E    
Sbjct: 81  ---REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGEL 137

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFE---MP 250
            APE++    Y GF  D+WS GVILY L+TG LPFD++D       +  +  +++   +P
Sbjct: 198 MAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIP 257

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
           +D      A++LIS++L  NP ER +   +L+HP LQ Y S+
Sbjct: 258 DD------ARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  165 bits (417), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 154/270 (57%), Gaps = 22/270 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG GS G V+ A   +TG+  A+K++ K   + ++V   +           +  E+
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQM-----------LYDEL 96

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
           +I++ LNH N+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   QI+ 
Sbjct: 97  MILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILK 156

Query: 140 GISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMAA-LETEDKLLETSCGSPHYAA 195
            + Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +  L+  + GS  Y A
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVA 216

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FEMPE 251
           PE+++    HG   D+WS GVI Y LL G  PF  E  ++   L +  +GQ    F  P 
Sbjct: 217 PEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPY 273

Query: 252 DDEISKEAQNLISKILVVNPAERITARDIL 281
            + ISKEA+  I ++L ++P +R TA D+L
Sbjct: 274 WNNISKEAKLFILRVLTISPKKRPTATDLL 303

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  172 bits (435), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 148/281 (52%), Gaps = 26/281 (9%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK---NDPNIV------------- 80

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T S ++M LEY    EL++ L+    L   E    
Sbjct: 81  ---REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGEL 137

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS GVILY L+TG LPFD++D  ++     V     E P+ D
Sbjct: 198 MAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKYD 252

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
              I  +A++LIS++L  NP ER +   +L+HP LQ Y S+
Sbjct: 253 SKFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  171 bits (434), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 151/279 (54%), Gaps = 26/279 (9%)

Query: 13  DQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALP 72
           +++G++K+ + +G GS GKV LA +K T  +  +K   KT   D NV             
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLKSSDKT---DPNVV------------ 78

Query: 73  YGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
               REI   +  +   + +LY+V  T + ++MV+EY    EL++ L+ +  +  +E+ R
Sbjct: 79  ----REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESAR 134

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPH 192
            F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG     +++  LET CG+  
Sbjct: 135 IFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTV 194

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFE--MP 250
           Y APE++    Y G+  D+W+ G++LY ++ G +PFDE+D     L +   +  ++    
Sbjct: 195 YMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYF 254

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            DD I     +L++++L  +P+ R T   IL HP L  Y
Sbjct: 255 NDDSI-----DLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 152/273 (55%), Gaps = 18/273 (6%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG G+ G V+ A   TTG   A+K++ K   + +NV   +           +  E+
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQM-----------LYDEL 102

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H N++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+I 
Sbjct: 103 AILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLIS 162

Query: 140 GISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMAA-LETEDKLLETSCGSPHYAA 195
            +SY H+  IVHRDLKPEN+L LD   N  + IADFG+A  L++ D L+    GS  Y A
Sbjct: 163 AVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYVA 222

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPEDD 253
           PE+++    HG   D+WS GVI Y LL+G   F  E  +G +          +F  P  D
Sbjct: 223 PEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWD 281

Query: 254 EISKEAQNLISKILVVNPAERITARDILKHPLL 286
            IS+EA++ I + L ++P +R TA ++L+ P +
Sbjct: 282 NISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 140/229 (61%), Gaps = 7/229 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I+G + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE+++G    H +  D+WSCGV++YALL G+ PF  ++ NI  +  +++ G F  P+D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLP 302
           IS EA  LI  IL ++P ER +  +I+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 26/293 (8%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++K+ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 37  EVGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK---NDPNIV------------- 80

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  +   + +LY+V  T + ++M LEY    EL++ L+    +   E    
Sbjct: 81  ---REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAEL 137

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+WS GVILY L+TG LPFD++D  ++     V     E P  D
Sbjct: 198 MAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNYD 252

Query: 254 E--ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPRE 304
              I  +A++LIS++L  NP ER +   +L H  LQ Y S+   ++ + L R+
Sbjct: 253 STLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 154/299 (51%), Gaps = 26/299 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG GS G V+ A   +TG   A+K++ K   Q + V   +           +  E+
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQM-----------LYDEL 88

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H +++   D +E+    Y+V + A  GELF+ ++ RG   EN+A++   Q++ 
Sbjct: 89  SILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLD 148

Query: 140 GISYCHALGIVHRDLKPENLLL---DTKYNIKIADFGMA-ALETEDKLLETSCGSPHYAA 195
            + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+  D ++  + GS  Y A
Sbjct: 149 AVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVA 208

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPEDD 253
           PE+++ +  HG A D+WS GVI Y LL+G   F  E  +G +           F  P  D
Sbjct: 209 PEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWD 267

Query: 254 EISKEAQNLISKILVVNPAERITARDILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           +IS EA+  I   L + P ER TA  +L HP +           PS+++    R   RE
Sbjct: 268 KISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFRE 326

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  162 bits (410), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 157/277 (56%), Gaps = 22/277 (7%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           ++ G+TLG GS G V+ A  K+   + AIK++ K   + + V   +           +  
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQM-----------LYD 75

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I+K L+H N++   + +ET+  +Y+V + A  GELF+ ++++G   E++A++   QI
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQI 135

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTK---YNIKIADFGMAA-LETEDKLLETSCGSPHY 193
           +  + Y H+  IVHRDLKPENLL  T+     + IADFG+A  L+  ++L+  + GS  Y
Sbjct: 136 LSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGY 195

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAG----QFEM 249
            APE+++ +  HG   D+WS GVI Y LL+G   F  E   +   L +  +G    +F  
Sbjct: 196 VAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFHK 252

Query: 250 PEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           P  D IS +A+N I K L +NP +R TA ++L  P +
Sbjct: 253 PYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 139/229 (60%), Gaps = 7/229 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I+G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE+++G    H +  D+WSCGV++YALL G+ PF  ++ NI  +  +++ G +  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLP 302
           IS+EA  LI  IL ++P ER +  +I+ +   +  +P   D+  + + P
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  163 bits (412), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 156/271 (57%), Gaps = 18/271 (6%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           ++ G+TLG GS G V+ A   ++  + A+K++ K   +++ +   +           + +
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRM-----------LYQ 79

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I+K L+H N++   + +ET+  LY+V + A  GELF+ ++  G   E++A++   QI
Sbjct: 80  ELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQI 139

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTK---YNIKIADFGMAA-LETEDKLLETSCGSPHY 193
           +  + Y H+  IVHRDLKPENLL  TK     + IADFG+A  L++ ++L+  + GS  Y
Sbjct: 140 LSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGY 199

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPE 251
            APE+++ +  HG   D+WS GVI Y LL G   F  E  +G +   +   Q  QF+ P 
Sbjct: 200 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPY 258

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
            D IS+ A+N I K L + P +R TA ++LK
Sbjct: 259 WDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  160 bits (406), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 135/249 (54%), Gaps = 17/249 (6%)

Query: 40  TGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWET 99
           TG   AIK++ K+     NVT    N            EI I   LNH N+ +LY  +  
Sbjct: 148 TGFICAIKIMDKSEILTYNVTKQFRN------------EIEIQSNLNHENLTKLYGFFHD 195

Query: 100 NSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENL 159
           +  +Y+++EY   GEL+++L + GP  +  A  F  Q+   I Y H   I+HRDLKPEN+
Sbjct: 196 SKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKRIIHRDLKPENI 255

Query: 160 LLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILY 219
           L+D    IKI DFG +         +T CG+  Y +PE+++   Y G   DVW+ G+I Y
Sbjct: 256 LIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGLI-DVWALGIIAY 314

Query: 220 ALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARD 279
            L+ G  PF+E+   +     +++      P    +S++A+NLIS +L +NP+ERIT  D
Sbjct: 315 ELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLKLNPSERITLTD 370

Query: 280 ILKHPLLQK 288
           +LKHP + K
Sbjct: 371 VLKHPWINK 379

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  162 bits (409), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 150/271 (55%), Gaps = 22/271 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG GS G V+ A   ++G   AIK++ K   +  +V   +           +  E+
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQM-----------LYDEL 96

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H N+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI+ 
Sbjct: 97  SILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILK 156

Query: 140 GISYCHALGIVHRDLKPENLLLDTKY---NIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
            + Y H+  IVHRDLKPENLL  T+     + + DFG+A  L+ +D+L+  + GS  Y A
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVA 216

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FEMPE 251
           PE+V+    HG   D+WS GV+ Y LL G  PF  E  ++   L +   G+    F  P 
Sbjct: 217 PEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTIGRTPVTFHKPY 273

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
              IS EA++ I + L VNP +R TA ++L+
Sbjct: 274 WSNISNEAKDFILRALTVNPHDRPTATELLQ 304

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  162 bits (410), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 153/279 (54%), Gaps = 22/279 (7%)

Query: 16  GSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGI 75
             ++ G+T+G G+ G V+ A   +TG + A+K+I K   + +++   +           +
Sbjct: 39  ADYEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGNDIQLQM-----------L 87

Query: 76  EREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
             E+ I++ L H N++     +E+   +Y+V + A  GELF+ +++RG   E +A+    
Sbjct: 88  YDELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVV 147

Query: 136 QIIIGISYCHALGIVHRDLKPENLLL---DTKYNIKIADFGMAA-LETEDKLLETSCGSP 191
           QI+  + Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE E  L+  + GS 
Sbjct: 148 QILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSL 207

Query: 192 HYAAPEIV--SGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQF 247
            Y APE++  SG   HG   D+WS G+I Y LL G  PF  E  DG +  ++   +   F
Sbjct: 208 GYVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAF 264

Query: 248 EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             P  DEIS EA+  I + + ++P +R TA ++LK P +
Sbjct: 265 HSPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  167 bits (422), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 131/207 (63%), Gaps = 6/207 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N++   D +E ++N+Y++LE    G L +L+ +R  L E E +RFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I G + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 196 PEIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV++YALL G+ PF  +D N+  +  +++A Q+  P+D  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 255 ISKEAQNLISKILVVNPAERITARDIL 281
           +S EA+ LI+ IL V+P ER + R+I+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  162 bits (409), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 160/304 (52%), Gaps = 30/304 (9%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G TLG GS G V+ A   +T    AIK++ K   Q +N+   +           + 
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQM-----------LY 94

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I++ L+H N++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQ 154

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMA-ALETEDKLLETSCGSPH 192
           I+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS  
Sbjct: 155 ILGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLG 214

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FE 248
           Y APE+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  A +    F 
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTFH 271

Query: 249 MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK--------YPSIKDSKSIRN 300
           MP  D IS +A+  I K L++NPA+R TA ++L  P +           P +K   S+R 
Sbjct: 272 MPYWDNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRK 331

Query: 301 LPRE 304
             R+
Sbjct: 332 KLRD 335

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  159 bits (403), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 144/277 (51%), Gaps = 27/277 (9%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
           +G  LG G  GKV    +K +G   A+KV+ KT                D L Y +ER+ 
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT----------------DILQYKLERQF 158

Query: 80  V----IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           +    I   LNH N+ +LY  +     +Y+++EY   GEL+  L   GP     A  +  
Sbjct: 159 IREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVY 218

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAA 195
           QI   I Y H   I+HRD+KPEN+L+     +K+ DFG + +  +     T CG+  Y +
Sbjct: 219 QIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLS 278

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQAGQFEMPEDDE 254
           PEIV    Y     D+W+ G++ Y LL G  PF+E   N ++L   +++ G    P+  +
Sbjct: 279 PEIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFPK--Q 332

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPS 291
           ++ EA++ I +ILV+ P +R+T ++I+ HP + KY S
Sbjct: 333 VTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  167 bits (423), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 151/276 (54%), Gaps = 28/276 (10%)

Query: 24  LGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMK 83
           +G G+   V+ A  ++TG   A+K+I K       V    D         G++RE+ +++
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHK-----RKVMDKFD---------GVKRELDVLQ 243

Query: 84  LLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISY 143
            LNH  +++L D +E N N YM++E+   G+L + +   G + E+      RQ++  + Y
Sbjct: 244 KLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKY 303

Query: 144 CHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 201
            H  GI HRDLKP+N+++  D    IKI DFG+A ++ ++  L T CG+  Y APE++ G
Sbjct: 304 MHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDG 363

Query: 202 I--------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQF-EMP-E 251
                      +    D+WS G ++Y +LTG LPF  +  N   L  +++ G + E P +
Sbjct: 364 KNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLK 421

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           D  IS+EA+N I  +L V+P ER+ A   L+HP ++
Sbjct: 422 DYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  161 bits (407), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 156/278 (56%), Gaps = 22/278 (7%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G+TLG G+ G V+ A N  TG   A+K++ K   + + +               + 
Sbjct: 36  NYVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLE-----------ALY 84

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I++ L+H N++   D +E+N   Y++ + A+ GELF+ ++++G   E +A+R   +
Sbjct: 85  DELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVE 144

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGSPH 192
           I+  + Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++++L+  + GS  
Sbjct: 145 ILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLG 204

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FE 248
           Y APE+++    HG   D+WS GVI Y LL G   F  E   + + L +   G+    F 
Sbjct: 205 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFH 261

Query: 249 MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
            P  D +S +A+  I K L +NPA+R TA ++L+ P +
Sbjct: 262 RPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  161 bits (407), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/332 (31%), Positives = 167/332 (50%), Gaps = 38/332 (11%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G+TLG G+ G V+ A    T    A+K++ K   + ++V   +           + 
Sbjct: 44  NYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQM-----------LY 92

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I+++L H N++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    Q
Sbjct: 93  DELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQ 152

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMA-ALETEDKLLETSCGSPH 192
           I+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+  D L+  + GS  
Sbjct: 153 ILSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLG 212

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMP 250
           Y APE+++    HG   D+WS GVI+Y LL G   F  E  DG +           F  P
Sbjct: 213 YVAPEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKP 271

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK--------YPSIKDSKSIRNLP 302
             D IS EA+N I + L ++PAER TA +++K P +          YP I+    +R   
Sbjct: 272 YWDNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKL 331

Query: 303 REDTYLHPL------------AETNSAIDENI 322
           R+   +  L             ET++ I+EN+
Sbjct: 332 RDAIEIVKLNNRIKKLRSLYMVETDTDIEENV 363

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 164/311 (52%), Gaps = 40/311 (12%)

Query: 2   ITNKTTPTIKGDQIGSWK----MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDS 57
           +T+ TT  I   + G +K    + E +G G+   V+ A  +TTG   A+K+ISK      
Sbjct: 178 LTSSTTSAIMARKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----R 232

Query: 58  NVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFN 117
            V   +D         G+ RE+ +++ LNH  ++RL   +E   + YMV+E+   G+L +
Sbjct: 233 KVIGNMD---------GVTRELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMD 283

Query: 118 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMA 175
            +   G + E+      RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIP-------------YHGFASDVWSCGVILYALL 222
            ++     ++T CG+  Y APE++ G               Y     D+WS G ++Y +L
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLV-DMWSMGCLVYVIL 402

Query: 223 TGRLPFDEEDGNIRNLLLK-VQAGQF-EMP-EDDEISKEAQNLISKILVVNPAERITARD 279
           TG LPF    G+ ++ L K +  G + E P +D  IS+EA++ I  +L V+P  R+TA  
Sbjct: 403 TGHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAK 459

Query: 280 ILKHPLLQKYP 290
            L HP ++  P
Sbjct: 460 ALDHPWIKMNP 470

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 131/207 (63%), Gaps = 6/207 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H+N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I G I Y H+  I+HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 196 PEIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV++YALL G+ PF  +D N+  +  +++  ++  P+D  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 255 ISKEAQNLISKILVVNPAERITARDIL 281
           +SKEA+ LI  IL +NP +R T  DI+
Sbjct: 319 VSKEAEILIHDILSLNPLQRPTIIDII 345

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 152/281 (54%), Gaps = 33/281 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+ISK       V   +D         G+ RE+ +
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISK-----RKVMGNID---------GVTRELEV 237

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++RL   +E + + Y+++E+   G+L + +   G + E+      +Q++  +
Sbjct: 238 LRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAV 297

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVI 357

Query: 200 SGI----------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF- 247
           SG            Y     D+WS G ++Y +LTG LPF    G+ ++ L K +  G + 
Sbjct: 358 SGKNSEDKSQNKNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYH 413

Query: 248 EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           E P +D  IS EA+N I  +L VNP +R+TA   L HP ++
Sbjct: 414 EGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 156/286 (54%), Gaps = 34/286 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  +TTG   A+K+ISK       V   +D         G+ RE+ +
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISK-----RKVIGNMD---------GVTRELEV 247

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+  +
Sbjct: 248 LQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAV 307

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 308 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVI 367

Query: 200 SGIPYHG----------FAS--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQ 246
            G               ++S  D+WS G ++Y +LTG LPF    G+ ++ L K +  G 
Sbjct: 368 RGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGS 424

Query: 247 F-EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYP 290
           + E P +D  IS+EA++ I  +L V+P+ R+TA   L HP ++  P
Sbjct: 425 YHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  165 bits (418), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 151/279 (54%), Gaps = 31/279 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+I+K       V   +D         G+ RE+ +
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINK-----RKVMGNMD---------GVTRELEV 237

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++ L   +E   + Y+V+E+   G+L + +   G + E+      RQ++  +
Sbjct: 238 LRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAV 297

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVI 357

Query: 200 SGI--------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF-EM 249
           SG          Y     D+WS G ++Y +LTG LPF    G+ +  L K + AG + E 
Sbjct: 358 SGKNSEEKEGNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEG 413

Query: 250 P-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           P +D  IS +A++ I   L VNP +R+TA   LKHP ++
Sbjct: 414 PLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  159 bits (403), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 159/304 (52%), Gaps = 30/304 (9%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G TLG GS G V+ A   +T    AIK++ K   Q +NV   +           + 
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LY 94

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I++ L+H N++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQ 154

Query: 137 IIIGISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMA-ALETEDKLLETSCGSPH 192
           I+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS  
Sbjct: 155 ILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLG 214

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FE 248
           Y APE+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  A +    F 
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTFH 271

Query: 249 MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK--------YPSIKDSKSIRN 300
           MP  D IS + +  I K L +NPA+R TA ++L  P +           P +K   S+R 
Sbjct: 272 MPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRK 331

Query: 301 LPRE 304
             R+
Sbjct: 332 KLRD 335

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  160 bits (406), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 146/292 (50%), Gaps = 40/292 (13%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A NK TG  AA+K+       D   T    + T             
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKIFHPQQNDDQKKTKQFRDETK------------ 239

Query: 81  IMKLLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           I+  + H N+++L D     V +++   Y+VLE    GELF+ +V +  L ++E    F+
Sbjct: 240 ILMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAIFK 299

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFGMAA 176
           Q++ G+ Y H+  I+HRD+KPEN+LL  +                     +KIADFG+A 
Sbjct: 300 QLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGLAK 359

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E K   T CG+P Y APE+++   Y     D+WS GV+LY  L G  PF E+    +
Sbjct: 360 FTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSPPS 418

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           ++  +L+ +   F  P  DEI   A +LIS +LVVNPA+R +  D + HP  
Sbjct: 419 MKEQILQGKYA-FYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  165 bits (417), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 164/310 (52%), Gaps = 38/310 (12%)

Query: 2   ITNKTTPTIKGDQIGSWK----MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDS 57
           +T+ T  ++  ++ G +K    + E +G G+   V+ A  +TTG   A+K+ISK      
Sbjct: 178 LTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----R 232

Query: 58  NVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFN 117
            V   +D         G+ RE+ +++ LNH  ++RL   +E   + YMV+E+   G+L +
Sbjct: 233 KVIGNMD---------GVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMD 283

Query: 118 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMA 175
            +   G + E+      RQI+  I Y H++GI HRDLKP+N+L+  D    +KI DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIPY------------HGFASDVWSCGVILYALLT 223
            ++     ++T CG+  Y APE++ G               +    D+WS G ++Y +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILT 403

Query: 224 GRLPFDEEDGNIRNLLLK-VQAGQF-EMP-EDDEISKEAQNLISKILVVNPAERITARDI 280
           G LPF    G+ ++ L K +  G + E P +D  IS+EA++ I  +L V+P  R TA   
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKA 460

Query: 281 LKHPLLQKYP 290
           L HP ++  P
Sbjct: 461 LNHPWIKMSP 470

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  166 bits (419), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 153/287 (53%), Gaps = 38/287 (13%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A+K+ISK     SN+              G+ RE+ +
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMD-------------GVSRELEV 252

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E + N YM++E+   G+L + +   G + E+      RQI+  I
Sbjct: 253 LQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAI 312

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APEI+
Sbjct: 313 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEII 372

Query: 200 SGI----------------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-V 242
           SG                  Y     D+WS G ++Y +LTG LPF    G+ +  L K +
Sbjct: 373 SGKNDGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYKQI 428

Query: 243 QAGQF-EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
             G + E P +D  IS EA++ I  +L V P +R+TA   L+HP ++
Sbjct: 429 SRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  164 bits (414), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 162/308 (52%), Gaps = 20/308 (6%)

Query: 5   KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVD 64
           KT P++   +   +  G  LG G   +    +N  +G   A K ++K   +         
Sbjct: 70  KTPPSLIKTRGRDYHRGHFLGEGGFARC-FQFNDDSGKIFAAKTVAKLSIKSEKTRR--- 125

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
                     +  EI I K + + N+++  D +E ++N+Y++LE    G L +LL +R  
Sbjct: 126 ---------KLLSEIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKS 176

Query: 125 LPENEAIRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183
           L E E +RFF   I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+ 
Sbjct: 177 LTEPE-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRE 235

Query: 184 LE-TSCGSPHYAAPEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
            + T CG+P+Y APE++ G    H +  D+WS GV+LYALL G+ PF  +D N   +  +
Sbjct: 236 RKYTVCGTPNYIAPEVLMGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYER 293

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRN 300
           ++   F  P+D  IS EA+ LI  +L ++P ER +  +I+ +   +  +P   +S  + N
Sbjct: 294 IKCCDFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTN 353

Query: 301 LPREDTYL 308
           +P  D  L
Sbjct: 354 IPNYDNQL 361

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  157 bits (396), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 153/289 (52%), Gaps = 23/289 (7%)

Query: 6   TTPTIKGD------QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV 59
           T+  IKG       ++  +++G  LG G  GKV    +K +G   A+KV++K    + NV
Sbjct: 100 TSSQIKGRFPMVDLKLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNV 159

Query: 60  TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119
                           +REI I   LNH N+ +LY  +  + N+Y+V+EY   GEL+ LL
Sbjct: 160 QKQ------------FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLL 207

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179
            + GP+ +  A  +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +    
Sbjct: 208 KKNGPMNDITASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNP 267

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
            ++  +T CG+  Y +PE++S   Y     DVW+ G++ Y L+ G  PF+E+        
Sbjct: 268 NNQKRKTLCGTIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTY 324

Query: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
            ++     + P +  +S EA++LI+ +L V P+ER   + ++ HP ++K
Sbjct: 325 KRIAKSDLKFPPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/208 (39%), Positives = 128/208 (61%), Gaps = 4/208 (1%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K ++H N+++  D +E N N+Y++LE    G L  L+ +R  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 196
             GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 197 EIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEI 255
           E++ G    H +  D+WS GV+LYALL G+ PF  +D N   +  +++   F  P+D +I
Sbjct: 248 EVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 256 SKEAQNLISKILVVNPAERITARDILKH 283
           S++A+ LI  IL +NP ER + ++I+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 153/277 (55%), Gaps = 22/277 (7%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +  G+TLG GS G V+ A   +TG   A+K++ K   + + V   +           +  
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEM-----------LYD 86

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I++ L+H N++     +E+    Y+  + A  GELF+ ++ RG   E +A+R   Q+
Sbjct: 87  ELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQL 146

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMA-ALETEDKLLETSCGSPHY 193
           + GI Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS  Y
Sbjct: 147 LQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGY 206

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAG----QFEM 249
            APE+++ +  HG   D+WS GVI Y LL G  PF  E  ++   L +  +G    +F  
Sbjct: 207 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHR 263

Query: 250 PEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           P  D IS EA+  I + L++ P++R TA ++L+ P +
Sbjct: 264 PYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 165/316 (52%), Gaps = 40/316 (12%)

Query: 2   ITNKTTPTIKGDQIGSWK----MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDS 57
           +T+ T   +   + G +K    + E +G G+   V+ A  +TTG   A+K+ISK      
Sbjct: 178 LTSSTPSVVAAHKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----R 232

Query: 58  NVTSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFN 117
            V   +D         G+ RE+ +++ L+H  ++RL   +E   + YMV+E+   G+L +
Sbjct: 233 KVIGNMD---------GVTRELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMD 283

Query: 118 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMA 175
            +   G + E+      RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 176 ALETEDKLLETSCGSPHYAAPEIVSGIP-------------YHGFASDVWSCGVILYALL 222
            ++     ++T CG+  Y APE++ G               Y     D+WS G ++Y +L
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSLV-DMWSMGCLVYVIL 402

Query: 223 TGRLPFDEEDGNIRNLLLK-VQAGQF-EMP-EDDEISKEAQNLISKILVVNPAERITARD 279
           TG LPF    G+ ++ L K +  G + E P +D  IS+EA++ I  +L V+P  R+TA  
Sbjct: 403 TGHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAK 459

Query: 280 ILKHPLLQKYPSIKDS 295
            L HP ++  P +  S
Sbjct: 460 ALCHPWIKMNPLVSQS 475

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 156/279 (55%), Gaps = 26/279 (9%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT--SMVDNTTPDALPYGI 75
           +  G+TLG G+ G V+ A N  TG   A+K++ K   + + V   ++ D           
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD----------- 85

Query: 76  EREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
             E+ I++ L+H N++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILV 143

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGSP 191
           +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++LL    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSL 203

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----F 247
            Y APE+++    HG   D+WS GVI Y LL G   F  E   +++ L +   G+    F
Sbjct: 204 GYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKF 260

Query: 248 EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             P  D +S +A+  I K L ++P++R TA ++L+ P +
Sbjct: 261 HRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 150/276 (54%), Gaps = 18/276 (6%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G TLG GS G V+ A   +T    AIK++ K   Q +NV   +           + 
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LY 94

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I++ L+H N++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQ 154

Query: 137 IIIGISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMA-ALETEDKLLETSCGSPH 192
           I+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  
Sbjct: 155 ILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLG 214

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMP 250
           Y APE+++    HG   D+WS GVI Y LL G  PF  E  +G +           F MP
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMP 273

Query: 251 EDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             D IS +A++ I K L ++PA+R TA ++L  P +
Sbjct: 274 YWDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 155/280 (55%), Gaps = 26/280 (9%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT--SMVDNTTPDALPYG 74
           ++  G+TLG G+ G V+ A N  TG   A+K++ K   + + +   ++ D          
Sbjct: 36  NYVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD---------- 85

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
              E+ I++ L+H N++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R  
Sbjct: 86  ---ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRIL 142

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGS 190
            +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS
Sbjct: 143 VEILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGS 202

Query: 191 PHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ---- 246
             Y APE+++    HG   D+WS GVI Y LL G   F  E   +++ L +   G+    
Sbjct: 203 LGYVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVR 259

Query: 247 FEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           F  P  D +S +A+  I K L ++PAER TA  +L  P +
Sbjct: 260 FHRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 147/272 (54%), Gaps = 22/272 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G TLG GS G V+ A   +TG   A+K++ K   +  +V   +           +  E+
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQM-----------LYDEL 96

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H N+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI+ 
Sbjct: 97  SILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILK 156

Query: 140 GISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 195
            + Y H+  IVHRDLKPENLL   + +   + + DFG+A  L  ED+L+  + GS  Y A
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVA 216

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FEMPE 251
           PE+++    HG   D+WS GV+ Y LL G  PF  E  ++   L +  +G+    F  P 
Sbjct: 217 PEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPY 273

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKH 283
              IS +A++ I + L V P  R +A ++L H
Sbjct: 274 WSSISDDAKDFILQALTVTPRYRPSATELLNH 305

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 152/279 (54%), Gaps = 31/279 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+ISK       V  ++D         G+ RE+ +
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISK-----RKVVGVMD---------GVARELEV 237

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++ L   +E   + Y+V+E+   G+L + +   G + E+      RQI+  +
Sbjct: 238 LQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 297

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVI 357

Query: 200 SGI--------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF-EM 249
           SG          Y     D+WS G ++Y +LTG LPF    G+ +N L K + AG + E 
Sbjct: 358 SGKNSGEKEGNTYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHEG 413

Query: 250 P-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           P +D  IS +A++ I   L V+P  R+TA   L+HP ++
Sbjct: 414 PLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/268 (33%), Positives = 146/268 (54%), Gaps = 20/268 (7%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG G+ G V+ A N       AIK++ K   + + +  + D             E+
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYD-------------EL 104

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H N+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q++ 
Sbjct: 105 SILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLT 164

Query: 140 GISYCHALGIVHRDLKPENLL-LD--TKYNIKIADFGMA-ALETEDKLLETSCGSPHYAA 195
            + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y A
Sbjct: 165 AVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVA 224

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPEDD 253
           PE+++    HG   D+WS GVI Y LL G  PF  E  +G +  +        F  P  +
Sbjct: 225 PEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWN 283

Query: 254 EISKEAQNLISKILVVNPAERITARDIL 281
            ISKEA+  I + L + PA R TA ++L
Sbjct: 284 NISKEAKQFILRALTLTPARRPTAAELL 311

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 134/223 (60%), Gaps = 8/223 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D KYN+KI DFG+AA    D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIA 260

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H +  D+WS GV++YAL+ GR PF  +D N   +  +++   F  P+D  
Sbjct: 261 PEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKY--PSIKDS 295
           IS EA+ LI  IL ++P ER +  +I+ +   +    PS K+S
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 147/270 (54%), Gaps = 22/270 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG G+ G V+ A   ++G   A+K++ K   +  +V   +           +  E+
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQM-----------LYDEL 96

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ LNH N++R  D +E+    Y+V + A  GELF+ ++E+G   E +A+   +QI+ 
Sbjct: 97  SILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQ 156

Query: 140 GISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           G+ Y H   IVHRDLKPEN+L   K +   + I DFG+A  L+ +++L+  + GS  Y A
Sbjct: 157 GVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVA 216

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FEMPE 251
           PE+++    HG   D+WS GVI Y LL G  PF  E  +    + +  +GQ    F  P 
Sbjct: 217 PEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTSGQYPVVFHKPY 273

Query: 252 DDEISKEAQNLISKILVVNPAERITARDIL 281
            + +SK A+  I   L V+P  R TA D++
Sbjct: 274 WNNVSKTAKEFILWALTVSPKRRPTATDLI 303

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  156 bits (395), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 162/287 (56%), Gaps = 26/287 (9%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +  G+TLG G+ G V+ A   +T    A+K++ K   + ++V   +           +  
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQL-----------LYD 88

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I++ L+H N+++  D +E+    Y+V + A  GELF+ ++ +G   E +A++   QI
Sbjct: 89  ELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQI 148

Query: 138 IIGISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMAA-LETEDKLLETSCGSPHY 193
           +  + Y H+  IVHRDLKPEN+L +D   +  + +ADFG+A  L++ D+L+  + GS  Y
Sbjct: 149 LSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGY 208

Query: 194 AAPEIV--SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAG----QF 247
            APE++  SG   HG   D+WS GV+ Y LL+G  PF  E  ++   L +   G    +F
Sbjct: 209 VAPEVLTTSG---HGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 248 EMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKD 294
             P  D IS +A+N I + LV++P++R TA ++L+ P +    S K+
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 152/284 (53%), Gaps = 35/284 (12%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A    TG   A+K+I+K       V   +D         G+ RE+ +
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINK-----RKVMGNLD---------GVTRELTV 251

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H +++ L   +E   N YMV+E+   G+L + +   GP+ E+      RQI+  +
Sbjct: 252 LQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAV 311

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     + T CG+  Y APE+V
Sbjct: 312 KYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVV 371

Query: 200 SG--------IP-----YHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKV--QA 244
           +G        +P     ++    D+WS G ++Y +LTG LPF    G+    L +   +A
Sbjct: 372 NGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF---SGSTPQQLYEQIGKA 428

Query: 245 GQFEMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
              E+P +D  IS +A++ I  +L V+P  R++A   L+HP +Q
Sbjct: 429 SYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  156 bits (395), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 159/304 (52%), Gaps = 30/304 (9%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIE 76
           ++  G TLG GS G V+ A   +T    AIK++ K   Q +NV   +           + 
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LY 94

Query: 77  REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 136
            E+ I++ L+H N++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQ 154

Query: 137 IIIGISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMA-ALETEDKLLETSCGSPH 192
           I+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  
Sbjct: 155 ILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLG 214

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ----FE 248
           Y APE+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  A +    F 
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTFH 271

Query: 249 MPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK--------YPSIKDSKSIRN 300
           +P  D IS +A+  I K L +NP ER TA ++L  P +           P +K   S+R 
Sbjct: 272 IPYWDNISIDAKRFILKALRLNPTERPTATELLDDPWITSKRIGTSNILPDVKKGFSLRK 331

Query: 301 LPRE 304
             R+
Sbjct: 332 KLRD 335

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I+G I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE+++G    H F  D+WS GV++YALL G+ PF  ++ N   +  +++   F  P+D  
Sbjct: 239 PEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKP 296

Query: 255 ISKEAQNLISKILVVNPAERITARDILKH 283
           IS EA+ LI  IL ++P ER +  +I+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 130/209 (62%), Gaps = 6/209 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I+G I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE+++G    H F  DVWS GV++YALL G+ PF  ++ N   +  +++   F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 255 ISKEAQNLISKILVVNPAERITARDILKH 283
           IS EA+ LI  IL ++P ER +  +I+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  160 bits (406), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 125/209 (59%), Gaps = 6/209 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K ++H N+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D+ YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV+LYALL G+ PF   D N   +  +++   F  P+D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 255 ISKEAQNLISKILVVNPAERITARDILKH 283
           IS E + LI  IL ++P ER +  +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  160 bits (406), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 138/235 (58%), Gaps = 7/235 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H NV++  D +E ++N+Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H +  D+WS GV+LYALL G+ PF  +D N   +  +++   F  P++  
Sbjct: 248 PEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKH 305

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLPREDTYL 308
           IS EA+ LI  +L ++P ER +  +I+ +   +  +P   +S  +  +P  D  L
Sbjct: 306 ISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  161 bits (408), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 154/281 (54%), Gaps = 32/281 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  +TTG   A+K+I+K       V   +D         G+ RE+ +
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINK-----RKVMGNLD---------GVTRELEV 236

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           +K LNH  ++ L   +E N + YMV+E+   G+L + +   G + E+      RQI+  +
Sbjct: 237 LKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAV 296

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 297 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 356

Query: 200 SGIPYHG--------FAS--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF- 247
                +         ++S  D+WS G ++Y +LTG LPF    G+ +  L K +  G + 
Sbjct: 357 GSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYH 413

Query: 248 EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           E P +D  IS EA++ I  +L V+P+ R+TA   L+HP ++
Sbjct: 414 EGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 137/241 (56%), Gaps = 13/241 (5%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF   
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D+ YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV+LYALL G+ PF   D N   +  +++   F  P+D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKY--PSI-----KDSKSIRNLPREDTY 307
           IS E + LI  IL ++P ER +  +I+ +   +    PSI      ++ +  N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSL 365

Query: 308 L 308
           +
Sbjct: 366 I 366

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K ++H N+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D+ YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV+LYALL G+ PF   D N   +  +++   F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKP 305

Query: 255 ISKEAQNLISKILVVNPAERITARDILKH 283
           IS E + LI  IL ++P ER +  +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  160 bits (404), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E +SN+Y++LE    G L  LL  R  L E E +RFF   
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D+ YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 196 PEIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H F  D+WS GV+LYALL G+ PF   D N   +  +++   F  P+D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 255 ISKEAQNLISKILVVNPAERITARDILKH 283
           IS E + LI  IL ++P ER +  +I+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 156/280 (55%), Gaps = 26/280 (9%)

Query: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVT--SMVDNTTPDALPYG 74
           ++  G+TLG G+ G V+ A N  TG   A+K++ K   + + +   ++ D          
Sbjct: 36  NYVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD---------- 85

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
              E+ I++ L+H N++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R  
Sbjct: 86  ---ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRIL 142

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-LETEDKLLETSCGS 190
            +I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS
Sbjct: 143 VEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGS 202

Query: 191 PHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQ---- 246
             Y APE+++    HG   D+WS GVI Y LL G   F  E   +++ L +   G+    
Sbjct: 203 LGYVAPEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVR 259

Query: 247 FEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           F  P  D +S +A+  I K L ++P++R TA  +L+ P +
Sbjct: 260 FHRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/273 (33%), Positives = 149/273 (54%), Gaps = 18/273 (6%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG G+ G V+ A   ++    A+K++ K   + ++V   +           +  E+
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGNDVQLQM-----------LYDEL 88

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
            I++ L+H N++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q++ 
Sbjct: 89  SILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLD 148

Query: 140 GISYCHALGIVHRDLKPENLL-LD--TKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
            + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS  Y A
Sbjct: 149 AVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVA 208

Query: 196 PEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPEDD 253
           PE+++    HG   D+WS GVI Y LL+G  PF  E  +G +          QF  P  D
Sbjct: 209 PEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWD 267

Query: 254 EISKEAQNLISKILVVNPAERITARDILKHPLL 286
            IS EA++ I K L ++P ER +A +++  P +
Sbjct: 268 SISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 128/218 (58%), Gaps = 5/218 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H NV++  D +E ++N+Y++LE    G L  LL +R  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 196
              I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 197 EIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEI 255
           E++ G    H +  D+WS GV++YALL G+ PF  +D N+  +  +++   F  P+D  I
Sbjct: 258 EVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYI 315

Query: 256 SKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSI 292
           S EA+ LI  IL  +P ER +  +I+ +   +  +PS 
Sbjct: 316 SNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSC 353

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 131/228 (57%), Gaps = 13/228 (5%)

Query: 102 NLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 161
           + YM+ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++
Sbjct: 7   HFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMI 66

Query: 162 DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYAL 221
            T   IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L
Sbjct: 67  STSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVL 126

Query: 222 LTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDIL 281
           + G++PFD+E+ ++  L  K++ G+ E P+   +S E  +L+SK+LVV+P +R + + ++
Sbjct: 127 VCGKVPFDDENSSV--LHEKIKQGKVEYPQ--HLSIEVISLLSKMLVVDPTKRASLKQVV 182

Query: 282 KHPLLQKYPSIKDSKSIRNLPREDTYLHPLAETNSAIDENILQNLVVL 329
            H  +Q+           + P      H +  T  A+D  +++ +  L
Sbjct: 183 NHQWMQRG---------YDFPAPSYIPHRVPLTADALDATVIKEMYRL 221

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 135/229 (58%), Gaps = 7/229 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 136
           EI I K + HAN+++  D +E  +N+Y++LE    G L  LL +R  L E E +RFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I  GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 196 PEIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H +  D+WS GV++YALL G+ PF  +D N   +  +++   F  P++  
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLP 302
           IS EA+ L+  +L ++P ER +  ++L +   +  +P    S  +  +P
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 137/231 (59%), Gaps = 5/231 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L +LL +R  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 196
           +  I Y H   ++HRDLK  N+  D+ YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 197 EIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEI 255
           E+++G    H +  D+WS GV++YALL G+ PF  ++ NI  +  ++++G +  P +   
Sbjct: 244 EVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPT 301

Query: 256 SKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLPRED 305
           SKE   LI  IL ++P ER +  +I+ +   +  +P+  +   + ++P  D
Sbjct: 302 SKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 146/271 (53%), Gaps = 24/271 (8%)

Query: 20  MGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79
            G+TLG G+ G V+ A N       A+K++ K   +   +  + D             E+
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKGDELNMLYD-------------EL 102

Query: 80  VIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 139
           +I++ L+H ++++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q++ 
Sbjct: 103 MILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQMLE 162

Query: 140 GISYCHALGIVHRDLKPENLLL---DTKYNIKIADFGMA-ALETEDKLLETSCGSPHYAA 195
            I Y H+  +VHRDLKPEN+L         + I+DFG+A  L +ED L+  + GS  Y A
Sbjct: 163 AIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYVA 222

Query: 196 PEIV--SGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPE 251
           PE++  SG   HG   D+WS GVI Y LL G  PF  E  +G +  +        F  P 
Sbjct: 223 PEVLTTSG---HGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPY 279

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILK 282
            + IS EA+  I K L ++P+ER TA ++L+
Sbjct: 280 WNSISVEAKEFILKALTLDPSERPTATELLQ 310

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 152/281 (54%), Gaps = 33/281 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A K+ISK       V   +D         G+ RE+ +
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISK-----RKVMGNMD---------GVTRELEV 242

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++RL   +E +   Y+++E+   G+L + +   G + E+      RQ++ G+
Sbjct: 243 LRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGV 302

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 303 KYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 362

Query: 200 SGIP----------YHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF- 247
           +G            Y     D+WS G ++Y +LTG LPF    G+ +  L K ++ G + 
Sbjct: 363 AGKANAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYH 418

Query: 248 EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           E P +D  IS EA++ I  +L VNP  R TA+  L+HP ++
Sbjct: 419 EGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 151/285 (52%), Gaps = 31/285 (10%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+I+K       V   VD         G+ RE+ +
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINK-----RKVMGNVD---------GVTRELEV 266

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++ L   +E + + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 267 LRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 326

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 327 RYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVI 386

Query: 200 SGIPYHGFAS---------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF-E 248
            G    G  +         D+WS G ++Y +LTG LPF    G+ +  L K +  G + E
Sbjct: 387 GGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHE 443

Query: 249 MP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSI 292
            P +D  IS EA++ I  +L +NP +R+TA   L+HP L    SI
Sbjct: 444 GPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  155 bits (391), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 152/312 (48%), Gaps = 44/312 (14%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           + +G+ LG G    V+ A NKTTG   A+K+       D                     
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQ------------FRE 240

Query: 78  EIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           E  I+  ++H N++ L D +     +T    Y+VLE  + GELF+ +V++  LP+ E+  
Sbjct: 241 ETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKA 300

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFG 173
            F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIADFG
Sbjct: 301 IFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFG 360

Query: 174 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVILYALLTGRLPFDEE 231
           +A    E +   T CG+P Y APE++      G+ S  D+WS GVILY  L G  PF ++
Sbjct: 361 LAKFTGEMQFTNTLCGTPSYVAPEVLVK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQ 417

Query: 232 DG--NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
            G  +++  ++  +   F  P  DEI   A +LIS +LV++P  R        HP L   
Sbjct: 418 LGPPSLKEQIMSAKYA-FYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSV 476

Query: 290 PSIKDSKSIRNL 301
             +  S +++ L
Sbjct: 477 SHLDVSHNLKRL 488

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  153 bits (387), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 149/276 (53%), Gaps = 18/276 (6%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +  G+TLG GS G V+ A   +T    A+K+I K   + ++V   +           +  
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGNDVQLQM-----------LYD 95

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I++ L+H N+++  D +E+    Y+V + A  GELF+ +++RG   E +A++   Q+
Sbjct: 96  ELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQM 155

Query: 138 IIGISYCHALGIVHRDLKPENLLL---DTKYNIKIADFGMAA-LETEDKLLETSCGSPHY 193
           +  I Y H+  IVHRDLKPEN+L         + IADFG+A  L+  D L+  + GS  Y
Sbjct: 156 LKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSLGY 215

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPE 251
            APE+++    HG   D+WS GVI Y LL G   F  E  +G +      +   +F  P 
Sbjct: 216 VAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHEPY 274

Query: 252 DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            + +S+EA+  I K L +NP ER TA ++L  P ++
Sbjct: 275 WNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 135/231 (58%), Gaps = 5/231 (2%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G +  LL +R  L E E      QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 196
           I  I Y H+  ++HRDLK  N+  D +YN+KI DFG+AA+   DK  + T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 197 EIVSGIPY-HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEI 255
           E+++G    H +  D+WS GV+LYALL G+ PF  ++  +  +  +++   F  P D  +
Sbjct: 257 EVLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPV 314

Query: 256 SKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLPRED 305
           S +A+NLIS +L +NPA R +  +I  +   +  +PS   S   + +P  D
Sbjct: 315 SSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  153 bits (387), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 150/277 (54%), Gaps = 19/277 (6%)

Query: 23  TLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIM 82
           TLG GS G V+ A    +    A+K++ K   + +          P      I  E+ I+
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNG------GLEP------IYDELNII 117

Query: 83  KLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGIS 142
           + L+H N+++  D +ET S  Y+V + A  GELF+ ++  G   E +A+    QI+  + 
Sbjct: 118 QHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVE 177

Query: 143 YCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMA-ALETEDKLLETSCGSPHYAAPEI 198
           Y H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +D ++    GS  Y APE+
Sbjct: 178 YLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEV 237

Query: 199 VSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEMPEDDEIS 256
            +    HG  SD+WS GVI Y LL G  PF  E  DG +  +       +F+ P  D IS
Sbjct: 238 FTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGIS 296

Query: 257 KEAQNLISKILVVNPAERITARDILKHPLLQKYPSIK 293
           + A+N I +IL ++PA R +A ++L  P +Q   S++
Sbjct: 297 ELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  158 bits (400), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 149/279 (53%), Gaps = 31/279 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A+K+ISK          ++ N        G+ RE+ +
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--------KVMGNME------GVSRELEV 244

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  +
Sbjct: 245 LQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAV 304

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 305 KYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVI 364

Query: 200 SGI--------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF-EM 249
            G          Y     D+WS G ++Y +LTG LPF    G+ +  L K +  G + E 
Sbjct: 365 GGKGETNEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEG 420

Query: 250 P-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           P +D  IS EA++ I  +L VNP  R+TA   L+HP ++
Sbjct: 421 PLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  154 bits (390), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 138/292 (47%), Gaps = 40/292 (13%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A NK TG   A+K+       D   T                 E  
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTK------------KFTEETK 248

Query: 81  IMKLLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           I+  + H N+++L D     V +T    Y+VLE    GELF  +V +  L E+E    FR
Sbjct: 249 ILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFR 308

Query: 136 QIIIGISYCHALGIVHRDLKPENLLL-------------------DTKYNIKIADFGMAA 176
           Q++ G+ Y H+  I+HRD+KPEN+LL                   +    +KIADFG+A 
Sbjct: 309 QLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAK 368

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E K   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF E+    +
Sbjct: 369 FTGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAPPS 427

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           ++  +L+ +   F  P  D I     +LIS +LVVNPA R +  D L HP  
Sbjct: 428 MKEQILQGKFA-FYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  158 bits (400), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 152/280 (54%), Gaps = 31/280 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A+K+ISK       V   +D         G+ RE+ +
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISK-----RKVMGNMD---------GVTRELEV 246

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E   + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 247 LRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 306

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APEI+
Sbjct: 307 KYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEII 366

Query: 200 SG---------IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQF-E 248
           SG            +    D+WS G ++Y +LTG LPF    G+ +  L K V+ G + E
Sbjct: 367 SGSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYHE 423

Query: 249 MP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            P +D  IS EA+N I  +L VNP +R++A   L+HP ++
Sbjct: 424 GPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  157 bits (398), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 156/295 (52%), Gaps = 35/295 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+I+K       V   +D         G+ RE+ +
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINK-----RKVVGNMD---------GVSRELEV 237

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ LNH  ++ L   +E  +N YMV+E+   G+L + +   G + E       RQI+  I
Sbjct: 238 LQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAI 297

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++    +++T CG+  Y APE++
Sbjct: 298 QYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVI 357

Query: 200 SGIP-------------YHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQAG 245
            G                +    D+WS G +++ +LTG LPF    G+ +  L  +++ G
Sbjct: 358 GGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKG 414

Query: 246 QF-EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSI 298
            + E P +D  IS EA++ I  +L V+ ++R+T  D L HP +++  S  D+ S+
Sbjct: 415 SYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494
           bp, 497 aa] {ON} Anc_2.352 YDL101C
          Length = 497

 Score =  153 bits (387), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 142/297 (47%), Gaps = 44/297 (14%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           + +G+ LG+G    V+   NK T    AIK+    +  D                   + 
Sbjct: 181 YVVGKELGVGHYATVKEGINKKTEQIVAIKIFHPQLNDDQKKNKQ------------FKE 228

Query: 78  EIVIMKLLNHANVLRLYDVW-ETNS----NLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           E  I+  + H+N+++L D + ET S      Y+VLE  + GELF+ ++ +  L ++E   
Sbjct: 229 ETDILMRVKHSNIVKLLDSYVETVSKSQIQKYLVLEKIDDGELFDRILRKTSLRQDETKA 288

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLL-------------------DTKYNIKIADFG 173
            F+QI+ G+ Y H + I+HRD+KPEN+LL                   +    +KIADFG
Sbjct: 289 LFKQILTGLQYLHGMNIIHRDIKPENILLNITKRSDPKELQKGPWDADEIDIQVKIADFG 348

Query: 174 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG 233
           +A    E +   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF +  G
Sbjct: 349 LAKFTGEMQFTNTLCGTPSYVAPEVLRKTDYSS-KVDMWSAGVLLYVCLCGFPPFSDTLG 407

Query: 234 NIRNLLLKVQAGQ----FEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
                 LK Q  Q    F  P  DEI     +LIS +LVVNP  R +  D ++HP  
Sbjct: 408 PPS---LKEQIAQGIFAFYSPYWDEIDDSVLHLISHLLVVNPTNRYSVEDTIRHPWF 461

>AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL101C
           (DUN1)
          Length = 472

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/328 (31%), Positives = 159/328 (48%), Gaps = 46/328 (14%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A NK TG   A+K+       D+  T                 E  
Sbjct: 158 GKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQ------------FREETK 205

Query: 81  IMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           I+  LNH N+++L + +     ++    Y+VLE  + GELF+ +V +  L ++E    F+
Sbjct: 206 ILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFK 265

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFGMAA 176
           QI+ G+ Y H   I+HRD+KPEN+LL  +                     +KIADFG+A 
Sbjct: 266 QILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAK 325

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E +   T CG+P Y A E+++   Y     D+WS GV+LY  L G  PF ++    +
Sbjct: 326 FTGEMQFTTTLCGTPSYVAAEVLTKTGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPS 384

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKD 294
           ++  +L+ +   F  P  DEI     +LIS +LVV+PA+R + RD + H  L K    K 
Sbjct: 385 MKEQILQGKFA-FYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKT 443

Query: 295 SKSIR------NLPREDTYLHPLAETNS 316
           SK  R      N+P+  + L  + +T S
Sbjct: 444 SKVERPRLSETNVPKTYSELSSIQQTAS 471

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  153 bits (387), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 144/292 (49%), Gaps = 40/292 (13%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           + +G+ LG G    V+   NK TG   AIK+    +  D                +    
Sbjct: 182 YIIGKELGSGHYAIVKEGRNKKTGQSVAIKIFHPQLNDDQKKN------------HQFRE 229

Query: 78  EIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 132
           E  I+  ++H N++ L D +     ++    Y+VL+  + GELF+ +V +  L +NE   
Sbjct: 230 ETDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVRKTSLSQNETKA 289

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLL-------------------DTKYNIKIADFG 173
            F+QI+ GI Y H   I+HRD+KPEN+LL                   +    +KIADFG
Sbjct: 290 LFKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDEIDIQVKIADFG 349

Query: 174 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG 233
           +A    E +   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF ++ G
Sbjct: 350 LAKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCLCGFPPFSDQLG 408

Query: 234 --NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
              ++  +L+ +   F  P  DEI+    +LIS +LVVNPA+R +  D++ H
Sbjct: 409 PPTLKEQILQGKFAFFS-PYWDEINDSVLHLISNLLVVNPAQRYSIEDMINH 459

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 164/310 (52%), Gaps = 20/310 (6%)

Query: 5   KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVD 64
           KT P++   +   ++ G+ LG G   +        +G   A K ++K       ++   +
Sbjct: 129 KTPPSLIKTRGRDYRRGQFLGEGGFARC-FQIKDESGKIFAAKTVAK-------ISIKTE 180

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
            T    L      EI I K + H N+++  D +E + N+Y++L     G L  LL +R  
Sbjct: 181 KTRRKLL-----SEIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKI 235

Query: 125 LPENEAIRFFR-QIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183
           L E E +RFF  QI   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+ 
Sbjct: 236 LTEPE-VRFFTVQICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRE 294

Query: 184 LE-TSCGSPHYAAPEIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
            + T CG+P+Y APE++ G    H +  D+WS GV+++ALL G+ PF  +D N   +  +
Sbjct: 295 RKYTVCGTPNYIAPEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSR 352

Query: 242 VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ-KYPSIKDSKSIRN 300
           ++  ++  P +  IS+EA+ LI  IL+ +P  R +  +I+++   +  +PS+  +     
Sbjct: 353 IKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTE 412

Query: 301 LPREDTYLHP 310
           +P  D +L P
Sbjct: 413 IPEYDQFLTP 422

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 150/311 (48%), Gaps = 47/311 (15%)

Query: 4   NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63
           NKT P    D+   + +G+ LG G    V+ A NK TG Q A+K+       D       
Sbjct: 189 NKTRPVSFFDK---YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ- 244

Query: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFNL 118
                         E  I+  + H N++ L D +     ++    Y+VLE  + GELF  
Sbjct: 245 -----------FREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFER 293

Query: 119 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL----------------- 161
           +V +  L ++E+   F+Q++ G+ Y H   I+HRD+KPEN+LL                 
Sbjct: 294 IVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWD 353

Query: 162 --DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVI 217
             +    +KIADFG+A    E +   T CG+P Y APE+++     G+ S  D+WS GVI
Sbjct: 354 EDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVI 410

Query: 218 LYALLTGRLPFDEEDG--NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERI 275
           LY  L G  PF ++ G  +++  +L+ +   F  P  D+I     +LIS +LV+NP ER 
Sbjct: 411 LYVCLCGFPPFSDQLGPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERY 469

Query: 276 TARDILKHPLL 286
              + L HP  
Sbjct: 470 NIDEALNHPWF 480

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 150/277 (54%), Gaps = 18/277 (6%)

Query: 16  GSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGI 75
           G++  G+TLG G+ G V+ A   +T    A+K+I K   + +++   +           +
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKGNDIQLQM-----------L 85

Query: 76  EREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
             E+ I++ L+H N++   D +E+    Y+V + A  GELF+ ++ +G   E +A++   
Sbjct: 86  YDELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVV 145

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMA-ALETEDKLLETSCGSP 191
           QI+  I Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ ++ L+  + GS 
Sbjct: 146 QILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSL 205

Query: 192 HYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQAGQFEM 249
            Y APE+++    HG   D+WS GVI Y LL G   F  E  +G +          +F  
Sbjct: 206 GYVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTRSKFPVKFHK 264

Query: 250 PEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           P  D IS EA+N I + L +NP ER TA ++L+ P +
Sbjct: 265 PYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 154/291 (52%), Gaps = 22/291 (7%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           +  K     K D I     G+TLG G+ G V+ A   +T    A+K++ K   + ++V  
Sbjct: 20  LAGKVASNAKTDYI----FGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQL 75

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121
            +           +  E+ I++ LNH N++   D +ET    ++V + A  GELF+ +V+
Sbjct: 76  QM-----------LYDELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVK 124

Query: 122 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYN---IKIADFGMAA-L 177
           +G   E +AI+   QI+  + Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L
Sbjct: 125 KGKFTEEDAIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKEL 184

Query: 178 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEE--DGNI 235
           ++ D+L+  + GS  Y APE+++    HG   D+WS GVI Y LL G   F  E  +G +
Sbjct: 185 KSGDELIFKAAGSLGYVAPEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFL 243

Query: 236 RNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
                  +   F  P  D +S++A+  I + L ++P +R TA  +L+ P +
Sbjct: 244 DECTQNDKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 134/229 (58%), Gaps = 7/229 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N+++  D +E ++N+Y++LE    G L  LL +R  L E E +RFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 195
           I G I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 196 PEIVSG-IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           PE++ G    H +  DVWS GV++YALL G+ PF  +D N   +  +++   F  P++  
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQK-YPSIKDSKSIRNLP 302
           IS EA+ L+  +L ++P ER +  +I+ +   +  +P    S  +  +P
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  152 bits (384), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/314 (30%), Positives = 151/314 (48%), Gaps = 44/314 (14%)

Query: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61
           +T K++ T        + +G+ LG G    V+ A NK TG Q A+K+       D     
Sbjct: 184 VTRKSSKTKPVSFFDKYLLGKELGSGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNK 243

Query: 62  MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELF 116
                           E  I+  + H N++ L D +     ++    Y+VLE  + GELF
Sbjct: 244 Q------------FREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELF 291

Query: 117 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--------------- 161
             +V +  L ++E+   F+Q++ G+ Y H   I+HRD+KPEN+LL               
Sbjct: 292 ERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGP 351

Query: 162 ----DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCG 215
               +    +KIADFG+A    E +   T CG+P Y APE+++     G+ S  D+WS G
Sbjct: 352 WDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAG 408

Query: 216 VILYALLTGRLPFDEEDG--NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAE 273
           VILY  L G  PF ++ G  +++  +L+ +   F  P  D+I     +LIS +LV+NP E
Sbjct: 409 VILYVCLCGFPPFSDQLGPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDE 467

Query: 274 RITARDILKHPLLQ 287
           R    D + HP  +
Sbjct: 468 RYNIDDAMNHPWFK 481

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  148 bits (373), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 132/255 (51%), Gaps = 17/255 (6%)

Query: 32  VQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVL 91
           V    +K TG   A+KV+ K      N+                 RE+ I   LNH N+ 
Sbjct: 105 VYCVRHKETGFICALKVMDKAEIVQYNLQKQ------------FRREVEIQTSLNHPNLT 152

Query: 92  RLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVH 151
           +LY  +     +Y+++EY   GEL+ LL   GP  +  A RF  QI   ++Y H   I+H
Sbjct: 153 KLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQIIH 212

Query: 152 RDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDV 211
           RDLKPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y     DV
Sbjct: 213 RDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KVDV 271

Query: 212 WSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNP 271
           W+ GV+ Y L+ G  PF+E+   +     ++     + PE   +S + ++LISK+L  NP
Sbjct: 272 WALGVLTYELIVGSPPFEEDTKELT--YKRILKNDIKFPE--TVSHDVKDLISKLLKYNP 327

Query: 272 AERITARDILKHPLL 286
           +ERI+ RD++KHP +
Sbjct: 328 SERISMRDVMKHPWI 342

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 146/281 (51%), Gaps = 32/281 (11%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           ++G++++ + +G GS GKV LA ++ T  +  +K   K    D N+              
Sbjct: 37  EVGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK---NDPNIV------------- 80

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 133
              RE+   +  ++  + ++Y++  T + ++M LEY    EL++ L+    +P  E    
Sbjct: 81  ---REVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTEL 137

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  Y
Sbjct: 138 FAQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVY 197

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE++    Y GF  D+W+ GVILY ++ G +PFDE+D        +V+     + ED 
Sbjct: 198 MAPELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD--------EVKTKWKIVNEDP 249

Query: 254 EI-----SKEAQNLISKILVVNPAERITARDILKHPLLQKY 289
           +      S + ++LI K+L  +P ER T R+ILKH  L+ Y
Sbjct: 250 DFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPY 290

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  155 bits (393), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 152/280 (54%), Gaps = 31/280 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A+K+I+K          ++ N +      G+ RE+ I
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKR--------KVMGNLS------GVTRELEI 246

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E   + Y+V+E+   G+L + +   G + E+      RQI+  +
Sbjct: 247 LRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 306

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
           +Y H  GI HRD+KP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 307 AYMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 366

Query: 200 SG----------IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQF-E 248
           SG          I Y     D+WS G ++Y +LT  LPF       + L  ++  G + E
Sbjct: 367 SGKNAATENDDRIEYSSLV-DMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHE 423

Query: 249 MP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            P +D  +S+EA++ I  ++ V+P  R+TA+D LKH  ++
Sbjct: 424 GPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 149/281 (53%), Gaps = 33/281 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A+K+I+K       V   +D         G+ RE+ +
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINK-----RKVMGNMD---------GVTRELDV 242

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E   + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 243 LRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 302

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 303 KYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 362

Query: 200 SG----------IPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK--VQAGQF 247
            G          I Y     D+WS G ++Y +LTG LPF    G+ ++ L K   +    
Sbjct: 363 GGKNSAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYH 418

Query: 248 EMP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
           E P +D  IS EA++ I  +L V+P +R+TA   L HP ++
Sbjct: 419 EGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 148/281 (52%), Gaps = 17/281 (6%)

Query: 5   KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVD 64
           KT P++  D    +   E LG G   +         G   A K++SK             
Sbjct: 80  KTPPSVIKDNSKKYFRRECLGEGGFARC-FHIKDDVGISFACKIVSKK------------ 126

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
           +   +   + +  EI I + L ++++++  D +E   N+Y++LE    G L +LL +R  
Sbjct: 127 SIKTERTKFKLLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKI 186

Query: 125 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKL 183
           L E E      Q+   I+Y H+  I+HRDLK  N+  D  +NIKI DFG+AA L    + 
Sbjct: 187 LTEAEVKFMTTQVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEK 246

Query: 184 LETSCGSPHYAAPEIV-SGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKV 242
             T CG+P+Y APE++ S    H F +D+WS G+++YA++ G+ PF  +D  +  +  K+
Sbjct: 247 KYTMCGTPNYIAPEVILSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKI 304

Query: 243 QAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
           +  Q+E P D  I+ + + LI  +LV++P++R    DILK+
Sbjct: 305 KLCQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKY 345

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 151/280 (53%), Gaps = 31/280 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  + TG   A+K+ISK       V   V+         G+ RE+ +
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISK-----RKVMGNVE---------GVTRELEV 239

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           +  LNH  ++ L   +E   + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 240 LHRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 299

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
            Y H   I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 300 KYIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVI 359

Query: 200 SG-------IPYHGFAS--DVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQAGQF-E 248
            G       +  + ++S  D+WS G ++Y +LTG LPF    G+ +  L  ++  G + E
Sbjct: 360 DGKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHE 416

Query: 249 MP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            P +D +IS EA++ I  +L VNP +R+TA   LKHP +Q
Sbjct: 417 GPLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 126/210 (60%), Gaps = 7/210 (3%)

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           EI I K + H N++   D +E + N+Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 145 EIQIHKNMRHQNIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE-VRFFTTQ 203

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 195
           I G + + H+  I+HRDLK  N+  D  +N+KI DFG+AA +  E++   T CG+P+Y A
Sbjct: 204 ICGALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTICGTPNYIA 263

Query: 196 PEIVSGIPY--HGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
           PE++ G     H F  D+WS GV+++A++TG+ PF  ++  +  +  +++   +  P D 
Sbjct: 264 PEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKE--VSTIYDRIKHCNYSFPTDK 321

Query: 254 EISKEAQNLISKILVVNPAERITARDILKH 283
            +SK+ + LI  IL +NP ER T ++IL +
Sbjct: 322 YVSKDVKKLIQDILSMNPMERPTIQEILNY 351

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  149 bits (376), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 151/311 (48%), Gaps = 47/311 (15%)

Query: 5   KTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVD 64
           KT P    D+   + +G+ LG G    V+ A NK TG Q A+K+       D        
Sbjct: 191 KTKPVSFFDK---YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ-- 245

Query: 65  NTTPDALPYGIEREIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFNLL 119
                        E  I+  ++H N++ L D +     ++    Y+VLE  + GELF  +
Sbjct: 246 ----------FREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERI 295

Query: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL------------------ 161
           V +  L ++E+   F+Q++ G+ Y H   I+HRD+KPEN+LL                  
Sbjct: 296 VRKTCLGQDESRALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDE 355

Query: 162 -DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGVIL 218
            +    +KIADFG+A    E +   T CG+P Y APE+++     G+ S  D+WS GVIL
Sbjct: 356 DEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVIL 412

Query: 219 YALLTGRLPFDEEDG--NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERIT 276
           Y  L G  PF ++ G  +++  +++ +   F  P  D+I     +LIS +LV+NP ER  
Sbjct: 413 YVCLCGFPPFSDQLGPPSLKEQIMQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYN 471

Query: 277 ARDILKHPLLQ 287
             + + HP  +
Sbjct: 472 IDEAMNHPWFK 482

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  149 bits (376), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 165/314 (52%), Gaps = 33/314 (10%)

Query: 1   MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQA-AIKVISKTIFQDSNV 59
           + T ++ P IK  ++G      T+G GS G V+ A  K   +   A+K +      +S +
Sbjct: 2   VFTQESLPVIKDVELGG-----TIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGL 56

Query: 60  TSMVDNTTPDALPYGIEREIVIM-KLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNL 118
           +              + RE+V+  K   HANVLR+ D       L+++LE A+ G+LF+ 
Sbjct: 57  SQK-----------DVSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDK 105

Query: 119 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAA-L 177
           +     +  + A  +F+Q+I  ++Y H +G+ HRD+KPEN+LLD K N+K+ADFG+A+  
Sbjct: 106 IEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQF 165

Query: 178 ETEDKLLETSC---GSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFD---EE 231
             +D  L  S    GSP Y APEI+S   Y+   +D+WS GV+L+ LLTG +P+    +E
Sbjct: 166 RRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKE 225

Query: 232 DGNIRNLL---LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
           D N    +    KV  G +E      +     NL+ KIL  +P +R++   +  HP L  
Sbjct: 226 DDNYEWFVNNEGKVSLGPWE-----RVELRQMNLLRKILQPDPRKRVSLEKLRHHPWLTS 280

Query: 289 YPSIKDSKSIRNLP 302
              + +S+ + N P
Sbjct: 281 RSKLANSEGLCNNP 294

>Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFL188C
          Length = 454

 Score =  147 bits (372), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 147/296 (49%), Gaps = 40/296 (13%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A NK+TG   A+K     IF         ++    A  +  E EI+
Sbjct: 149 GKELGSGHYATVKEAVNKSTGEVVAVK-----IFHPQK-----NDDIKKARQFREETEIL 198

Query: 81  IMKLLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           +   ++H N+++L +     V +T    Y+VLE    GELF  +V +  L ++E    F+
Sbjct: 199 MS--IDHVNIVKLLERFVEPVSKTKVQTYLVLEKINDGELFERIVRKTKLRQDETRALFK 256

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTKYN-------------------IKIADFGMAA 176
           QI+ G+ Y H   I+HRD+KPEN+LL  +                     +KIADFG+A 
Sbjct: 257 QILGGLKYLHDKNIIHRDIKPENILLSIRQRKFTDELQLGPWDKNEIDIIVKIADFGLAK 316

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E +   T CG+P Y A E++S   Y     D+WS GV+LY  L G  PF ++    +
Sbjct: 317 FTGEMQFTNTLCGTPSYVAAEVLSKAGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPS 375

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYP 290
           ++  +L+ +   F  P  D+I     +LIS +LVVNP +R + RD + HP     P
Sbjct: 376 MKEQILRGKFA-FYSPYWDDIDDSVLDLISNLLVVNPDQRFSVRDAIAHPWFDGLP 430

>TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.352
           YDL101C
          Length = 526

 Score =  149 bits (375), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 144/295 (48%), Gaps = 40/295 (13%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           + +G+ LG G    V+   NK TG   AIK+    +  D                +    
Sbjct: 213 YIVGKELGSGHYAIVKEGINKQTGKSVAIKIFHPQLNDDQKKN------------HQFRE 260

Query: 78  EIVIMKLLNHANVLRLYDVW-ETNSNL----YMVLEYAEKGELFNLLVERGPLPENEAIR 132
           E  I+  + H N++ L D + E  S +    Y+VL+  + GELF+ +V +  L + E   
Sbjct: 261 ETDILMRVQHKNIVNLLDSFVEPISKMQIQKYLVLDKIDDGELFDRIVRKTNLSQPETKA 320

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFG 173
            F+QI+ G+ Y H   I+HRD+KPEN+LL+ +                     +KIADFG
Sbjct: 321 LFKQILSGLKYLHGKNIIHRDIKPENILLNVRRRQSPDEIQTGPWDDDEIDIQVKIADFG 380

Query: 174 MAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG 233
           +A    E +   T CG+P Y APEI++    H    DVWS GV+LY  L G  PF ++ G
Sbjct: 381 LAKFTGEMQFTNTLCGTPSYVAPEILTK-QGHSSKVDVWSAGVLLYVCLCGFPPFSDQLG 439

Query: 234 --NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
             ++++ +L+ +   F  P  D+I     +LIS +LVVNP +R +    + HP  
Sbjct: 440 PPSLKDQILQGKFA-FYSPYWDDIDDTVLHLISNLLVVNPVQRFSIEHCINHPWF 493

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  146 bits (369), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 147/276 (53%), Gaps = 18/276 (6%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPY 73
           Q   +++G  LG G  GKV    +K +G  +A+KV+ K      N               
Sbjct: 171 QFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ----------- 219

Query: 74  GIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELF-NLLVERGPLPENEAIR 132
             +RE+ +   LNH N+++++  ++    +Y+++EY   GEL+ +L    GP  +  A  
Sbjct: 220 -FKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASN 278

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPH 192
           +  QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +     +   +T CG+  
Sbjct: 279 YIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTID 338

Query: 193 YAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPED 252
           Y APE+V+   Y  +  D+W+ G++ Y L+ G  PF+EE  ++     ++       P+ 
Sbjct: 339 YLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFPQ- 394

Query: 253 DEISKEAQNLISKILVVNPAERITARDILKHPLLQK 288
             +S +A++LI+++L  +P++R+   D++KHP + K
Sbjct: 395 -TVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  151 bits (381), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 149/280 (53%), Gaps = 32/280 (11%)

Query: 22  ETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVI 81
           E +G G+   V+ A  ++TG   A K+ISK          ++ N        G++RE+ +
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKR--------KLMGNWD------GVDRELAV 235

Query: 82  MKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 141
           ++ L+H  ++RL   +E     Y+++E+   G+L + +   G + E+      RQ++  +
Sbjct: 236 LRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAV 295

Query: 142 SYCHALGIVHRDLKPENLLL--DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 199
           +Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++
Sbjct: 296 AYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 355

Query: 200 SGI---------PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQAGQF-E 248
            G           Y     D+WS G ++Y +LTG LPF    G+ +  L  ++  G + E
Sbjct: 356 GGKNDNTEEEKNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHE 411

Query: 249 MP-EDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            P +D  IS EA++ I  +L VNP  R TA   L+HP ++
Sbjct: 412 GPLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 135/258 (52%), Gaps = 17/258 (6%)

Query: 31  KVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANV 90
           +V    +K TG   A+KV+ K      NV                 RE+ I   LNH N+
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQ------------FRREVEIQSSLNHQNL 169

Query: 91  LRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIV 150
            +LY  +  +  +Y+++EY   GEL+ LL  +GPL +  A  +  Q+   + Y H   I+
Sbjct: 170 TKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRNII 229

Query: 151 HRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASD 210
           HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y     D
Sbjct: 230 HRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-KVD 288

Query: 211 VWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVN 270
           VW+ GV+ + L+    PF+E+   + +   ++  G  + P  + IS +AQ+LI+K+L  N
Sbjct: 289 VWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NHISSDAQDLITKLLRHN 344

Query: 271 PAERITARDILKHPLLQK 288
             +RI+ R++ +HP + K
Sbjct: 345 SKDRISLREVKQHPWITK 362

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 153/313 (48%), Gaps = 47/313 (15%)

Query: 3   TNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSM 62
           T KT P    D+   + +G+ LG G    V+ A NK +G Q A+K+       D      
Sbjct: 188 TIKTKPVSFFDK---YLLGKELGAGHYALVKEAKNKKSGQQVAVKIFHAQQNDDQKKNKQ 244

Query: 63  VDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVW-----ETNSNLYMVLEYAEKGELFN 117
                          E  I+  ++H N++ L D +     ++    Y+VLE  + GELF 
Sbjct: 245 ------------FREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFE 292

Query: 118 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL---------------- 161
            +V +  L ++E+   F+Q++ G+ Y H   I+HRD+KPEN+LL                
Sbjct: 293 RIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPW 352

Query: 162 ---DTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFAS--DVWSCGV 216
              +    +KIADFG+A    E +   T CG+P Y APE+++     G++S  D+WS GV
Sbjct: 353 DEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYSSKVDLWSAGV 409

Query: 217 ILYALLTGRLPFDEEDG--NIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274
           ILY  L G  PF ++ G  +++  +L+ +   F  P  D+I     +LIS +LV+NP ER
Sbjct: 410 ILYVCLCGFPPFSDQLGPPSLKEQILQAKYA-FYSPYWDKIDDLVLHLISNLLVLNPDER 468

Query: 275 ITARDILKHPLLQ 287
               + + HP  +
Sbjct: 469 YNIDEAMDHPWFK 481

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 149/277 (53%), Gaps = 22/277 (7%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +  G TLG G+ G V+ A   +T    A+K++ K   + ++V   +           +  
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGNDVQLQM-----------LYD 107

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I++ L H N++R  D +E+    Y+V + A  GELF+ ++ +G   E +A++   Q+
Sbjct: 108 ELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVVQM 167

Query: 138 IIGISYCHALGIVHRDLKPENLL-LDTKYN--IKIADFGMAA-LETEDKLLETSCGSPHY 193
           +  + Y H+  IVHRDLKPEN+L +D   +  + IADFG+A  L   D+L+  + GS  Y
Sbjct: 168 LNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSLGY 227

Query: 194 AAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDD 253
            APE+++    HG   D+WS GVI Y LL G  PF  E  ++   L +V   ++ +   +
Sbjct: 228 VAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKFHE 284

Query: 254 E----ISKEAQNLISKILVVNPAERITARDILKHPLL 286
           +    IS EA+  I + L +NP  R TA ++L  P +
Sbjct: 285 QYWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {ON}
           similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 412

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 140/296 (47%), Gaps = 40/296 (13%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A +K +G+  A+K+       D   T                 E  
Sbjct: 100 GKELGSGHYAIVKEATDKDSGDVVAVKIFHPQQNDDQKKTRQ------------FREETK 147

Query: 81  IMKLLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           I+  + H N+++L D     V +     Y+VLE    GELF+ +V +  L + E    F+
Sbjct: 148 ILMSIQHKNIVKLIDRFVEPVSKAQIQTYLVLEKVSDGELFDRIVRKTKLRQEETNAIFK 207

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFGMAA 176
           QI+ G+ Y HA  I+HRD+KPEN+LL  +                     IKIADFG+A 
Sbjct: 208 QILNGLKYLHAKNIIHRDIKPENILLSIRRRRYQDEQQMGPWDDDEIDITIKIADFGLAK 267

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E +   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF E+    +
Sbjct: 268 FIGELQFTNTLCGTPSYVAPEVLRKTGYSS-RVDLWSAGVLLYVCLCGFPPFSEQLAPPS 326

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYP 290
           ++  +L+ +   F  P  D+I     +LIS +LVVNPA R   +  ++HP     P
Sbjct: 327 MKEQILQGKFA-FYSPYWDDIDDSCLHLISNLLVVNPALRYDIQKTIEHPWFSHAP 381

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  147 bits (370), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 150/283 (53%), Gaps = 18/283 (6%)

Query: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISK---TIFQDSNVTSMVDNTTPDA 70
           Q+G W    TLG G+ G V+LA ++ +G   A+K+  +    I    N  ++ D      
Sbjct: 51  QLGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKE 110

Query: 71  LPYGIE------REIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGP 124
               I+      +E  + ++L H ++ + Y + E   + YM LEY +   L   +  +  
Sbjct: 111 FKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNA 170

Query: 125 LPENEAIR--FFRQIIIGISYCHALGIVHRDLKPENLLL-DTKYNIKIADFGMAALETED 181
              NE I   F  QI+  ++Y H+  IVHRDLK EN+++ +    IK+ DFG+     ++
Sbjct: 171 KKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQN 230

Query: 182 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
             L   CGS +YAAPE++    Y G   D+WS GV+LY ++TG+LPF    G  +  L+K
Sbjct: 231 STLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMK 287

Query: 242 -VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKH 283
            + +GQ + P  + +S +  +L+S+IL ++ + R +  DI+KH
Sbjct: 288 HILSGQVKFP--NFLSMDVISLLSRILEIDLSFRFSLSDIIKH 328

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  142 bits (358), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 144/271 (53%), Gaps = 28/271 (10%)

Query: 23  TLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSM--VDNTTPDALPYGIEREIV 80
           TLG GS G+V L  +   G   AIKV+ K     + V  M  +++T         ER + 
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----AQVVKMKQIEHTND-------ERRM- 102

Query: 81  IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 140
            +KL+ H  ++R++  ++ + NL+MV++Y E GELF LL +    P   A  +  ++ + 
Sbjct: 103 -LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLA 161

Query: 141 ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 200
           + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE+++
Sbjct: 162 LEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIA 219

Query: 201 GIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQ 260
             PY+  + D WS GV++Y +L G  PF   D        K+  G+   P+    + +  
Sbjct: 220 TKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQ--FFNSDVI 274

Query: 261 NLISKILVVNPAERI-----TARDILKHPLL 286
           +L+SK+L  +   RI      A+DI  HP  
Sbjct: 275 DLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 148/274 (54%), Gaps = 24/274 (8%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +++  TLG GS G+V L  +   G   AIKV+ K   Q       +++T         ER
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK---QQIIKMKQIEHTND-------ER 142

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
            +  +KL+ H  ++RL+  ++ + NL+MV++Y E GELF+LL +    P   A  +  ++
Sbjct: 143 RM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV 200

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPE 197
           ++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y APE
Sbjct: 201 VLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYIAPE 258

Query: 198 IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISK 257
           +++  PY+  + D WS GV++Y +L G  PF   D        K+  G+   P+      
Sbjct: 259 VIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG--FHP 313

Query: 258 EAQNLISKILVVNPAERI-----TARDILKHPLL 286
           +  +L+++++  +  +R+      +RD+  HP  
Sbjct: 314 DVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 141/269 (52%), Gaps = 24/269 (8%)

Query: 23  TLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIM 82
           TLG GS G+V L  +   G   AIKV+ K   Q       V++T         ER +  +
Sbjct: 77  TLGTGSFGRVHLVRSVHNGRYYAIKVLKK---QQVVKMKQVEHTND-------ERRM--L 124

Query: 83  KLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGIS 142
           KL+ H  ++R++  ++   N++MV++Y E GELF+LL +    P   A  +  ++I+ + 
Sbjct: 125 KLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 184

Query: 143 YCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 202
           Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE+++  
Sbjct: 185 YLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTK 242

Query: 203 PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNL 262
           PY+  + D WS GV++Y +L G  PF   D        K+  G+   P       +  +L
Sbjct: 243 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPP--YFHPDVVDL 297

Query: 263 ISKILVVNPAERI-----TARDILKHPLL 286
           +SK++  +   RI      +RDI  HP  
Sbjct: 298 LSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 151/295 (51%), Gaps = 26/295 (8%)

Query: 3   TNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSM 62
           T KTT  +    I  +K GETLG GS   V LA +K +G + A+KV+SK           
Sbjct: 152 TGKTTRQVVKKGIKDFKFGETLGDGSYSTVMLATSKESGKKYAVKVLSKEYLIRQKKVKY 211

Query: 63  VDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122
           V+          IE+   + +L N   +++LY  ++  S+LY +LEYA  G+  +++ + 
Sbjct: 212 VN----------IEKN-ALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKKY 260

Query: 123 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAAL----- 177
           G L E+ A  +  QII  I + H+ GIVHRD+KPEN+LLD  + +K+ DFG A +     
Sbjct: 261 GSLNEDCACYYSAQIIDAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKP 320

Query: 178 ETEDK--LLETS---CGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEED 232
            T D   LL  S    G+  Y +PE+++   Y  +  D+W+ G IL+ ++ G+ PF   +
Sbjct: 321 NTTDSYDLLSRSKSFVGTAEYVSPELLND-NYVDYRCDIWAFGCILFQMIAGKPPFKATN 379

Query: 233 GNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
             +     KV   Q+       +    ++L+  IL+  PA+R+T   I  H   +
Sbjct: 380 EYL--TFQKVMKVQYAFTAGFPLV--VRDLVKGILIKQPAQRLTIPQIKSHHFFK 430

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  142 bits (358), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 145/277 (52%), Gaps = 24/277 (8%)

Query: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74
           +  +++  TLG GS G+V L  +   G   AIKV+ K   Q       V++T        
Sbjct: 67  LHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKK---QQVVKMKQVEHTND------ 117

Query: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134
            ER +  +KL+ H  ++R++  ++   N++MV++Y E GELF+LL +    P   A  + 
Sbjct: 118 -ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 174

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194
            ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y 
Sbjct: 175 AEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYI 232

Query: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254
           APE+++  PY+  + D WS GV++Y +L G  PF   D        K+  G+   P    
Sbjct: 233 APEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYPP--Y 287

Query: 255 ISKEAQNLISKILVVNPAERI-----TARDILKHPLL 286
              +  +L+SK++  +   RI      +RDI  HP  
Sbjct: 288 FHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {ON}
           YDL101C (DUN1) - protein kinase [contig 253] FULL
          Length = 499

 Score =  145 bits (365), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 139/292 (47%), Gaps = 40/292 (13%)

Query: 21  GETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80
           G+ LG G    V+ A +K +G+  A+K+       D   T                 E  
Sbjct: 189 GKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQ------------FREETK 236

Query: 81  IMKLLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR 135
           I+  + H N+++L D     V +     ++VLE    GELF+ +V +  L E+E    F+
Sbjct: 237 ILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIFK 296

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDTK-------------------YNIKIADFGMAA 176
           QI+ G+ Y HA  I+HRD+KPEN+LL  +                     IKIADFG+A 
Sbjct: 297 QILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAK 356

Query: 177 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--N 234
              E +   T CG+P Y APE+++   Y     D+WS GV+LY  L G  PF E+    +
Sbjct: 357 FIGEMQFTNTLCGTPSYVAPEVLTKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAPPS 415

Query: 235 IRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLL 286
           ++  +L  +   F  P  D+I     +LIS +LVVNPA R   +  + HP  
Sbjct: 416 MKEQILNGKFA-FYSPYWDDIDDSCLHLISNLLVVNPAYRFDVQKTINHPWF 466

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  142 bits (358), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 129/257 (50%), Gaps = 17/257 (6%)

Query: 32  VQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVL 91
           V    +K TG   A+K + K+     NV                 RE+ I   L H N+ 
Sbjct: 137 VYCVKHKRTGFICALKAMKKSEIVQYNVQKQ------------FRREVEIQSSLKHPNLT 184

Query: 92  RLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVH 151
           RLY  +     +Y+++EY   GEL+  L   GP  +  A  F  Q+   ++Y H+  I+H
Sbjct: 185 RLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKNILH 244

Query: 152 RDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDV 211
           RD+KPEN+LL  +  +K+ DFG +     +   +T CG+  Y +PE++    Y     DV
Sbjct: 245 RDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-KVDV 303

Query: 212 WSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNP 271
           W+ GV+ Y LL G  PF+E+   +     ++       P  D++S  A++LIS++L  +P
Sbjct: 304 WALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQVSPHARDLISRLLEYDP 359

Query: 272 AERITARDILKHPLLQK 288
             RI  +D+ +HP ++K
Sbjct: 360 QNRIPLKDVKRHPWIKK 376

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  142 bits (357), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 141/269 (52%), Gaps = 24/269 (8%)

Query: 23  TLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIM 82
           TLG GS G+V L  +   G   AIKV+ K   Q       V++T         ER +  +
Sbjct: 76  TLGTGSFGRVHLVRSVHNGRYYAIKVLKK---QQVVKMKQVEHTND-------ERRM--L 123

Query: 83  KLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGIS 142
           KL+ H  ++R++  ++   N++MV++Y E GELF+LL +    P   A  +  ++I+ + 
Sbjct: 124 KLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 183

Query: 143 YCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGI 202
           Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE+++  
Sbjct: 184 YLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTK 241

Query: 203 PYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNL 262
           PY+  + D WS GV++Y +L G  PF   D        K+  G+   P       +  +L
Sbjct: 242 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPP--YFHPDVVDL 296

Query: 263 ISKILVVNPAERI-----TARDILKHPLL 286
           +SK++  +   RI      +RDI  HP  
Sbjct: 297 LSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  141 bits (355), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 144/271 (53%), Gaps = 28/271 (10%)

Query: 23  TLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSM--VDNTTPDALPYGIEREIV 80
           TLG GS G+V L  +   G   AIKV+ K       V  M  +++T         ER + 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKK-----EQVIRMKQIEHTND-------ERRM- 94

Query: 81  IMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 140
            +KL++H  ++R++  ++ + NL+MV++Y E GELF+LL +    P   A  +  ++I+ 
Sbjct: 95  -LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 141 ISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVS 200
           + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+++
Sbjct: 154 LEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIA 211

Query: 201 GIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQ 260
             PY+  + D WS G++++ +L G  PF   D        K+  G+   P       +  
Sbjct: 212 TKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDVV 266

Query: 261 NLISKILVVNPAERI-----TARDILKHPLL 286
           +L+SK++  +   R+       +D+  HP  
Sbjct: 267 DLLSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  141 bits (355), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 142/272 (52%), Gaps = 19/272 (6%)

Query: 18  WKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIER 77
           +++G  LG G  GKV    +K +G   A+K I K      N+               ++R
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQ------------LKR 147

Query: 78  EIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 137
           E+ I   ++H N+++LY  +     +Y+++E++  GEL+  L   GP  +  A  +  QI
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPE 197
              + Y H   I+HRD+KPEN+L+     +K+ADFG + L  E    +T CG+  Y +PE
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPE 267

Query: 198 IVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQAGQFEMPEDDEIS 256
           +++   Y     DVW+ GV+ Y L+ G  PF+E   N + L  K +       PE   IS
Sbjct: 268 MITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFPE--SIS 321

Query: 257 KEAQNLISKILVVNPAERITARDILKHPLLQK 288
           K+A++LISK+LV +  +R++   +  HP + K
Sbjct: 322 KDAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [1485
           bp, 494 aa] {ON} highly similar to uniprot|P39009
           Saccharomyces cerevisiae YDL101C DUN1 Cell-cycle
           checkpoint serine- threonine kinase required for DNA
           damage-induced transcription of certain target genes
           phosphorylation of Rad55p and Sml1p and transient G2/M
           arrest after DNA damage also regulates postreplicative
           DNA repair
          Length = 494

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 141/290 (48%), Gaps = 40/290 (13%)

Query: 24  LGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMK 83
           LG G    V+   NK TG   A+K+       D   ++                E  I+ 
Sbjct: 188 LGSGHYATVKEGINKKTGEVVAVKIFHPQQNDDQKKSNQ------------FREETNILM 235

Query: 84  LLNHANVLRLYD-----VWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 138
            ++H N++++ D     V ++    Y+VLE    GELF+ +V++  L +NE    F+QI+
Sbjct: 236 RVHHPNIVKMLDSFVEPVSKSQIQKYLVLEKINDGELFDRIVKKVCLRQNETQALFKQIL 295

Query: 139 IGISYCHALGIVHRDLKPENLLL-------------------DTKYNIKIADFGMAALET 179
            GI + H+  I+HRD+KPEN+LL                   +    +KIADFG+A    
Sbjct: 296 EGIKHLHSQNIIHRDIKPENILLNITRRQSPNEMQLGPWDQDEIDVQVKIADFGLAKFTG 355

Query: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDG--NIRN 237
           E +   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF +  G  ++R 
Sbjct: 356 EIQFTNTLCGTPSYVAPEVLLKSDYSS-KVDMWSAGVLLYVCLCGFPPFSDSLGPPSMRE 414

Query: 238 LLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287
            +L+ +   F  P  DEI     +LIS +LVVN +ER +  + + HP  +
Sbjct: 415 QILQGKFA-FYSPYWDEIDDSVLHLISNLLVVNASERFSVVETMNHPWFR 463

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 125/257 (48%), Gaps = 17/257 (6%)

Query: 32  VQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIVIMKLLNHANVL 91
           V    +K TG   A+K + K      NV                 RE+ I   L H N+ 
Sbjct: 154 VYCVKHKQTGFICALKAMKKKEIIQYNVEKQ------------FRREVEIQSSLKHPNLT 201

Query: 92  RLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVH 151
           RLY  +     +Y+++EY   GEL+  L   GP  +  A  F  Q+   + Y H+  I+H
Sbjct: 202 RLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIH 261

Query: 152 RDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDV 211
           RD+KPEN+LL  +  +K+ DFG +     +    T CG+  Y +PE++    Y     DV
Sbjct: 262 RDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDN-KVDV 320

Query: 212 WSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNP 271
           W+ GV+ Y LL G  PF E+   +    +K +  +F     D IS +A+++ISK+L   P
Sbjct: 321 WALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKFP----DHISSQARDIISKLLEYEP 376

Query: 272 AERITARDILKHPLLQK 288
             RI  RD+ KHP + K
Sbjct: 377 NARIALRDVKKHPWILK 393

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,990,871
Number of extensions: 4767030
Number of successful extensions: 30025
Number of sequences better than 10.0: 2375
Number of HSP's gapped: 26787
Number of HSP's successfully gapped: 2718
Length of query: 1125
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1005
Effective length of database: 39,721,479
Effective search space: 39920086395
Effective search space used: 39920086395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)