Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E028006.5ON74174137170.0
YPL270W (MDL2)6.5ON77367521600.0
NDAI0I027306.5ON83270521660.0
NCAS0D022106.5ON77368821540.0
Suva_16.356.5ON76768621430.0
Smik_6.4786.5ON77377521430.0
Skud_16.76.5ON77377821370.0
ZYRO0F00396g6.5ON73271820920.0
TDEL0G046606.5ON73966720780.0
CAGL0A01133g6.5ON80171020820.0
Kpol_1045.836.5ON74868920720.0
KAFR0B064806.5ON75173420040.0
TPHA0J002206.5ON74063020020.0
SAKL0E00748g6.5ON77466819920.0
TBLA0A071906.5ON79466719640.0
KLLA0D00748g6.5ON78969819070.0
KLTH0C11616g6.5ON74064819000.0
Kwal_56.223296.5ON77665719030.0
ACR022W6.5ON75467918820.0
Ecym_30076.5ON76960218060.0
NCAS0B087001.67ON71563912721e-165
SAKL0C02244g1.67ON71268012591e-163
Ecym_10721.67ON68365912501e-162
KLLA0C01991g1.67ON70663712501e-162
Kpol_2000.791.67ON70761912491e-161
TPHA0B046201.67ON72059312471e-161
TDEL0C063501.67ON69359512371e-160
NDAI0A005601.67ON71458812241e-158
AFR683C1.67ON67758212011e-155
Kwal_33.133081.67ON70661012031e-155
YLR188W (MDL1)1.67ON69565612011e-154
Skud_12.2531.67ON69266911991e-154
Smik_12.2481.67ON69661911791e-151
ZYRO0F17050g1.67ON71459311761e-151
TBLA0A053001.67ON70759911651e-149
KLTH0F02024g1.67ON73461511621e-148
Suva_10.2841.67ON69358411561e-148
CAGL0E00385g1.67ON60857411081e-142
Kwal_26.94805.20ON7193785015e-53
SAKL0H00968g5.20ON7003754989e-53
KLTH0B09482g5.20ON6943774847e-51
KLLA0A10131g5.20ON7203774761e-49
Kpol_1018.1851.527ON12765104821e-49
TPHA0L022705.20ON7113704723e-49
KNAG0E013205.20ON6953394696e-49
YMR301C (ATM1)5.20ON6903794697e-49
Suva_13.4915.20ON6933764689e-49
KAFR0I025805.20ON7093954681e-48
Skud_13.4755.20ON6913794671e-48
NCAS0D024305.20ON7023954662e-48
YKL209C (STE6)1.527ON12905124714e-48
Smik_13.5185.20ON6873784625e-48
KAFR0E002301.527ON12705214618e-47
AGL335W5.20ON6913954511e-46
Suva_11.111.527ON12905124572e-46
Ecym_56495.20ON6963114502e-46
TDEL0G004305.20ON6963794493e-46
TDEL0F003401.527ON12574144536e-46
TBLA0C070005.20ON7253374451e-45
ZYRO0D07106g5.20ON7093764441e-45
Skud_11.111.527ON12955104474e-45
NCAS0G035101.527ON12885124431e-44
TBLA0B100701.527ON12965044422e-44
SAKL0A10208g1.527ON13105004422e-44
CAGL0M13739g5.20ON7273654362e-44
NDAI0I024405.20ON7303984336e-44
Kpol_513.235.20ON7083684317e-44
KNAG0G001901.527ON12755074351e-43
ZYRO0G02244g1.527ON12734094314e-43
TPHA0O001601.527ON12535084314e-43
AFR432W1.527ON12845014262e-42
NDAI0D015401.527ON12934084154e-41
Smik_11.141.527ON13164124154e-41
KLLA0B14256g1.527ON12715094056e-40
Ecym_36121.527ON13155143961e-38
CAGL0K00363g1.527ON12274023932e-38
Kwal_33.155611.527ON12975133871e-37
KLTH0B01100g1.527ON12985083834e-37
Smik_12.484.52ON15575083612e-34
KNAG0J027304.52ON15375193532e-33
YHL035C (VMR1)4.6ON15925133523e-33
NDAI0B006405.10ON14915103461e-32
TDEL0E056104.52ON15355153407e-32
Skud_7.6145.10ON14775013399e-32
KAFR0B056308.303ON15154863381e-31
SAKL0H00704g5.10ON14395043371e-31
TPHA0C009608.303ON15235253372e-31
Ecym_42658.303ON15054793353e-31
NDAI0J011508.303ON15174893336e-31
YGR281W (YOR1)5.10ON14774963326e-31
Kwal_56.22747na 1ON15383123327e-31
CAGL0E03355g4.52ON15353233318e-31
Suva_7.5775.10ON14785023318e-31
CAGL0G00242g5.10ON14775093301e-30
NCAS0E041605.10ON15065113301e-30
Skud_12.524.52ON15615303301e-30
Smik_4.3808.303ON15165103282e-30
NCAS0B034708.303ON15124823272e-30
Skud_4.3958.303ON15165153264e-30
KLTH0G12716g8.303ON15004903254e-30
SAKL0H16016g8.303ON14994893246e-30
Suva_10.594.52ON15615233221e-29
KAFR0C065105.10ON14575163211e-29
KNAG0K001705.10ON14425243202e-29
KLLA0D04059g4.52ON15685163202e-29
KNAG0E011204.6ON17175303202e-29
Suva_10.60singletonON9903233182e-29
Kpol_1033.288.303ON15315003202e-29
KLTH0C09240gna 1ON15463133192e-29
Smik_16.275.10ON14775053193e-29
TBLA0G007104.6ON16915013175e-29
Kwal_56.238448.303ON14944893165e-29
ZYRO0G07612g4.6ON16955123166e-29
AGR047W8.303ON14924863166e-29
SAKL0H26026g4.6ON16535183167e-29
KLLA0E00529g4.6ON16505183159e-29
KAFR0I013004.52ON15362763149e-29
YDR135C (YCF1)8.303ON15155093141e-28
YLL048C (YBT1)4.6ON16615193131e-28
Suva_2.2978.303ON15165143131e-28
Kpol_1060.75.10ON14605273112e-28
NCAS0J00160singletonON16545043113e-28
YLL015W (BPT1)4.52ON15594973103e-28
ZYRO0G22176g4.52ON15703193086e-28
KNAG0I009908.303ON15354693069e-28
Suva_10.234.6ON16613073061e-27
KAFR0L001904.6ON16532893051e-27
Smik_8.64.6ON15855153051e-27
Skud_8.94.6ON15875123051e-27
CAGL0E03982g4.6ON16592913051e-27
Kpol_311.34.6ON16573033023e-27
CAGL0C03289g4.6ON16485093023e-27
YKR104WsingletonON3062802836e-27
NCAS0C059304.6ON16572382997e-27
KLTH0B00396gsingletonON15072582997e-27
Suva_8.164.6ON15992342988e-27
CAGL0L06402g8.303ON15354742989e-27
KLLA0F20075g8.303ON15164702989e-27
Smik_12.114.6ON16615152989e-27
TPHA0A056205.10ON14775142961e-26
Skud_12.224.6ON16615092962e-26
TBLA0A06840singletonON10582722952e-26
NDAI0H001904.6ON16825172962e-26
Kwal_34.157704.6ON14365142952e-26
SAKL0H23958g4.52ON15582822952e-26
KLTH0H16038g4.6ON16495112933e-26
TDEL0G018504.6ON16423042934e-26
TPHA0F004104.52ON15703472916e-26
TDEL0F043008.303ON15142632916e-26
ZYRO0D06160g8.303ON15254982891e-25
Zrou_YGOB_Anc_5.105.10ON9925142871e-25
KLLA0C14234g5.10ON14545072862e-25
TPHA0K023104.6ON16495032853e-25
TDEL0G003305.10ON14655142844e-25
TPHA0F001804.6ON16462512844e-25
Ecym_84184.6ON16782442835e-25
Kwal_26.95325.10ON14715022827e-25
Skud_18.2singletonON15802872792e-24
KLTH0B09724g5.10ON14865132739e-24
TBLA0C071005.10ON14855052702e-23
AGL346W5.10ON14005112674e-23
Smik_11.367na 2ON15952352666e-23
TBLA0C06400singletonON13775212622e-22
ACL072C4.6ON16272492603e-22
Kpol_YGOB_1041.454.52ON15683262594e-22
Kpol_1041.45singletonOFF15963262585e-22
TBLA0A038008.303ON15465322504e-21
YKR103W (NFT1)na 2ON12182462093e-16
Kpol_175.1singletonON13774522094e-16
Ecym_56605.10ON15363492051e-15
SAKL0D10208g1.366ON7522741772e-12
YPL147W (PXA1)8.661ON8701961744e-12
Suva_16.1638.661ON8701961745e-12
TBLA0D043501.427ON11192761729e-12
Smik_6.3448.661ON8701961711e-11
ZYRO0E08800g3.534ON6102791673e-11
ZYRO0G01144g1.366ON7522721673e-11
Kwal_26.87308.661ON8311971655e-11
Skud_16.1358.661ON8701961655e-11
NDAI0H035701.366ON7552491621e-10
TDEL0B057601.427ON10362321631e-10
KNAG0I005301.427ON10472421621e-10
ACR128C8.661ON8271901612e-10
KNAG0A029808.661ON8711981612e-10
CAGL0K10472g1.366ON7522531602e-10
Ecym_11943.534ON6092231592e-10
Skud_5.1453.534ON6102231592e-10
KAFR0C045401.366ON7522891593e-10
KLLA0F11484g8.661ON8451971593e-10
Ecym_24108.661ON8282441583e-10
YER036C (ARB1)3.534ON6102781573e-10
KLTH0H13442g1.366ON7522321574e-10
Suva_5.1343.534ON6101741565e-10
Smik_5.1593.534ON6102231565e-10
Kpol_1043.431.366ON7522661565e-10
AEL032W1.366ON7532781566e-10
NCAS0E004803.534ON6102231557e-10
NCAS0A085701.427ON10602701567e-10
ZYRO0F07018g8.661ON8612131558e-10
Smik_7.3131.366ON7522771549e-10
TPHA0A023101.366ON7522481541e-09
KLTH0D10890g8.661ON8301981541e-09
SAKL0F01606g3.534ON6081771531e-09
KAFR0A037908.661ON8762021531e-09
NDAI0E012408.661ON8972031531e-09
KLLA0A10857g1.366ON7522281512e-09
TBLA0C012201.366ON7512751512e-09
Kwal_47.191163.534ON6072841512e-09
NDAI0I030203.534ON6092781512e-09
Kpol_1035.328.42ON2802271462e-09
YFR009W (GCN20)1.366ON7522771503e-09
KAFR0J027003.534ON6081741503e-09
Suva_6.841.366ON7522491494e-09
KNAG0C019601.366ON7522341485e-09
ZYRO0E04092g1.427ON10622411486e-09
AGL142CsingletonON14972181486e-09
Kwal_34.162401.366ON7522491468e-09
AFR232C3.534ON6072781459e-09
KAFR0F014601.427ON10572351461e-08
KLLA0D04554g1.427ON10222511461e-08
KAFR0C052205.500ON14992311461e-08
KNAG0B004603.534ON6602231451e-08
TPHA0O010001.427ON10112561451e-08
TPHA0A058903.534ON6102761441e-08
TDEL0D060203.534ON6102261432e-08
CAGL0C02343g3.534ON7202231422e-08
TBLA0I033303.534ON6102231422e-08
KAFR0C05210na 3ON14932391432e-08
Kwal_0.3271.427ON10192321432e-08
TPHA0A008403.133ON13122471433e-08
Ecym_27141.366ON7482671423e-08
KLTH0G01452g3.534ON6072821413e-08
TBLA0D01820singletonON15512181423e-08
KNAG0B038705.500ON15132181424e-08
TBLA0D017805.500ON15952051424e-08
KLLA0A01452g3.534ON6072231395e-08
Kpol_1049.234.6ON110731275e-08
TPHA0D011708.661ON9152061405e-08
TDEL0D023701.366ON7532781396e-08
Skud_6.951.366ON7522771397e-08
NCAS0D005801.366ON7532751388e-08
TDEL0A060708.661ON8721951388e-08
YOL075C3.133ON12942491398e-08
AER190W1.427ON10112401381e-07
Ecym_36043.220ON14742341381e-07
ZYRO0B05588g3.133ON12702351381e-07
TBLA0D025308.42ON2762271331e-07
Suva_15.913.133ON13022911371e-07
CAGL0K12474g8.42ON2941831321e-07
ZYRO0D11880g5.500ON14982261361e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02800
         (741 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...  1436   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   836   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   838   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      834   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   830   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   830   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   827   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   810   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   805   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   806   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   802   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   776   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   775   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   771   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   761   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   739   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   736   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   737   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   729   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   700   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   494   e-165
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   489   e-163
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   486   e-162
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   486   e-162
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   485   e-161
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   484   e-161
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   481   e-160
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   476   e-158
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   467   e-155
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   468   e-155
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   467   e-154
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   466   e-154
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   458   e-151
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   457   e-151
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   453   e-149
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   452   e-148
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   449   e-148
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   431   e-142
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   197   5e-53
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   196   9e-53
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   191   7e-51
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   187   1e-49
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   190   1e-49
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   186   3e-49
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   185   6e-49
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   185   7e-49
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   184   9e-49
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   184   1e-48
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   184   1e-48
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     184   2e-48
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   186   4e-48
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   182   5e-48
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   182   8e-47
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   178   1e-46
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   180   2e-46
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   177   2e-46
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   177   3e-46
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   179   6e-46
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   176   1e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   175   1e-45
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   176   4e-45
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   175   1e-44
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   174   2e-44
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   174   2e-44
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   172   2e-44
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   171   6e-44
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   170   7e-44
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   172   1e-43
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   170   4e-43
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   170   4e-43
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   168   2e-42
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   164   4e-41
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   164   4e-41
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   160   6e-40
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   157   1e-38
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   155   2e-38
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   153   1e-37
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   152   4e-37
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   143   2e-34
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   140   2e-33
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   140   3e-33
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    137   1e-32
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   135   7e-32
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   135   9e-32
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   134   1e-31
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   134   1e-31
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   134   2e-31
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   133   3e-31
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   132   6e-31
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   132   6e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   132   7e-31
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   132   8e-31
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   132   8e-31
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   131   1e-30
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    131   1e-30
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   131   1e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   130   2e-30
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   130   2e-30
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   130   4e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   129   4e-30
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   129   6e-30
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   128   1e-29
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   128   1e-29
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   127   2e-29
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   127   2e-29
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   127   2e-29
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   127   2e-29
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   127   2e-29
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   127   2e-29
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   127   3e-29
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   126   5e-29
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   126   5e-29
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   126   6e-29
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   126   6e-29
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   126   7e-29
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   125   9e-29
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   125   9e-29
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   125   1e-28
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   125   1e-28
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   125   1e-28
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   124   2e-28
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   124   3e-28
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   124   3e-28
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   123   6e-28
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   122   9e-28
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   122   1e-27
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   122   1e-27
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   122   1e-27
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   122   1e-27
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   122   1e-27
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   120   3e-27
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   120   3e-27
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   113   6e-27
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   119   7e-27
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   119   7e-27
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   119   8e-27
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   119   9e-27
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   119   9e-27
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   119   9e-27
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   118   1e-26
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   118   2e-26
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   118   2e-26
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   118   2e-26
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   118   2e-26
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   118   2e-26
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   117   3e-26
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   117   4e-26
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   116   6e-26
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   116   6e-26
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   115   1e-25
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   115   1e-25
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   114   2e-25
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   114   3e-25
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   114   4e-25
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   114   4e-25
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   113   5e-25
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   113   7e-25
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   112   2e-24
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   109   9e-24
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           108   2e-23
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   107   4e-23
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   107   6e-23
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   105   2e-22
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   104   3e-22
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   104   4e-22
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   103   5e-22
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   100   4e-21
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    85   3e-16
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    85   4e-16
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    84   1e-15
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    73   2e-12
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    72   4e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    72   5e-12
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    71   9e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    70   1e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    69   3e-11
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    69   3e-11
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    68   5e-11
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    68   5e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    67   1e-10
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    67   1e-10
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    67   1e-10
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    67   2e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    67   2e-10
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    66   2e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    66   2e-10
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    66   2e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    66   3e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    66   3e-10
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    65   3e-10
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    65   3e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    65   4e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    65   5e-10
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    65   5e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    65   5e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    65   6e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 64   7e-10
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    65   7e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    64   8e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    64   9e-10
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    64   1e-09
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    64   1e-09
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    64   1e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    64   1e-09
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     64   1e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    63   2e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    63   2e-09
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    63   2e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    63   2e-09
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    61   2e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    62   3e-09
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    62   3e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    62   4e-09
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    62   5e-09
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    62   6e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    62   6e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    61   8e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    60   9e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    61   1e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    61   1e-08
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    61   1e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    60   1e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    60   1e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    60   1e-08
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    60   2e-08
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    59   2e-08
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    59   2e-08
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            60   2e-08
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    60   2e-08
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    60   3e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    59   3e-08
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    59   3e-08
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              59   3e-08
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    59   4e-08
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    59   4e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    58   5e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    54   5e-08
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    59   5e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    58   6e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    58   7e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       58   8e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    58   8e-08
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    58   8e-08
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    58   1e-07
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    58   1e-07
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    58   1e-07
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    56   1e-07
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    57   1e-07
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    55   1e-07
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    57   1e-07
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    57   2e-07
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    57   2e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    57   2e-07
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    57   2e-07
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                57   2e-07
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    57   2e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    57   2e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    57   2e-07
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    56   3e-07
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    56   3e-07
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    55   3e-07
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    56   3e-07
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    56   3e-07
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    56   3e-07
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    56   3e-07
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    56   3e-07
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    56   3e-07
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    56   4e-07
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    55   5e-07
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    55   5e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    55   5e-07
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    55   5e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    55   5e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   6e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    55   6e-07
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    55   6e-07
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    55   6e-07
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    55   7e-07
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    55   7e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    55   8e-07
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    55   8e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    55   8e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    54   9e-07
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    55   9e-07
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    54   1e-06
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    54   1e-06
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    54   1e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    53   1e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    54   1e-06
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    54   1e-06
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             54   1e-06
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    53   1e-06
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    54   1e-06
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    54   1e-06
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    54   1e-06
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    54   1e-06
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    54   2e-06
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    54   2e-06
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    54   2e-06
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    54   2e-06
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    54   2e-06
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    54   2e-06
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    54   2e-06
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    54   2e-06
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    54   2e-06
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    53   2e-06
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    53   2e-06
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    53   2e-06
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    53   2e-06
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    53   2e-06
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    53   3e-06
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    53   3e-06
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    53   3e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    53   3e-06
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    53   4e-06
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    53   4e-06
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    52   4e-06
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    52   4e-06
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    52   4e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    52   4e-06
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    52   4e-06
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    52   4e-06
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    52   5e-06
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    52   5e-06
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    52   6e-06
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    52   6e-06
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    52   6e-06
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    52   7e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    52   7e-06
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    50   7e-06
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    51   8e-06
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    52   8e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    51   8e-06
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            51   9e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    51   9e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    51   9e-06
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    51   9e-06
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    51   1e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    51   1e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    51   1e-05
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    51   1e-05
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    51   1e-05
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    50   1e-05
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    50   2e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    50   2e-05
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    50   2e-05
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    50   2e-05
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    50   3e-05
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    50   3e-05
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    49   4e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    48   5e-05
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    48   5e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    49   5e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    49   5e-05
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    49   5e-05
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    48   6e-05
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    49   6e-05
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    49   6e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     49   7e-05
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    48   7e-05
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    47   8e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    48   8e-05
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    48   9e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    48   1e-04
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    48   1e-04
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    48   1e-04
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    47   1e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   1e-04
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    47   1e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    47   1e-04
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    47   1e-04
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    47   1e-04
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    46   2e-04
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    47   2e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    46   2e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    47   2e-04
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    47   2e-04
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    47   2e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    46   2e-04
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    47   2e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    46   3e-04
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    45   3e-04
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    45   6e-04
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    45   6e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   6e-04
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              45   7e-04
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    44   7e-04
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    45   7e-04
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    44   8e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    45   9e-04
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    45   9e-04
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    45   9e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    45   9e-04
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    45   0.001
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    44   0.001
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    44   0.001
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    44   0.001
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    44   0.001
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    44   0.001
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    44   0.001
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.001
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    43   0.001
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    44   0.001
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    44   0.001
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.001
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    44   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    44   0.002
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.002
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    44   0.002
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    44   0.002
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    44   0.002
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    44   0.002
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.002
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    44   0.002
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    44   0.002
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    44   0.002
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.002
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    43   0.003
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    43   0.003
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    43   0.003
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    43   0.003
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    43   0.003
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    43   0.003
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    43   0.004
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    43   0.004
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    43   0.004
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    42   0.004
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    42   0.004
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    42   0.004
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    42   0.004
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    42   0.004
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    42   0.005
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    42   0.005
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.005
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    42   0.006
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    42   0.006
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    42   0.006
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    42   0.006
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    41   0.006
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    42   0.006
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    42   0.006
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    42   0.007
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    42   0.007
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    42   0.007
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    42   0.008
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    42   0.008
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.008
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.008
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    41   0.008
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    42   0.009
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    41   0.009
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    41   0.010
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    41   0.010
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    41   0.010
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          40   0.010
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    41   0.013
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    41   0.013
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    40   0.013
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    41   0.014
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    41   0.014
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    40   0.022
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    40   0.027
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    40   0.031
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    39   0.033
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    40   0.035
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    39   0.037
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    39   0.052
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    39   0.058
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    39   0.060
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    39   0.060
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    39   0.069
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    38   0.088
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    38   0.10 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    38   0.11 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    38   0.12 
TDEL0E00800 Chr5 (165112..165699) [588 bp, 195 aa] {ON}                37   0.12 
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    38   0.13 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.13 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    37   0.21 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.27 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    36   0.30 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.31 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    36   0.45 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    36   0.49 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.56 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    35   0.63 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   0.63 
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    35   0.68 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    35   0.69 
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    35   0.72 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    35   0.81 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.82 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.97 
KAFR0C03280 Chr3 complement(666612..667646) [1035 bp, 344 aa] {O...    33   1.7  
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    33   2.1  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    33   2.4  
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    33   3.4  
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    31   8.6  

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score = 1436 bits (3717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/741 (95%), Positives = 704/741 (95%)

Query: 1   MLKVAPLRLGLLKHTGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVL 60
           MLKVAPLRLGLLKHTGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVL
Sbjct: 1   MLKVAPLRLGLLKHTGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVL 60

Query: 61  YSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGM 120
           YSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGM
Sbjct: 61  YSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGM 120

Query: 121 CIPKVIGTVLDSLKDIQGKEFSELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILS 180
           CIPKVIGTVLDSLKDIQGKEFSELMIWDMSLKHFFY           ANYVRVILLRILS
Sbjct: 121 CIPKVIGTVLDSLKDIQGKEFSELMIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILS 180

Query: 181 ENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIG 240
           ENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIG
Sbjct: 181 ENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIG 240

Query: 241 SAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFN 300
           SAGVGMM              MGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFN
Sbjct: 241 SAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFN 300

Query: 301 GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360
           GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW
Sbjct: 301 GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360

Query: 361 LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTR 420
           LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTR
Sbjct: 361 LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTR 420

Query: 421 GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480
           GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL
Sbjct: 421 GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480

Query: 481 LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540
           LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE
Sbjct: 481 LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540

Query: 541 IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600
           IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS
Sbjct: 541 IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600

Query: 601 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF
Sbjct: 601 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660

Query: 661 ANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAET 720
           ANPA            GNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAET
Sbjct: 661 ANPASELSKLLREKSSGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAET 720

Query: 721 INEVLKDISTEGKPLKIPQNE 741
           INEVLKDISTEGKPLKIPQNE
Sbjct: 721 INEVLKDISTEGKPLKIPQNE 741

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/675 (65%), Positives = 515/675 (76%), Gaps = 24/675 (3%)

Query: 7   LRLGLLKH--TGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVLY--- 61
           LRLG+ ++  + P L K     P  RFR+    + +++        RSP + + ++    
Sbjct: 9   LRLGICRNMLSRPRLAKL----PSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLILQSF 64

Query: 62  ---STDVTPKE--PEKQP-----AVVVHPKPEDE-GTYKDIWRLFLLVKSDWKLLMSALT 110
              S+   P+   P   P     A   H K + +   YKDI RLF+L K DWKLL++A+ 
Sbjct: 65  RCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLLTAIL 124

Query: 111 LLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI--WDMSLKHFFYXXXXXXXXXXXA 168
           LLT+SC IGM IPKVIG VLD+LK   G +F +L I  + + L  F             A
Sbjct: 125 LLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAA 184

Query: 169 NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
           N+ R ILLRILSE +VA+LRANVIK  +HQDA+FFD +KVGDLISR+G+DA++VSRS+TQ
Sbjct: 185 NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ 244

Query: 229 KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVT 288
           K+SDGVKA+  G  GVGMM                 P+L SA VFGKQIR+ SK LQE T
Sbjct: 245 KVSDGVKALICGVVGVGMMCSLSPQLSILLLF-FTPPVLFSASVFGKQIRNTSKDLQEAT 303

Query: 289 ANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGD 348
             LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR IF VGK AAF NAKFFTT S++GD
Sbjct: 304 GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGD 363

Query: 349 LSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFE 408
           LSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAASR+FE
Sbjct: 364 LSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423

Query: 409 LTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
           LTD KP I+PT G K+ P +G  IEFK+VSF+YPTRP+V IF+NLNFKI  GS+VCIVGP
Sbjct: 424 LTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482

Query: 469 SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
           SG+GKSTIA LLL YYNP+ G I ID QDIS L+ KSLRRHIGIVQQEP+LMSGTIRDNI
Sbjct: 483 SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542

Query: 529 TYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIK 588
           TYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT IGPHGTLLSGGQKQRIAIARALIK
Sbjct: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602

Query: 589 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648
           KPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG+DG
Sbjct: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662

Query: 649 SVVEQGKFKELFANP 663
           SVVE GKFKEL+ANP
Sbjct: 663 SVVEMGKFKELYANP 677

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/705 (61%), Positives = 513/705 (72%), Gaps = 35/705 (4%)

Query: 62  STDVTPKEPEKQPAVVVHPKPED------EGTYKDIWRLFLLVKSDWKLLMSALTLLTVS 115
           +TD  P   E   +     +P +      E  +KD++RLFLLVK D+KLL+ +LTLLT+S
Sbjct: 128 TTDTIPPHTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTIS 187

Query: 116 CGIGMCIPKVIGTVLDSLKDIQ-----GKEFSELMIWDMSLKHFFYXXXXXXXXXXXANY 170
           C IGM IPK+IG +LD+LK +      G      +++ ++L  F             ANY
Sbjct: 188 CTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALFIGCAANY 247

Query: 171 VRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKI 230
            R+ILLRILSE LVA+LR+ V+KH +HQD++FFD +KVGDLISR+G D++IVSRSITQKI
Sbjct: 248 GRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKI 307

Query: 231 SDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN 290
           SDGVK++  G  G+GMM              +  P++LSA +FGKQIR NS++LQ+ T  
Sbjct: 308 SDGVKSLICGGVGIGMMLELSMDLSSVLVCFV-IPVVLSASIFGKQIRINSRELQDATGQ 366

Query: 291 LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLS 350
           LTRVSEEQ NG++T+QSFVAEQ E+ +FN SIR+IF VGK AAFINAKFFT+ S++GDLS
Sbjct: 367 LTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLS 426

Query: 351 FLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELT 410
           FL VL YGS+LV    L++GDLTAFMLYTEYTGNAIF LS F+SEIMQGAGAASR+FELT
Sbjct: 427 FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT 486

Query: 411 DLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSG 470
           D  P I PT G  + P KG EIEFKNVSF YPTRP+  IF++LNFKI+ GSNVCIVGPSG
Sbjct: 487 DRVPTIRPTLGKTYTPGKG-EIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545

Query: 471 KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
           KGKSTIA LLLHYYNP+ GQILIDGQDI+ L++KSLRR I +VQQEP+LMSGTIRDNITY
Sbjct: 546 KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605

Query: 531 GLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKP 590
           GLT  PTKEEIR+VAKQCFCHNFI +FP TYDT IGPHGTLLSGGQKQRIAIARALIKKP
Sbjct: 606 GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665

Query: 591 TVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
            +LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN+IVLGNDGSV
Sbjct: 666 NILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725

Query: 651 VEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQT---------------IEE 695
           VE GKFKELFA+P                   +  P   S +               +EE
Sbjct: 726 VEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHHEGTILEE 785

Query: 696 DPS---FSGEATPASSVTGFKAETEAETINEVLKDISTEGKPLKI 737
           D +      EA P    T    +   ++I  VL D+S E KP+K+
Sbjct: 786 DHAQEDHESEAPP----TIITTQQLEDSIESVLNDVSAESKPIKL 826

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/688 (63%), Positives = 519/688 (75%), Gaps = 23/688 (3%)

Query: 60  LYSTDVTPKEPEKQPAVVVHP---KPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSC 116
           L ST  T  +  KQP++  +P     E +  + D+ RLFLLVK+DWKLL+ ALTLLT+SC
Sbjct: 93  LNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISC 152

Query: 117 GIGMCIPKVIGTVLDSLKDIQGKEFSE-------LMIWDMSLKHFFYXXXXXXXXXXXAN 169
            IGM IPKVIG +LDSLK +Q    SE       +M++ +++  F             AN
Sbjct: 153 VIGMMIPKVIGIILDSLK-VQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMAN 211

Query: 170 YVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQK 229
           + R+ILLRILSE LVA+LR+ VIK  IHQDAQF+D +K GDLISR+G DA+IVSRSITQK
Sbjct: 212 FGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQK 271

Query: 230 ISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTA 289
           ISDG K++  G  GVGMM              +  P+++SA +FGKQIR NS++LQ+ T 
Sbjct: 272 ISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLI-IPVVISASIFGKQIRINSRELQDATG 330

Query: 290 NLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL 349
            LTRVSEEQ NG+KT+QSFVAEQ E+ +FN +IR IF VGK +AFINAKFFT+ S++GDL
Sbjct: 331 QLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL 390

Query: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409
           SFL VL YGS+LV    L++GDLTAFMLYTEYTGN+IF LS F+SEIMQGAGAASR+FEL
Sbjct: 391 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450

Query: 410 TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPS 469
           TD  P I PT G  ++P KG EIEFKNVSF+YPTRP   IF+NLNFKIE GSNVCIVGPS
Sbjct: 451 TDYVPEIRPTLGKTYLPGKG-EIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPS 509

Query: 470 GKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT 529
           GKGKSTIA LLLHYYNP+ GQILIDGQDI+ +++KSLRR +GIVQQEP+LMSG+IRDNIT
Sbjct: 510 GKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT 569

Query: 530 YGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589
           YGLTYTPTKEEIR VAKQCFCHNFIT+FP TYDT IGP GTLLSGGQKQRIAIARALIKK
Sbjct: 570 YGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629

Query: 590 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGS 649
           P +LILDEATSALDVESEGAINYTFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLGNDGS
Sbjct: 630 PNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGS 689

Query: 650 VVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSV 709
           V+E GKFKELF++P+              ++  + +   IS   E D   +GE      V
Sbjct: 690 VIEMGKFKELFSDPSSELSKLLNE----KSSRKKTKSDPISSAPEVDADATGEP-----V 740

Query: 710 TGFKAETEAETINEVLKDISTEGKPLKI 737
                  E + ++ VL D+++E KP+K+
Sbjct: 741 EPIDPAIE-DALHSVLNDVTSESKPIKM 767

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/686 (63%), Positives = 515/686 (75%), Gaps = 27/686 (3%)

Query: 72  KQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD 131
           KQPA   +    D+  YKDI RLF+L K DWKLL++A+ LLT+SC IGM IPKVIG VLD
Sbjct: 85  KQPAKPAYQSKSDD--YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLD 142

Query: 132 SLKDIQGKEFSELMI--WDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRA 189
           +LK   G +F +L I  + + L  F             AN+ R ILLRILSE +VA+LRA
Sbjct: 143 TLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRA 202

Query: 190 NVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXX 249
           +VIK  +HQDA+FFD +KVGDLISR+G+DA++VSRS+TQK+SDGVKA+  G  GVGMM  
Sbjct: 203 HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 262

Query: 250 XXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFV 309
                          P+L SA VFGKQIR+ SK LQE T  LTRV+EEQ +GIKT+QSFV
Sbjct: 263 LSPQLSVLLLF-FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 321

Query: 310 AEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSV 369
           AE +E+ ++N +IR IF VGK AAF NAKFFTT S++GDLSFL VL+YGS+LV Q QLS+
Sbjct: 322 AEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSI 381

Query: 370 GDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKG 429
           GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAASR+FELTD KP I+PT G K+ P +G
Sbjct: 382 GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG 441

Query: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
             IEFK+VSF+YPTRP+V IF++LNFKI  GS+VCIVGPSG+GKSTIA LLL YYNP+ G
Sbjct: 442 -VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 500

Query: 490 QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 549
            I+ID QDI+ ++ KSLRRHIGIVQQEP+LMSGTIRDNITYGLTYTPTKEEIRSVAKQCF
Sbjct: 501 TIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 560

Query: 550 CHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 609
           CHNFIT+FP+TYDT IGP+GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA
Sbjct: 561 CHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 620

Query: 610 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXX 669
           INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL++NP      
Sbjct: 621 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQ 680

Query: 670 XXXXXXXGNNAAPEIQPQEISQTIE-EDPSFS------GEATPASS-----------VTG 711
                       P  Q Q++ +  E E+P+         E    S+              
Sbjct: 681 LLNERTA---PVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPLESKD 737

Query: 712 FKAETEAETINEVLKDISTEGKPLKI 737
            K++   E++  VLKD + E  P+K+
Sbjct: 738 KKSDDIEESVEHVLKDAAKEANPIKL 763

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/775 (58%), Positives = 548/775 (70%), Gaps = 53/775 (6%)

Query: 7   LRLGLLKH--TGPSLYKRTFVSPIWRFRA-GSHLNVNRVR-TPLHFVKRSPLIPRRVLYS 62
           LRLGL ++  + P + K     P  RFR+  +H +   +   PLH   RSP+I + ++ S
Sbjct: 9   LRLGLYRNMLSRPRMTKL----PFMRFRSLVTHSSSQLILINPLH--TRSPIIGKTLILS 62

Query: 63  T--DVTPKEPEKQP-----------AVVVHPKPEDE-GTYKDIWRLFLLVKSDWKLLMSA 108
           +   ++ K   + P           +   H   + +   YKDI RLF+L K DWKLL++A
Sbjct: 63  SFRYISSKTKLQAPLPSVSSTSKGSSKSAHSTEQSKTDDYKDIIRLFMLAKRDWKLLLTA 122

Query: 109 LTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI--WDMSLKHFFYXXXXXXXXXX 166
           + LLT+SC IGM IPKVIG VLD+LK   G +F +L I  + + L  F            
Sbjct: 123 ILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGC 182

Query: 167 XANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSI 226
            AN+ R ILLRILSE +VA+LRA+VIK  +HQDA+FFD +KVGDLISR+G+DA++VSRS+
Sbjct: 183 AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242

Query: 227 TQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQE 286
           TQK+SDGVKA+  G  GVGMM                 P+L SA VFGKQIR+ SK LQE
Sbjct: 243 TQKVSDGVKALICGIVGVGMMCSLSPQLSILLLF-FTPPVLFSASVFGKQIRNTSKDLQE 301

Query: 287 VTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASII 346
            T  LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR IF VGK AAF NAKFFTT S++
Sbjct: 302 ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLL 361

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
           GDLSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAASR+
Sbjct: 362 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 421

Query: 407 FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
           FELTD KP I+PT G K+ P +G  IEFK+VSF+YPTRP+V IF++LNFKI  GS+VCIV
Sbjct: 422 FELTDRKPSISPTVGHKYQPERG-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
           GPSG+GKSTIA LLL YYNP+ G I+ID QDI+ L+ KSLRR IGIVQQEP+LMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540

Query: 527 NITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
           NITYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT IGPHGTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 587 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGN 646
           IKKPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG+
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 647 DGSVVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGE---- 702
           DGSVVE GKFKEL+AN                   P  Q  +I +  E++ +  GE    
Sbjct: 661 DGSVVEMGKFKELYANSTSALSQLLNERAA---PGPSDQQLQIEKVEEKEDTNEGEKHDQ 717

Query: 703 -----------------ATPASSVTGFKAETEAETINEVLKDISTEGKPLKI-PQ 739
                               +  V    +E   E++  +LKD + E  P+K+ PQ
Sbjct: 718 QNKQDDDNSHNNHDNDSNNQSLEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQ 772

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/778 (58%), Positives = 546/778 (70%), Gaps = 59/778 (7%)

Query: 7   LRLGLLKHTG--------PSLYKRTFVSPIWRFRAGSHL-NVNR--VRTPLHFVKRSPLI 55
           LRLG+ ++          PS+  R+ V+P     + SHL  +NR  +R+P   V +S L+
Sbjct: 9   LRLGMCRNIMSRPRLAKLPSIKFRSLVTP-----SSSHLIPINRLCIRSPT--VGKSLLL 61

Query: 56  PRRVLYSTDVTP----------KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLL 105
                 S+   P           +   +PA    P+      YKDI RLF+L K DWKLL
Sbjct: 62  QFSRYNSSKTEPVALLSSSSSASKDSVKPAR--PPQRSKTDDYKDIIRLFMLAKRDWKLL 119

Query: 106 MSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI--WDMSLKHFFYXXXXXXX 163
           ++A+ LLT+SC IGM IPKVIG VLD+LK   G +F EL I  + + L  F         
Sbjct: 120 LTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALL 179

Query: 164 XXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVS 223
               AN+ R ILLRILSE +VA+LRA+VIK  +HQDA+FFD +KVGDLISR+G+DA++VS
Sbjct: 180 IGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239

Query: 224 RSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKK 283
           RS+TQK+SDGVKA+  G  GVGMM                 P+L SA VFGKQIR+ SK 
Sbjct: 240 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF-FTPPVLFSASVFGKQIRNTSKD 298

Query: 284 LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343
           LQE T  LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR IF VGK AAF NAKFFTT 
Sbjct: 299 LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTT 358

Query: 344 SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
           S++GDLSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAA
Sbjct: 359 SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418

Query: 404 SRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463
           SR+FELTD KP I+PT G K+ P +G  +EFK+VSF+YPTRP+V IF+NLNFKI  GS+V
Sbjct: 419 SRLFELTDRKPSISPTAGHKYKPHRG-VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSV 477

Query: 464 CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
           CIVGPSG+GKSTIA LLL YYNPS G I+ID QDI+ ++ KSLRRHIGIVQQEP+LMSGT
Sbjct: 478 CIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGT 537

Query: 524 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIA 583
           IRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT IG  GTLLSGGQKQRIAIA
Sbjct: 538 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIA 597

Query: 584 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 643
           RALIKKPT+LILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIV
Sbjct: 598 RALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIV 657

Query: 644 LGNDGSVVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEA 703
           LG+DGSVVE GKFK+L+ANP                  P  Q Q+I +  E + S   +A
Sbjct: 658 LGHDGSVVEMGKFKKLYANPTSALSQLLNERAA---PGPSDQQQQIEKDNENEESTEEKA 714

Query: 704 ---------------------TPASSVTGFKAETEAETINEVLKDISTEGKPLKI-PQ 739
                                  +  VT   ++   E++  +L+D + E  P+K+ PQ
Sbjct: 715 PDHSNKNDNDDNDNNHDNDSNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQ 772

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/718 (57%), Positives = 525/718 (73%), Gaps = 40/718 (5%)

Query: 45  PLHFVK-RSPLIPRR--VLYSTDVTPKEPEKQPAVV---VHPKPEDEGTYKDIWRLFLLV 98
           PL+ V+ +  LI  R  V +++ ++P + E +P  V   + P  + E +YKD  RLF L 
Sbjct: 28  PLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLA 87

Query: 99  KSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSL-KDIQGKEFSELMIWDM-------S 150
           K DW+LL +A+ LLT+SC IGM IPKVIG VLD L K I+GK+   + + D+       +
Sbjct: 88  KRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLT 147

Query: 151 LKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGD 210
           +  F             AN+ R+++LRILSE +VA+LR+ V+   +HQD++F+DT+KVGD
Sbjct: 148 IYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGD 207

Query: 211 LISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSA 270
           LISR+G+DA++VSRS+TQK+SDG KA+  G  G+GMM                 P+L SA
Sbjct: 208 LISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLF-FAPPILWSA 266

Query: 271 KVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGK 330
            VFGK+IR  SK LQE T  LTRV+EEQ +G+KT+QSFVAEQ E+H++NG+IR I+ VG+
Sbjct: 267 SVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGR 326

Query: 331 EAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLS 390
           +AAFINA+FFT+ +++GD+SF+VVL YGS+LV Q  L++GDLTAFMLYTEYTG+++F L+
Sbjct: 327 KAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLT 386

Query: 391 GFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIF 450
            F+SE+MQG GAASR+F+LTD    I+PT+G K+IP KG +IEFKNVSF+YPTRP   IF
Sbjct: 387 TFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKG-DIEFKNVSFSYPTRPENQIF 445

Query: 451 RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
           +++N K+  GSNVCIVGPSG+GKSTIA LLL YYNP+ GQIL+DGQDIS ++ K+LRRHI
Sbjct: 446 KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505

Query: 511 GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
           G+VQQEPILMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT+FPD YDT IG  G 
Sbjct: 506 GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565

Query: 571 LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           LLSGGQ+QRIAIARALIKKP +L+LDEATSALDVESEGAINYTFGQLMKS SMTIVSIAH
Sbjct: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625

Query: 631 RLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAX---XXXXXXXXXXXGNNAAPEIQP- 686
           RLSTI+RSENVIVLG DGSV+E GKFKELFANP                GN++ P   P 
Sbjct: 626 RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPN 685

Query: 687 -------QEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDISTEGKPLKI 737
                  ++I++ I E    +G++  A             T+ E+ KD+S+EGKP+KI
Sbjct: 686 ATQDKVVEQIAEKILERFPEAGQSPDA-------------TVKEIFKDVSSEGKPIKI 730

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/667 (61%), Positives = 496/667 (74%), Gaps = 26/667 (3%)

Query: 83  EDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFS 142
           E +   KD+ RL +L K DWKLL+ A+TLLTVSCGIGM IPKVIG +LD LK   G E +
Sbjct: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLK--TGLETN 143

Query: 143 E-----LMIWDM-------SLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRAN 190
           E     + + D+       S+  F             ANY R++LLRILSE +VA+LRAN
Sbjct: 144 EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203

Query: 191 VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXX 250
           VIK  IHQD++FFD +KVGDLISR+G+DA++VSRS+TQK+SDG KA+  G  GVGMM   
Sbjct: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSI 263

Query: 251 XXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVA 310
                         P+L SA +FG++IRD S  LQE T  LTRVSEEQ +G++T+QSFVA
Sbjct: 264 SPQLSGLLLL-FTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVA 322

Query: 311 EQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVG 370
           EQ E+H+++ +IR IF VGK AA+INA+FFT  S +GD+SFLVVL+YGS+LV Q  L++G
Sbjct: 323 EQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382

Query: 371 DLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG 430
           DLTAFMLYTEYTG+++F L+ F+SE+MQG GAA+R+FELTD  P I PT G KF+P KG 
Sbjct: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKG- 441

Query: 431 EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQ 490
           EI FK+V+F+YPTRP   IFR+++ KI  GSNVC+VGPSG+GKSTIA LLL +YNPS GQ
Sbjct: 442 EIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQ 501

Query: 491 ILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 550
           I IDGQDIS L+ KSLRRHIG+VQQEP+LMSGT+RDNITYGLT TP+KEEIR VAKQCFC
Sbjct: 502 IFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFC 561

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
           HNFI +FP  YDT IGP G LLSGGQKQRIAIARALIKKPT+L+LDEATSALDVESEGAI
Sbjct: 562 HNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAI 621

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXX 670
           NYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLGNDGSVVE GKFKELFA+P+      
Sbjct: 622 NYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKL 681

Query: 671 XXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDIST 730
                  +  +        S+  E+      EA   ++      E   +++ E+LKD++ 
Sbjct: 682 LNEKSSRSENSSSSYSPNASEQPED------EANQKNA----PEEAHDDSVEEILKDVTA 731

Query: 731 EGKPLKI 737
           EGKP+KI
Sbjct: 732 EGKPIKI 738

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/710 (59%), Positives = 513/710 (72%), Gaps = 48/710 (6%)

Query: 68  KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIG 127
           KE E+Q         E+   ++DI RL LLV+ DWKLL++A+ LLT+SC IGM IPKVIG
Sbjct: 102 KEKEEQSET-----KENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIG 156

Query: 128 TVLDSLKD------IQGKEFS----ELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLR 177
            +LD LK+      + G+  S      +++ +S   F             ANY R+ILLR
Sbjct: 157 LILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLR 216

Query: 178 ILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAV 237
           +LSE LVA+LRA VIK  IHQDA+FFDT+KVGDLISR+G+DA++VSRS+TQK+SDG KA+
Sbjct: 217 VLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL 276

Query: 238 FIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEE 297
             GS G+GMM                 P++LSA VFGKQI   S++LQE T +LT+V+EE
Sbjct: 277 ICGSVGIGMMLALSPQLSCLLLV-FTPPVILSASVFGKQISTTSRELQEATGHLTKVAEE 335

Query: 298 QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSY 357
           Q +GIKT+QSFVAEQ E++++N +IR IF +GK+AA INAKFF++ S +GDLSFL VL +
Sbjct: 336 QLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGF 395

Query: 358 GSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRIN 417
           GS+LV Q  L++GDLTAFM+YTEYTGN+IF LS F+SEIMQGAGAASR+FELTD  P I+
Sbjct: 396 GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIS 455

Query: 418 PTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIA 477
            T+G K+ P  G EIEFKNVSF YPTRP+  IF+NLNFKIE GSNVCIVGPSG+GKST+A
Sbjct: 456 TTKGVKYKPGNG-EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVA 514

Query: 478 WLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPT 537
            LL  YY PS G+ILIDGQ+I+ L++KSLRRHIG+VQQEPILMSGTIRDNI YGLT  PT
Sbjct: 515 LLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPT 574

Query: 538 KEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDE 597
           K+EIR VAKQCFCHNFITRF  +YDT IGPHGTLLSGGQKQRIAIARALIKKP +LILDE
Sbjct: 575 KDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDE 634

Query: 598 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFK 657
           ATSALDVESEGAINYTFGQLMK K MTIVSIAHRLSTIRRSENVIVLG+DGSVVE GKFK
Sbjct: 635 ATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 694

Query: 658 ELFANPAXXXXXXXXXXXXGN---NAAPEIQPQEIS-------------QTIEEDPSFSG 701
           EL+ +P              +   N      P  ++             +T+ EDP    
Sbjct: 695 ELWDDPTSELSQLLNEKSTPHQTTNITVTPPPTTMAEKVVEEVVENAEPETVIEDP---- 750

Query: 702 EATPA---SSVTGFKAETE-------AETINEVLKDISTEGKPLKIPQNE 741
             +P    S+V+   AE          +TI  V+KD+++E KPLK+ ++E
Sbjct: 751 -GSPPMYISTVSEVSAEGHELINEQIEDTIENVMKDVTSERKPLKLQKDE 799

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/689 (58%), Positives = 508/689 (73%), Gaps = 23/689 (3%)

Query: 55  IPRRVLYSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTV 114
           IP +   ST+   +E              D+    D+ RL  L K DWKLL++A++LL+V
Sbjct: 71  IPSKRFNSTNTKEQESSTHT-----DGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSV 125

Query: 115 SCGIGMCIPKVIGTVLDSLKDIQGK-EFS----ELMIWDMSLKHFFYXXXXXXXXXXXAN 169
           SC IGM +PK+IG VLD LK I    +F+      + + ++L  F             AN
Sbjct: 126 SCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAAN 185

Query: 170 YVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQK 229
           Y RVILLR+LSE +VA+LRANVIK  +HQDA+FFD  KVGDLISR+ +DA++VSRS+TQK
Sbjct: 186 YGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQK 245

Query: 230 ISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTA 289
           +SDG KA+  GS G+GMM              +  P++LSA  FG+ IR+NS+ LQE T 
Sbjct: 246 VSDGFKAMLCGSVGIGMMISISPQLSAFLLF-LTPPVMLSASYFGRLIRNNSRDLQEATG 304

Query: 290 NLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL 349
           +LT+V+EEQF+GIKT+QSFVAEQ E+ ++N +IR IF VGK++AFINAKFF+  +++GD+
Sbjct: 305 SLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDM 364

Query: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409
           SFLVVL+YGS+LV    LS+GDLTA+M+YTEYTG++IF LS F+SEIMQGAGAASR+FEL
Sbjct: 365 SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL 424

Query: 410 TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPS 469
           TD  P I+PT G KF+P KG EIEFKNVSF+YPTR +  IF+NL+FKI+ GSNVCIVGPS
Sbjct: 425 TDRIPSISPTLGKKFVPNKG-EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPS 483

Query: 470 GKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT 529
           G+GKSTIA LLL YYNP+ GQI +DGQDIS +S+KSLRRH+ IVQQEP+LMSGTIRDNIT
Sbjct: 484 GRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT 543

Query: 530 YGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589
           YGL   PT++E+RS+ K+CFCHNFIT+FP++YDT +GPHGTLLSGGQKQRIAIARALIKK
Sbjct: 544 YGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKK 603

Query: 590 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGS 649
           PT+LILDEATSALDVESEGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLGNDGS
Sbjct: 604 PTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGS 663

Query: 650 VVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFS---GEATPA 706
           V E GKFKEL+A+P                A    + Q  ++  E DP  +     +TP 
Sbjct: 664 VAEVGKFKELYADPGSELSKLLH-----EKATRSERQQNTAEDQEIDPEETINIENSTPE 718

Query: 707 SSVTGFKAETEAETINEVLKDISTEGKPL 735
           S +T    E     I E + D++ + KP+
Sbjct: 719 SDIT---QELLENPIKEAIMDVAADNKPI 744

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/734 (57%), Positives = 519/734 (70%), Gaps = 31/734 (4%)

Query: 33  AGSHLNVNRVRTPLHFVKRSPLI-----PRRVLYSTDVTPKEPEKQPAVVVHPKP----- 82
           AGS+L +      L + + SP       P R L     T   P   P  +V  +      
Sbjct: 17  AGSNLRIIPSIRLLSYSRPSPFPSNSPRPTRCLTVPSRTNFIPRTLPQFLVPHRTLKTAS 76

Query: 83  -EDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGK-- 139
            ++  +++D+ RL +L+K D KLL+ A+ LLT+SC IGM IPK+IGT+LD+L++      
Sbjct: 77  TDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYENLT 136

Query: 140 EFSELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQD 199
             S++ I ++ L  F             AN+ RV++LRI+SE LV++LR+ V+K+IIH+D
Sbjct: 137 SLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKD 196

Query: 200 AQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXX 259
            +FFDT+KVGDL+SRVGNDAF+VSRSIT K++DGV++ FIG  G+G+M            
Sbjct: 197 LEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGALF 256

Query: 260 XXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFN 319
             +  P++    VFGKQIR NSKKLQ+VT +LTRV+EEQFNGI+T+Q FVAE++E+ +FN
Sbjct: 257 AIL-PPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFN 315

Query: 320 GSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYT 379
             +R+IF VGKE+AFIN KFFT+AS+IGDL FL+VL+YGS+LV    +S+GDLTAFMLYT
Sbjct: 316 NVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYT 375

Query: 380 EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRG-SKFIPAK---GGEIEFK 435
           EYTGNAIF LS F+SE+MQG GAASRIFE+ D +P+I  T G +KF P     G EIEFK
Sbjct: 376 EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435

Query: 436 NVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
           NVSF YPTRPT  IF+NLNFK+  GSNVCIVGPSG+GKSTIA LLLH+YN   GQILIDG
Sbjct: 436 NVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG 495

Query: 496 QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 555
           QDI+ L+TKSLRR IGIVQQEPILMSGTIRDNITYGLT  P+KEEIR VAKQCFCHNFIT
Sbjct: 496 QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFIT 555

Query: 556 RFPDTYD--TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYT 613
           +FPDTYD     G  GT LSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT
Sbjct: 556 KFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615

Query: 614 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXXXX 673
           FGQ+MKSKSMTIVSIAHRLSTIRR E+VIVLGNDGSVVE GKFKEL+ NP          
Sbjct: 616 FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNE 675

Query: 674 XXXGNNAAPE-IQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETI---------NE 723
                 A P+ + P      ++ +P    EA  AS   G K +   E +         ++
Sbjct: 676 KSSTKEATPQPVNPPPFID-LQTNPEEKKEADNASEENGAKLDDSKEDVSVPDNMTSSDD 734

Query: 724 VLKDISTEGKPLKI 737
            LK+   EG P+KI
Sbjct: 735 SLKEAVNEGGPIKI 748

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/630 (63%), Positives = 466/630 (73%), Gaps = 20/630 (3%)

Query: 74  PAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSL 133
           P V V PK  ++G   DI RL  L K DWKLL  A+ LLTVSC IGM +PKVIG VLD L
Sbjct: 63  PQVRV-PKSRNDGN--DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLL 119

Query: 134 KDIQGK-------------EFSEL--MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRI 178
           K+   K             E SEL  + + +SL  F             AN+ RV+LLR+
Sbjct: 120 KNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRV 179

Query: 179 LSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVF 238
           LSE +VA+LR+ VIK  IHQDA+FFD  KVGDLISR+G+DA++VSRS+TQK+SDG KA+ 
Sbjct: 180 LSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALL 239

Query: 239 IGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQ 298
            G  GVGMM                 P++LS+  FG+ IRDNS+KLQE T  LTRVSEEQ
Sbjct: 240 CGGVGVGMMVSISPELSAFLLF-FTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQ 298

Query: 299 FNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358
           F+G+KT+Q+FVAEQ E+ ++N  I+ ++ VGKE+AFINAK FT  S +GD+SFL+VL+YG
Sbjct: 299 FSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYG 358

Query: 359 SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP 418
           S+LV    LS+GDLTA+M+YTE TG+A+F LS F+SEIMQG GAASR+FELTD  P I+P
Sbjct: 359 SYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISP 418

Query: 419 TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
           T G K+IP KG EIEFKNVSF YPTRP   IF++LNFKIE GSNVCIVGPSG+GKSTIA 
Sbjct: 419 TTGKKYIPGKG-EIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIAS 477

Query: 479 LLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538
           LLL YY P+ G I +DGQDIS L++KSLRRHIGIVQQEPILMSG+IRDNITYGLTY  T 
Sbjct: 478 LLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATA 537

Query: 539 EEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEA 598
           EEIR V KQCFCHNFIT+FPD Y T +GP+GTLLSGGQKQRIAIARAL+KKP VLILDEA
Sbjct: 538 EEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEA 597

Query: 599 TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
           TSALDVESE AINYTFG+LMK K +TI+SIAHRLSTIRRSE VIVLGNDGSVVE GKFK 
Sbjct: 598 TSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKT 657

Query: 659 LFANPAXXXXXXXXXXXXGNNAAPEIQPQE 688
           LF NP              N   P  +P E
Sbjct: 658 LFGNPLSELSQLLNEKSTINERNPNEKPAE 687

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/668 (58%), Positives = 488/668 (73%), Gaps = 24/668 (3%)

Query: 81  KPEDEGT-------YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSL 133
           K E E T       YK+I+RLF L + DWKLL+ A++LLT+SC IGM +PKVIG VLD  
Sbjct: 110 KKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVA 169

Query: 134 K-----DIQGKEFSEL--MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAK 186
           K     D + K+  +L  ++W + L  F             AN+ RV+LLRIL E LVA+
Sbjct: 170 KNAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVAR 229

Query: 187 LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
           LR+NVIK  IHQDA+FFD  KVGDLISR+ +DA++VSRS+TQ ISDG KA+  G  G+GM
Sbjct: 230 LRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGM 289

Query: 247 MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQ 306
           M                 PLL+ A ++G++IR  S+ LQ+ T NLT+V+EEQ +G+KT+Q
Sbjct: 290 MFHISSTLATALFL-FAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQ 348

Query: 307 SFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQ 366
           SFVAEQ E+ ++N +IRK+F VGK  A  NA FF++ S++GD SFL+VL+YGS LV Q  
Sbjct: 349 SFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGS 408

Query: 367 LSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIP 426
           LS+GDLTAFMLYTEY+G+A+F LS F+SE+M+GAGAASR+FELTD +P I  T+G  ++P
Sbjct: 409 LSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVP 468

Query: 427 AKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNP 486
            KG EI+F+NVSF+YPTR    IF NLNF I+ GSNVC+VGPSG+GKSTIA LLL YYNP
Sbjct: 469 GKG-EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527

Query: 487 SQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK 546
           + G+I IDGQDIS +S KSLRRH+G+VQQEPILMSG+IRDNITYG+ YTPT +EIRSV+K
Sbjct: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587

Query: 547 QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
           +CFCHNFIT+F D Y+T IGP G LLSGGQKQRIAIARALIKKP +LILDEATSALDVES
Sbjct: 588 KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647

Query: 607 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXX 666
           EGAINYT GQLMKS+ +TI+SIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL+A+    
Sbjct: 648 EGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESK 707

Query: 667 XXXXXXXXXXGNNAAPEIQPQEISQTIEE-DPSFSGEATPASSVTGFKAETEAETINEVL 725
                      N  A +   +  ++T+E+ DPS   E          +   E + +N+VL
Sbjct: 708 LYKLL------NEKAKDTTSKMNAETVEKNDPSPKTEKLNDEEKEE-QRRIEEQVLNQVL 760

Query: 726 KDISTEGK 733
            D++ + K
Sbjct: 761 DDMNYDQK 768

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/667 (59%), Positives = 484/667 (72%), Gaps = 19/667 (2%)

Query: 80  PKPEDEGTYK-DIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQG 138
           P+ EDE   + ++ RL L+   DWKLL+ A+TLLT+SC IGM IPKVIG VLD+LK++  
Sbjct: 136 PRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMT 195

Query: 139 KEFSELMIWDM-------SLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANV 191
              S L   D+       +L  F              NY R ILLR+LSE +VA+LR++V
Sbjct: 196 DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHV 255

Query: 192 IKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXX 251
           IK  +HQDA+FFD  KVGDLISR+G+DA++VSRS+TQK+SDG KA+  G AG+GMM    
Sbjct: 256 IKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISIS 315

Query: 252 XXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAE 311
                         +++SA +FGK+IRD S  LQE T  LTRVSEEQ NG+KT+QSFVAE
Sbjct: 316 PQLSSFLVI-FAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374

Query: 312 QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGD 371
           Q E+ ++N +IR I+ +GK +A +N+KF T+ S+IGD+SFLVVL+YGS+LV    L++GD
Sbjct: 375 QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGD 434

Query: 372 LTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGE 431
           LTAFMLYT+YT N+IF LS F+SEIMQG GAA R+F+LTD  P I PT G KFIP  G  
Sbjct: 435 LTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGC- 493

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           IEF+N+ F YPTRP   +F+NLNFKIE G++VCIVGPSG+GKSTIA LLL YYNPS GQI
Sbjct: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 551
           LID QDI  L+ KSLR+++GIVQQEP+LMSG+IRDNITYGL    T +EIR V+KQCFCH
Sbjct: 554 LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCH 613

Query: 552 NFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611
           NFIT+FPD Y+T IGPHGTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAIN
Sbjct: 614 NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673

Query: 612 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP-AXXXXXX 670
           YTFG+LMKSKS+TIVSIAHRLSTIRRSE +IVLGNDGSVVE GKFKEL+A+P +      
Sbjct: 674 YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733

Query: 671 XXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDIST 730
                  N     + PQ   +  ++   F G  TPAS             + +VLK++S 
Sbjct: 734 NEKQSRANKKEAPLPPQSDGENGDD---FEGNGTPAS-----PPSLHNNLVTDVLKEVSD 785

Query: 731 EGKPLKI 737
           +  PLKI
Sbjct: 786 DSSPLKI 792

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/698 (54%), Positives = 487/698 (69%), Gaps = 36/698 (5%)

Query: 64  DVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIP 123
           D TP +   +P+  V       G   D+ RLF L + DWK+L+ A++LLTVSC IGM +P
Sbjct: 94  DKTPDKKTNKPSSTV------SGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVP 147

Query: 124 KVIGTVLDS----------------LKDIQGKEFSEL--MIWDMSLKHFFYXXXXXXXXX 165
           KVIG VLD+                L+D +     +L  ++ D+ L  FF          
Sbjct: 148 KVIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIG 207

Query: 166 XXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRS 225
             AN+ RV+LL+IL E LVA+LR+NVIK  +H D +F+D  KVGDL+SR+G DA+IVSRS
Sbjct: 208 TMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRS 267

Query: 226 ITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQ 285
           +TQ ISDG KA+  G  G+GMM                 PLL+ A ++G +IR  S++LQ
Sbjct: 268 MTQNISDGFKALICGGVGIGMMFHISSTLASVLFL-FAPPLLVGATIYGNKIRAISRELQ 326

Query: 286 EVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASI 345
           + + NLT+V+EEQ +GIKT+QSFVAE  E+H++N ++R++F VGK+ AF NA FF++ ++
Sbjct: 327 QASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNV 386

Query: 346 IGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASR 405
           +GD SFL+VL+YGS LV Q  L++GDLTAFMLYTEYTG+A+F LS F+SE+M+GAGAA+R
Sbjct: 387 LGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATR 446

Query: 406 IFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           +FEL D KP I  T G  F P  G ++EF++VSF+YPTR T  IF++LNF IE GSNVCI
Sbjct: 447 LFELLDYKPTIKSTTGKAFKPLNG-KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           VGPSG+GKSTIA LLL YYNP+ G+IL+DGQDI+ LS+KSLRR +G+VQQEPILMSGTIR
Sbjct: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           +NITYG++  P+ EEIRSVAK+CFCH FI++FP+ Y+T IGP G LLSGGQKQRIAIARA
Sbjct: 566 ENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
           L+ KP +LILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG
Sbjct: 626 LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685

Query: 646 NDGSVVEQGKFKELFANPAXXXXXXXXXXXXGNN------AAPEIQPQEISQTIEEDPSF 699
            DGSVVE GKFK+L+AN                +      A P I  +   QT E     
Sbjct: 686 IDGSVVEMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAITQESEPQTEENGKDD 745

Query: 700 SGEATPASSVTGFKAETEA----ETINEVLKDISTEGK 733
           SGE   +      + + E     E I++VL+DIS + K
Sbjct: 746 SGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQK 783

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/648 (57%), Positives = 472/648 (72%), Gaps = 18/648 (2%)

Query: 30  RFRAGSHLNVNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEKQPAVVVHPKPEDEGT-- 87
           R+   +H  +  ++ P     R+P+    + Y +  +P       +     K  +E T  
Sbjct: 41  RYHGATHRPLGLLQRPTQLDLRNPVSSSFIRYHSQNSPNSSTPSSSNDSGGKANNESTEE 100

Query: 88  -----YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFS 142
                Y++I RL  L + DWKLL  A+ LLT+S  +GM IPKVIG VLD++K+  G  FS
Sbjct: 101 KSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGG-FS 159

Query: 143 ELM--------IWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKH 194
             M        I+ + +  F             AN+ R++LLR+L E LVA+LR+NVIK 
Sbjct: 160 GPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKK 219

Query: 195 IIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXX 254
           IIHQDA+FFD  KVGDLISR+ +DA++VSRS+TQ +SDG KA+  G  G+GMM       
Sbjct: 220 IIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASL 279

Query: 255 XXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSE 314
                     PLL+ A ++GK+IR  S++LQE T NLT+VSEEQ +G+KTIQ+FVAE  E
Sbjct: 280 TSALFL-FAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338

Query: 315 MHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA 374
           +H++N +IRK+F+ GK+ A  NA FF++  I+GDLSFL+VL+YGS LV Q  LSVGDLTA
Sbjct: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398

Query: 375 FMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEF 434
           FMLYTEYTG+A+F LS F+SE+M+GAGAASR+FE+TD   +I P+ G  ++P+  GEI+F
Sbjct: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS-WGEIKF 457

Query: 435 KNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
           ++VSF+YPTRP   IF  LNF IE GSNVC+VGPSG+GKSTIA LLL YY+P+ G+I+ID
Sbjct: 458 EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517

Query: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554
           GQ+IS LS KSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FI
Sbjct: 518 GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577

Query: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF 614
           T+FP+ Y+T IGP G  LSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT 
Sbjct: 578 TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637

Query: 615 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
           G+LM+S+ +TI+SIAHRLSTIRRSENVIVLGNDGSVVE GKFKEL+AN
Sbjct: 638 GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAN 685

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/657 (57%), Positives = 470/657 (71%), Gaps = 14/657 (2%)

Query: 14  HTGPSLYKRTFVSPIWRFRAGSH-LNVNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEK 72
           H   S   RT    I   R  +H L ++  RT    ++ + L  ++ + S   TP + E 
Sbjct: 68  HCQASHTNRTLTPRIQETRFETHSLRLSVPRT----LQLTRLYSQKTVESQAKTPADKES 123

Query: 73  QPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDS 132
           Q +  +  +      YK++ RLF L   DWKLL  A+ LL +S  IGM IPKVIG VLD+
Sbjct: 124 QKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDA 183

Query: 133 LKDIQGKEFSEL-------MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVA 185
           +K+        +       ++ D+S+  F             AN+ R++LLR+L E LVA
Sbjct: 184 IKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVA 243

Query: 186 KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
           +LR+NVI+ IIHQDA+FFD  KVGDLISR+ +DA++VSRS+TQ +SDG KA+  G  G+G
Sbjct: 244 RLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIG 303

Query: 246 MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTI 305
           MM                 PLL+ A ++GK+IR  S+ LQE T NLTRVSEEQ +G+KTI
Sbjct: 304 MMVNISISLTSALLM-FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTI 362

Query: 306 QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
           QSFVAE  E+ ++N +IRK+F  GK+ A  NA FF++ +++GDLSFL+VL+YGS LV Q 
Sbjct: 363 QSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQG 422

Query: 366 QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFI 425
            L+VGDLTAFMLYTEYTG+A+F LS F+SE+M+GAGAASR+FE+TD  P I PT G  ++
Sbjct: 423 GLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYV 482

Query: 426 PAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
           P  G +I FK+VSF+YPTRP   IF  LNF IE GSNVCIVGPSG+GKSTI  LLL YYN
Sbjct: 483 PGSG-KISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYN 541

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           PS GQI ID QDIS LS KSLRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVA
Sbjct: 542 PSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVA 601

Query: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
           K+CFCH F+T+FP+ YDT IGP G  LSGGQKQRIAIARAL+KKP +LILDEATSALDVE
Sbjct: 602 KKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVE 661

Query: 606 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
           SEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLGNDGSVVE GKFK+L+A+
Sbjct: 662 SEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD 718

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/679 (55%), Positives = 476/679 (70%), Gaps = 19/679 (2%)

Query: 68  KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIG 127
           ++ EK+PA     +P     + +++RL  LVK DWKLL++AL LLT+SC IGM +PKVIG
Sbjct: 83  RKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIG 142

Query: 128 TVLDSLKDI--------QGKEFSEL----MIWDMSLKHFFYXXXXXXXXXXXANYVRVIL 175
            VLD+ KD          G   S L    +I + +L                AN+ R+ L
Sbjct: 143 LVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFL 202

Query: 176 LRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
           L++L E LVA+LRA VIK  +H DA+FFD  KVGDLISR+G+DA+IVSRS+T  ISDGVK
Sbjct: 203 LKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVK 262

Query: 236 AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS 295
           A   G  GVGMM                 PLL++A ++GK+IR  S++LQ+ T NLTRVS
Sbjct: 263 AALCGGVGVGMMFHISSTLTSAMIM-FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321

Query: 296 EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVL 355
           EEQFNGIKTI+SFVAE  EM ++N ++R++F V K     +A FF+  +++GD+SFL+VL
Sbjct: 322 EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVL 381

Query: 356 SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR 415
           +YGS LV Q +LS+G LTAFMLYTEYTG+++F LS F+SE+M+GAGAASR+FELTD K  
Sbjct: 382 AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441

Query: 416 INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKST 475
           +  T G  F+P + G IEFK+VSF+YPTRPT  IF+ L   I  GSNVCIVGPSG+GKST
Sbjct: 442 VPSTVGQTFVP-RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500

Query: 476 IAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
           IA LLL +Y+ + G ILIDGQDIS +S KSLR+H+G+VQQEP+LMSGTIRDNITYGL+YT
Sbjct: 501 IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560

Query: 536 PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595
           P+ +EIR+VAK+CFCHNFIT+FPD YDT IGP G LLSGGQ+QRIAIARALIKKP +LIL
Sbjct: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620

Query: 596 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
           DEATSALDVESEGAINYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLGNDGSV+E GK
Sbjct: 621 DEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680

Query: 656 FKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAE 715
           F +L+ +                +A+   +P+      +E+ S    A     + G    
Sbjct: 681 FADLYRD-----EDSELFKLLNEHASEPAKPEASPAPAQEEASAPQAADIPRDIEGGNLR 735

Query: 716 TEAETINEVLKDISTEGKP 734
              E I  VL+D +    P
Sbjct: 736 LNEEVIKHVLEDTARAPMP 754

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/602 (57%), Positives = 440/602 (73%), Gaps = 29/602 (4%)

Query: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLK------------D 135
           ++++ RL  L K DWKLL  A+ LL+VSC IGM +PKVIG VLD+ K            D
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 136 IQG-KEFSELMI--------------WDMSLKHFFYXXXXXXXXXXXANYVRVILLRILS 180
           ++G  E  E +I                +S+  F             AN+ RV+LL+I+ 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 181 ENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIG 240
           E LV++LR+ VIK  +H D +FFD  KVGDLISR G+DA++VSRS+TQ +SDG KA+  G
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 241 SAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFN 300
             G+GMM                 PLL+ A ++GK+I   S++LQ+ + NLTRV+EEQ N
Sbjct: 277 GVGMGMMFHISSTLTSVMLL-FAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335

Query: 301 GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360
           GI+TI+SFVAE+ E+ ++N +IR++F VGK  AF NA FF++ +I+GD+SF++VL YG+ 
Sbjct: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGAN 395

Query: 361 LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTR 420
           LV Q  LS+GDLTAFMLYTEYTG+++F LS F+SE+M+GAGAASR+FEL D K  +    
Sbjct: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455

Query: 421 GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480
                P +G +IEF++VSF+YPTRP+  IF++++F IE GSNVCIVGPSGKGKSTI  LL
Sbjct: 456 SHALTPTQG-KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLL 514

Query: 481 LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540
           L +Y+P+ G ILID  DIS  +TKSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +E
Sbjct: 515 LRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574

Query: 541 IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600
           IR V+KQCFCH FIT+FPD YDT IGP G  LSGGQ+QRIAIARALIKKP +LILDEATS
Sbjct: 575 IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634

Query: 601 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           ALDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+GNDGSVVE GKF +L+
Sbjct: 635 ALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694

Query: 661 AN 662
            N
Sbjct: 695 RN 696

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  494 bits (1272), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 268/639 (41%), Positives = 386/639 (60%), Gaps = 16/639 (2%)

Query: 35  SHLNVNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEKQPAVVVHPKPED---EGTYKDI 91
           + + ++ VR PL   +++  I R      DV  K     P++ V     +       KDI
Sbjct: 37  ASMAISLVRQPLGIRRKTLEIRRWNSSIVDVKKKRSSPPPSIEVQKLSNEVSKSNGMKDI 96

Query: 92  WRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLK-------DIQGKEFSEL 144
            RLF L K + K ++ AL  + +S  + M IP +IG +LD  K            +  +L
Sbjct: 97  KRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNAKKEKL 156

Query: 145 MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFD 204
           MI+ ++   F+            AN  R+++L++  E LVA+LR   +K  ++QDA F D
Sbjct: 157 MIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLD 216

Query: 205 TYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGS 264
           T +VGDLISR+ +DA IV++++TQ +SDG +AV  G  G GMM              M  
Sbjct: 217 TNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMI-MVP 275

Query: 265 PLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRK 324
           PL + A V+G++IR  S++LQ     LT+V+EEQ N  +TIQ++  E  E+H++   +RK
Sbjct: 276 PLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRK 335

Query: 325 IFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGN 384
           +F VG + A  +  FF +  ++G+++ + +L  G+ ++    L+VGDL++FM+Y  YTG+
Sbjct: 336 VFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGS 395

Query: 385 AIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTR 444
           ++F LSGF+SE+M+GAGAA+R+FEL D KP I PT G       G  IEF+NVSF YPTR
Sbjct: 396 SLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEFQNVSFAYPTR 455

Query: 445 PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
           PT  I  NL+  I+ G +VCIVGPSG GKST++ LLL YY+ S G I IDGQ+I   + +
Sbjct: 456 PTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLR 515

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGL----TYTPTKEEIRSVAKQCFCHNFITRFPDT 560
             RR +G+VQQEP+L +GTI DNI Y +    T T    +++   +Q  C  F+  FP+ 
Sbjct: 516 KYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEG 575

Query: 561 YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 620
            +T +GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     + ++ 
Sbjct: 576 VNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVE- 634

Query: 621 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             +T +SIAHRLSTI+ S  VIVL   GSVVE G F+EL
Sbjct: 635 LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEEL 673

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  489 bits (1259), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/680 (40%), Positives = 398/680 (58%), Gaps = 41/680 (6%)

Query: 9   LGLLKHTGPSLYK-RTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVLYSTDVTP 67
           LGL+    P L + R++  PI R +          R P   +    L  RR+  ST+   
Sbjct: 33  LGLVAMASPVLLQTRSYRPPIPRIQ---------TRPPA--LSHQLLQARRLNTSTEQDQ 81

Query: 68  KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIG 127
           K  +    + + P       +KDI RLFLL K +   ++ AL  + +S  + M IP VIG
Sbjct: 82  KTLQTLKTLKLSPHDSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIG 141

Query: 128 TVLDSLKD--IQG-----------------KEFSELMIWDMSLKHFFYXXXXXXXXXXXA 168
            +LD+ K+  + G                 ++ S+ +I+ ++   F+            A
Sbjct: 142 KLLDAAKEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFA 201

Query: 169 NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
           N  R++LL++  E LVA+LR   +K  + QDA F D  +VGDLISR+ +DA IVS+S+TQ
Sbjct: 202 NMGRIVLLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQ 261

Query: 229 KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVT 288
            +SDG +AV  G+ G GMM              M  PL + A V+GK+IR+ S++LQ   
Sbjct: 262 NLSDGARAVIQGAVGFGMMSFISWKLTCVMTL-MAPPLAVMAMVYGKKIRNLSRQLQTSV 320

Query: 289 ANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGD 348
             LT+V+EEQ +  +T+Q++  E+ E+ ++ G +R +F +G + A  +  FF     +G+
Sbjct: 321 GGLTKVAEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGN 380

Query: 349 LSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFE 408
           ++ L +L  G+ ++    ++VGDL++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+FE
Sbjct: 381 VALLALLLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFE 440

Query: 409 LTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
           L D KP I+PT+G   +  +G  IEF+NV+F YPTR    IF  L+  I+ G +VCIVGP
Sbjct: 441 LNDRKPLIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGP 500

Query: 469 SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
           SG GKSTIA LLL YY+   G+I I GQDI   + +  RR +G+VQQEP+L +GTI DNI
Sbjct: 501 SGGGKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNI 560

Query: 529 TYGLTYTPTKEEIR--SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
           TY +      ++ R      Q  C  F+  FPD  +T +GP G  +SGGQKQRIA+ARA 
Sbjct: 561 TYAVPGELAGDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAF 620

Query: 587 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM---TIVSIAHRLSTIRRSENVIV 643
           +  P VLILDEATSALD +SE  +     Q ++S+S    T VSIAHRLSTI+ S  VIV
Sbjct: 621 LLDPAVLILDEATSALDSQSEEVV----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIV 676

Query: 644 LGNDGSVVEQGKFKELFANP 663
           L   G V E G F+EL ++P
Sbjct: 677 LDRHGGVGETGSFRELISDP 696

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  486 bits (1250), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/659 (41%), Positives = 389/659 (59%), Gaps = 14/659 (2%)

Query: 17  PSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFV--KRSPLIPRRVLYSTDVT---PKEPE 71
           P    R  ++P+ R+++ S   ++ +R  L  V  K    + RR   S +V    P E  
Sbjct: 3   PHWLSRKSLNPLLRYQSISLSGLSPIRGRLSQVVLKSEIHVQRRWQNSINVRGVPPSEAS 62

Query: 72  KQPAVV-VHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVL 130
            +  V+ +      E  +K++ RLF L + + K L  AL L+ +S  + M IP VIG +L
Sbjct: 63  NRLQVLRLSGADSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLL 122

Query: 131 DSLKDIQ----GKEFSELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAK 186
           D  K+ +    G E  E  I+ ++ K F+            AN  R+++L++  E LVA+
Sbjct: 123 DISKEKEAGGDGDEEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVAR 182

Query: 187 LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
           LR   +K  + QDA F D  +VGDLISR+ +DA IVS+SITQ  SDG +AV  G  G GM
Sbjct: 183 LRTKTMKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGM 242

Query: 247 MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQ 306
           M              +  PL+L A V+G++IR+ +++LQ     LT+V+EEQ N  +TIQ
Sbjct: 243 MGYISAQLTGVMLL-LAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQ 301

Query: 307 SFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQ 366
           S+  E+ E+ ++   +R +F VG   A  +  FF T  ++G+++ L +L  G+ ++    
Sbjct: 302 SYCGERKEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGA 361

Query: 367 LSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIP 426
           ++VG+L++FM+Y  YTG+++F LS F+SE+M+GAGAASR+FEL D  P I+PT+G   I 
Sbjct: 362 ITVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPIS 421

Query: 427 AKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNP 486
               EIEFKNV F+YP+R    +F  LN KI  G +VC+VGPSG GKSTI+ LLL +Y+ 
Sbjct: 422 LAAKEIEFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDV 481

Query: 487 SQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL--TYTPTKEEIRSV 544
             G I I GQ+I   + +  RR +GIVQQEP+L +G+I+DNI Y L       K  +   
Sbjct: 482 DSGVITIGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRA 541

Query: 545 AKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
            +   C  FI+ FPD  DT +GP GT LSGGQKQRIAIARA I  P++LILDEATSALD 
Sbjct: 542 LEAANCTRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDS 601

Query: 605 ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           +SE  I        +S  +TI SIAHR+STI  S  VIVL  +G V E G F +L   P
Sbjct: 602 QSEDIIAQALRARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQP 659

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  486 bits (1250), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 267/637 (41%), Positives = 383/637 (60%), Gaps = 17/637 (2%)

Query: 42  VRTPLHFVKRSPLIP--RRVLYSTDVTPKEPEKQ--PAVVVHPK-----PEDEGT--YKD 90
           +R P++  KRSPLI    R      +  +  +KQ  P++    K     P D     ++D
Sbjct: 26  LRYPINLGKRSPLISFQSRSFARCSIALQAAKKQGKPSLTATVKGLRLSPHDSKASGWQD 85

Query: 91  IWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDI--QGKEFSELMIWD 148
           I RLFLL K + + +  AL L+ +S  + M +P VIG +LD  ++   Q +   E MI+ 
Sbjct: 86  IKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPETEKETMIFG 145

Query: 149 MSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKV 208
           ++   F+            AN  R+++L++  E LVA+LR   +K  + QDA F D  +V
Sbjct: 146 LTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQDATFLDHNRV 205

Query: 209 GDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLL 268
           GDLISR+ +DA IVS+S+TQ +SDG +AV  G  G GMM              +  PL +
Sbjct: 206 GDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMML-LAPPLGV 264

Query: 269 SAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAV 328
            A V+GK+IR+ S++LQ     LT+VSEEQ +  KTIQ++  E+ E+H++   +RK+F V
Sbjct: 265 MALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRKVFHV 324

Query: 329 GKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFN 388
           G + A  +  FF     +G+++ L +L  G+ ++    ++VGDL++FM+Y  YTG+++F 
Sbjct: 325 GLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGSSLFG 384

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP 448
           LS F+SE+M+GAGAA+R+FEL D KP I+PT G   +  +   I F +V F+YPTRP   
Sbjct: 385 LSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKFSYPTRPQHH 444

Query: 449 IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR 508
           IF +LNF +  G +VCIVGPSG GKST+A LLL YY+   G+I +   +I   + +  RR
Sbjct: 445 IFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRDFNLRKYRR 504

Query: 509 HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITRFPDTYDTAIG 566
            +G+VQQEP+L SGTI DNITY +      +E R      Q  C  F+  FPD   T +G
Sbjct: 505 LLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQTTVG 564

Query: 567 PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
           P GT LSGGQKQRIA+ARA +  P++LILDEATSALD +SE  +  +  Q   ++  T +
Sbjct: 565 PRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ-RSARGKTTI 623

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           SIAHR+STI+ S  VIVL   G+V E G F +L A P
Sbjct: 624 SIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIP 660

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  485 bits (1249), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 260/619 (42%), Positives = 376/619 (60%), Gaps = 21/619 (3%)

Query: 65  VTPKEPE-KQPAVVVHPKPEDEGT--YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMC 121
           V  +E E K P  +    P++ G   +KD+ RLF L + +   +  AL L+ +S  + M 
Sbjct: 71  VAAQERELKIPPKIQKLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMV 130

Query: 122 IPKVIGTVLD-----SLKDIQGKEFSELM---------IWDMSLKHFFYXXXXXXXXXXX 167
           +P VIG +LD     S  +  GK  SE +         I+ ++   F+            
Sbjct: 131 VPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGAL 190

Query: 168 ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSIT 227
           AN  R+I+L++  E LVA+LR   +K  + Q+A F D+ KVGDLISR+  DA IV++S+T
Sbjct: 191 ANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVT 250

Query: 228 QKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEV 287
           Q +SDG +A+  G  G GMM              +  PL   A ++G++IR+ S++LQ  
Sbjct: 251 QNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLI-PPLGAMAIIYGRKIRNLSRQLQTS 309

Query: 288 TANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIG 347
              LT+V+EEQ N  +TIQ++  E+ E+H++   +R +F +G + A  +  FF +  ++G
Sbjct: 310 VGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVG 369

Query: 348 DLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
           + + L +L  G+ ++    L+VG+L++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+F
Sbjct: 370 NTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVF 429

Query: 408 ELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVG 467
           EL+D KP I PT G   I   G  +EFKNVSF YPTRP   IF++ + KIE G +VC VG
Sbjct: 430 ELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVG 489

Query: 468 PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
           PSG GKST++ LLL YY+ ++G IL+ G+DI   S +  RR +G+VQQEP+L +GTI +N
Sbjct: 490 PSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILEN 549

Query: 528 ITYGLTYTPTKE--EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           I Y +      E   I    +   C  F+  FPD  +T +GP GT LSGGQKQRIA+AR 
Sbjct: 550 ILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALART 609

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
            +  P++LILDEATSALD +SE  I     Q    K  T +SIAHRLSTI+ S  V+VLG
Sbjct: 610 FLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLG 668

Query: 646 NDGSVVEQGKFKELFANPA 664
            +G VVE G F+EL +NP+
Sbjct: 669 KNGCVVETGTFQELISNPS 687

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  484 bits (1247), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 252/593 (42%), Positives = 369/593 (62%), Gaps = 19/593 (3%)

Query: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD--------------SL 133
           +KD+ RLF L K +   ++ AL L+ +S  + M +P VIG +LD              S 
Sbjct: 93  FKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSK 152

Query: 134 KDIQGKEFSEL-MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVI 192
           + +  KE  +   I+  +   FF            AN  R+++L++  E LVA+LR   +
Sbjct: 153 EKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTM 212

Query: 193 KHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXX 252
           K  + QDA F D+ +VGDLISR+ +DA IV++S+T  +SDG +A+  G  G  MM     
Sbjct: 213 KAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISF 272

Query: 253 XXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQ 312
                    +  PL + A V+GK+IR+ S++LQ     LT+V+EEQ N  KTIQ++  E+
Sbjct: 273 KLTSVMVLLI-PPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEK 331

Query: 313 SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL 372
            E+ ++   +R +F VG + A  +  FF +  ++G+ + L +L  G+ ++    L+VGDL
Sbjct: 332 KEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDL 391

Query: 373 TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEI 432
           ++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+FEL D KP I PT G   +  KG  I
Sbjct: 392 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAI 451

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
            F++VSF+YPTRP   +F  ++FKIE G ++C VGPSG GKST++ LLL YY+ ++G IL
Sbjct: 452 IFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNIL 511

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFC 550
           I   +I +LS +  R+ +G+VQQEP+L +GTI DNI Y +       K ++    K+  C
Sbjct: 512 IGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNC 571

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
             F+  FPD  +T +GP GT LSGGQKQRIAIAR+ +  P++L+LDEATSALD +SE  I
Sbjct: 572 TKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDII 631

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
             T  +  +++ +T +SIAHRLSTI+ S  V+VL  +GSVVE GKF EL ANP
Sbjct: 632 AMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANP 683

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  481 bits (1237), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 256/595 (43%), Positives = 365/595 (61%), Gaps = 13/595 (2%)

Query: 78  VHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQ 137
           + P   +   +KDI RLF L K +   +  AL L+ +S  + M IP ++G +LD  KD +
Sbjct: 80  LSPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDRK 139

Query: 138 GKEFSELM-----IWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVI 192
             + +        I+ M+ K F             AN  R+++L+I  E LVA+LR   +
Sbjct: 140 DADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTM 199

Query: 193 KHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXX 252
           K  + QDA F DT +VGDLIS + +DA IV++S+TQ +SDG +AV  G  G GMM     
Sbjct: 200 KAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISW 259

Query: 253 XXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQ 312
                    M  PL + A V+G++IR+ S++LQ     LT+VSEEQ   +KTIQS+V E+
Sbjct: 260 QLTSVMIL-MIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEK 318

Query: 313 SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL 372
            E+H++   +R +F +G + A  +  FF +  ++G++S L +L  G+ ++    ++VGDL
Sbjct: 319 KEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDL 378

Query: 373 TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEI 432
           ++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+FEL D KP I PT G   +      I
Sbjct: 379 SSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTI 438

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
            F+NVSF YPTR    IF  L+  +E G +VCIVGPSG GKST+A LLL YY+ ++G+I+
Sbjct: 439 RFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIM 498

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE----IRSVAKQC 548
           I   +I++ + +  RR +GIVQQEP L +GTI DNI Y  T  P + +    I +   Q 
Sbjct: 499 IGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILY--TVPPERADNDDLISTAIGQA 556

Query: 549 FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 608
            C  F+  FPD   T +GP G  LSGGQKQRIA+ARA +  P++LILDEATSALD +SE 
Sbjct: 557 NCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEE 616

Query: 609 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
            +  T  ++   + +T +SIAHRLSTI+    V+VLG  G VVE G F+EL  NP
Sbjct: 617 IVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNP 670

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  476 bits (1224), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 257/588 (43%), Positives = 362/588 (61%), Gaps = 14/588 (2%)

Query: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGK---EFSEL 144
           +KDI RLF L + + + +  AL  + +S  + M +P +IG +LD+ K  Q +   E S+ 
Sbjct: 94  FKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDSKT 153

Query: 145 MIWDMSL-----KHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQD 199
           ++ D++        F+            AN  R+I+L++  E LVA+LR   +K  + QD
Sbjct: 154 IVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALDQD 213

Query: 200 AQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXX 259
           A F D  +VGDLISR+ +DA IVS+++TQ +SDG +A+  G  G GMM            
Sbjct: 214 ATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMM 273

Query: 260 XXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFN 319
             M  PL + A V+G++IR+ SK+LQE    L++V+EEQ N  KTIQ++V E+ E+H++ 
Sbjct: 274 L-MVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRYA 332

Query: 320 GSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYT 379
             +R +F +G + A  +  FF +  ++G+++ + +L  G+ ++    L+VG+L++FM+Y 
Sbjct: 333 TEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMYA 392

Query: 380 EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSF 439
            YTG+++F LS F+SE+M+GAGAASR+FEL D KP I  T G       G  I+F+NVSF
Sbjct: 393 VYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFENVSF 452

Query: 440 NYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDIS 499
            YP+RP   IF NLN +I  G +VCIVG SG GKSTIA LLL YY+ + G I I   DI 
Sbjct: 453 TYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIR 512

Query: 500 ALSTKSLRRHIGIVQQEPILMSGTIRDNITYG----LTYTPTKEEIRSVAKQCFCHNFIT 555
             S +  RR IG VQQEP L +G+I DNI Y     LT     E ++   KQ  C+ F+ 
Sbjct: 513 NFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFLG 572

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
           +FPD   T +GP G  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  +  T  
Sbjct: 573 KFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTL- 631

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           Q   ++ +T +SIAHRLSTI+ S  VIV+G  GSVVE G F  L  NP
Sbjct: 632 QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNP 679

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  467 bits (1201), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 247/582 (42%), Positives = 359/582 (61%), Gaps = 9/582 (1%)

Query: 89  KDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD-SLKDIQ---GKEFSEL 144
           KD+ RLF L + + K L+ AL L+ +S  + M IP VIG +LD + +D++   G E  E 
Sbjct: 83  KDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESGDE-EEA 141

Query: 145 MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFD 204
           +++ +  K F+            AN  R+++L+   E LVA+LR   +K  + Q+  F D
Sbjct: 142 VLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLD 201

Query: 205 TYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGS 264
           + +VGDLISR+ +DA IVS+SITQ  SDG +AV  G+ G GMM              +  
Sbjct: 202 SNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTL-LAP 260

Query: 265 PLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRK 324
           PL+L A  +G+++R+ S++LQ     LT+V+EEQ N  +T+Q++  E+ E+ ++   +R 
Sbjct: 261 PLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRN 320

Query: 325 IFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGN 384
           +F VG + A I+  FF     +G+ + L +L  G+ ++    +SVG+L++FM+Y  YTG+
Sbjct: 321 VFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGS 380

Query: 385 AIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTR 444
           ++FNLS F+SE+M+GAGAA R+FEL D KP I+PT G   +   G  I F +V+F YPTR
Sbjct: 381 SLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTR 440

Query: 445 PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
           P   +F  ++  I  G +VCIVGPSG GKST+A LLL +Y+P  G I I G+DI   +  
Sbjct: 441 PHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLS 500

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITRFPDTYD 562
             RR +GIVQQEP+L + +I +NITY L    TK+  R     +   C  F+  FP+   
Sbjct: 501 KYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQ 560

Query: 563 TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 622
           TA+GP GT LSGGQKQR+A+ARA ++ P +LILDEATSALD +SE  +  T  Q  +   
Sbjct: 561 TAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
           +TI SIAHR STI+ S  VIVL   G V+E G +++L  +P 
Sbjct: 621 ITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPG 661

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  468 bits (1203), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 250/610 (40%), Positives = 374/610 (61%), Gaps = 23/610 (3%)

Query: 72  KQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD 131
           +QP+  + P+  +  ++KDI RLF L + + + +  AL L+ +S  + M +P VIG ++D
Sbjct: 68  RQPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMD 127

Query: 132 SLKDIQGKEFSELM---------------IWDMSLKHFFYXXXXXXXXXXXANYVRVILL 176
           + KD Q  + S+L+               I+ +++  F+            AN  R+++L
Sbjct: 128 AAKDDQ--QASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVIL 185

Query: 177 RILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKA 236
           ++  E LVA+LR   +K  + QDA F D  KVGDLISR+ +DA IVS+S+TQ +SDG ++
Sbjct: 186 KVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRS 245

Query: 237 VFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSE 296
           +  G  G GMM              +  PL   A ++GK+IR+ S+ LQ     LT+ +E
Sbjct: 246 LIQGFVGFGMMSYISWKLTCVMML-LAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAE 304

Query: 297 EQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLS 356
           EQ +  +TIQ++  E+  +H++   +R+++ VG + A  +  FF    ++G+++ L +L 
Sbjct: 305 EQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLL 364

Query: 357 YGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRI 416
            G+ ++    +++GDL++FM+Y  YTG+++F +S F+SE+M+GAGAA+R+FEL D +P I
Sbjct: 365 TGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAI 424

Query: 417 NPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTI 476
           +PTRG   +   G  +EF+NV F YPTR    IF NL F+I  G +VCIVGPSG GKST+
Sbjct: 425 HPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTV 484

Query: 477 AWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
           A LLL +Y+   G I I GQ I++ + +  RR +G+VQQEP+L +GTI DNI Y +  + 
Sbjct: 485 ASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSL 544

Query: 537 TKEEIRSVAK---QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
             +E R VA+   Q  C  F++ FPD   T +GP GT LSGGQKQRIA+ARA +  P +L
Sbjct: 545 LNDENR-VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLL 603

Query: 594 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
           ILDEATSALD  SE  +         ++  T +SIAHR+STI+ S  VIVLG  G VVE 
Sbjct: 604 ILDEATSALDSRSEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVET 662

Query: 654 GKFKELFANP 663
           G F EL ++P
Sbjct: 663 GTFDELISDP 672

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  467 bits (1201), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/656 (40%), Positives = 378/656 (57%), Gaps = 10/656 (1%)

Query: 16  GPSLYKRTFVSPIWRFRAGSHLN---VNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEK 72
           GP L +  F S    +   S        +    L    R   + R +   +D+   +   
Sbjct: 11  GPKLLRSQFASASALYSTKSLFKPPMYQKAEINLIIPHRKHFLLRSIRLQSDIAQGKKST 70

Query: 73  QPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD- 131
           +P + +         +KDI RLF+L K + K +  AL L+ +S  + M +P VIG +LD 
Sbjct: 71  KPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDL 130

Query: 132 -SLKDIQGKEFSEL-MIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRA 189
            S  D + +E S+   ++  + K FF            AN  R+I+L++  E LVA+LR 
Sbjct: 131 ASESDGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRT 190

Query: 190 NVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXX 249
             +K  + QDA F DT +VGDLISR+ +DA IV++S+TQ +SDG +A+  G  G GMM  
Sbjct: 191 RTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSF 250

Query: 250 XXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFV 309
                       +  PL   A ++G++IR+ S++LQ     LT+V+EEQ N  +TIQ++ 
Sbjct: 251 LSWKLTCVMMI-LAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYG 309

Query: 310 AEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSV 369
            E++E+ ++   +R +F +G + A  +  FF +  ++G+ + L +L  G+ ++    ++V
Sbjct: 310 GEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTV 369

Query: 370 GDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKG 429
           G+L++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+FEL D KP I PT G   +    
Sbjct: 370 GELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQ 429

Query: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
             I FKNVSF YPTRP   IF++LN  I+ G +VC VGPSG GKSTIA LLL YY+ + G
Sbjct: 430 KPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSG 489

Query: 490 QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL--TYTPTKEEIRSVAKQ 547
            I    +DI   + +  RR IG VQQEP+L +GTI DNI Y +        + IR    +
Sbjct: 490 SIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGK 549

Query: 548 CFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 607
             C  F+  FPD   T +G  G  LSGGQKQRIA+ARA +  P VLILDEATSALD +SE
Sbjct: 550 ANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSE 609

Query: 608 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
             +     Q    +  T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L A P
Sbjct: 610 EIVAKNL-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIP 664

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  466 bits (1199), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 265/669 (39%), Positives = 388/669 (57%), Gaps = 23/669 (3%)

Query: 1   MLKVAPLRLGLLKHTGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVL 60
           ML+     +G L  T PS   +T V P             +VR       +  L+ + + 
Sbjct: 14  MLRSQFTWVGALYSTKPSF--KTIVCP-------------KVRLNSIISHKKALLSQSIR 58

Query: 61  YSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGM 120
             + +   +   +P + +         +KDI RLF+L + + K +  AL L+ +S  + M
Sbjct: 59  LQSSIAEGKASTKPTLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSM 118

Query: 121 CIPKVIGTVLD----SLKDIQGKEFSELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILL 176
            +P VIG +LD    S  +   ++  +  ++ ++ K FF            AN  R+I+L
Sbjct: 119 AVPSVIGKLLDVASESDDEEDEEKARDSKLYGLTKKQFFTALGLVFVIGAVANASRIIIL 178

Query: 177 RILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKA 236
           +I  E LVA+LR   +K  + QDA F DT +VGDLISR+ +DA IV++S+TQ +SDG +A
Sbjct: 179 KITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRA 238

Query: 237 VFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSE 296
           +  G  G GMM              +  PL   A V+GK+IR+ S++LQ     LT+V+E
Sbjct: 239 IIQGFVGFGMMSFLSWKLTCVMML-LAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAE 297

Query: 297 EQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLS 356
           EQ N  +TIQ++  E++E+H++   +R +F +G + A  +  FF +  ++G+ + L +L 
Sbjct: 298 EQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLL 357

Query: 357 YGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRI 416
            G+ ++    +++G+L++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+FEL D KP I
Sbjct: 358 VGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLI 417

Query: 417 NPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTI 476
           +PT G   I      + FKNVSF YPTRP   IF++LN  I+ G +VC VGPSG GKSTI
Sbjct: 418 HPTIGKDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTI 477

Query: 477 AWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
           A LLL YY+ + G I  D +D+   + +  RR IG VQQEP+L +GTI DNI Y +    
Sbjct: 478 ASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEI 537

Query: 537 TKEEIR--SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI 594
            + E R     +Q  C  F+  FPD   T +G  G  LSGGQKQRIA+ARA +  P +LI
Sbjct: 538 AEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLI 597

Query: 595 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           LDEATSALD +SE  +     Q    + +T +SIAHRLSTI+ S  +IVLG  GSVVE G
Sbjct: 598 LDEATSALDSQSEEIVAKNL-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETG 656

Query: 655 KFKELFANP 663
            F++L A P
Sbjct: 657 SFRDLIAIP 665

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  458 bits (1179), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 251/619 (40%), Positives = 369/619 (59%), Gaps = 8/619 (1%)

Query: 51  RSPLIPRRVLYSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALT 110
           R   + + +   + V+  +   +P + +         +KDI RLF+L K + K +  AL 
Sbjct: 49  RKQFLSQSIRLQSSVSEGKTFTKPTLKLSDANSKSSGFKDIKRLFVLSKPESKYIGLALL 108

Query: 111 LLTVSCGIGMCIPKVIGTVLD----SLKDIQGKEFSELMIWDMSLKHFFYXXXXXXXXXX 166
           L+ +S  + M +P VIG +LD    +  + + ++     ++ ++ + FF           
Sbjct: 109 LILISSSVSMAVPSVIGKLLDLASETEDEEKEEKAKSNKLYGLTKRQFFTALGLVFIIGA 168

Query: 167 XANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSI 226
            AN  R+I+L++  E LVA+LR   +K  + QDA F DT +VGDLISR+ +DA IV++S+
Sbjct: 169 VANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSV 228

Query: 227 TQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQE 286
           TQ +SDG +A+  G  G GMM              +  PL   A ++G++IR+ S++LQ 
Sbjct: 229 TQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMV-LAPPLGAMALIYGRKIRNLSRQLQT 287

Query: 287 VTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASII 346
               LT+V+EEQ N  +TIQ++  E++E+ ++   +R +F +G + A  +  FF +  ++
Sbjct: 288 SVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLV 347

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
           G+ + L +L  G+ ++    ++VG+L++FM+Y  YTG+++F LS F+SE+M+GAGAA+R+
Sbjct: 348 GNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARV 407

Query: 407 FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
           FEL D KP I PT G   +      I FKNVSF YPTRP   IF++LN  I  G +VC V
Sbjct: 408 FELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAV 467

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
           GPSG GKSTIA LLL YY+ + G I    +DI + + +  RR IG VQQEP+L +GTI D
Sbjct: 468 GPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILD 527

Query: 527 NITYGLTYTPTKEEIR--SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIAR 584
           NI Y +     ++E R      Q  C  F+  FPD   T +G  G  LSGGQKQRIA+AR
Sbjct: 528 NILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALAR 587

Query: 585 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
           A +  P VLILDEATSALD +SE  +     Q    + +T +SIAHRLSTI+ S  V+VL
Sbjct: 588 AFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRVERGLTTISIAHRLSTIKHSTRVVVL 646

Query: 645 GNDGSVVEQGKFKELFANP 663
           G  GSVVE G F++L A P
Sbjct: 647 GKHGSVVETGSFQDLIAIP 665

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  457 bits (1176), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 244/593 (41%), Positives = 353/593 (59%), Gaps = 19/593 (3%)

Query: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSE---- 143
           ++DI RL  L + +   +M AL L+ +S  + M +P VIG +LD  K     E  +    
Sbjct: 90  FRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESG 149

Query: 144 -----------LMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVI 192
                        I+  + K F             AN  R+I+L++  E LVA+LR   +
Sbjct: 150 DGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTM 209

Query: 193 KHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXX 252
           K  + QD+ F D  +VGDLISR+ +D+ IV++S+TQ +SDG +AV  G  G GMM     
Sbjct: 210 KAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISW 269

Query: 253 XXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQ 312
                    M  P+   A ++GK+IR+ SK+LQ     LT+V+EEQ    KTIQS+V E+
Sbjct: 270 QLTCVMGL-MLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEK 328

Query: 313 SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL 372
            E+ ++   +R++F +G + A  +  FF +   +G++S L +L  G+ ++    ++VGDL
Sbjct: 329 KEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGDL 388

Query: 373 TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEI 432
           ++FM+Y  YTG ++F LS F+SE+M+GAGAA+R+FEL D KP I PT G      +   I
Sbjct: 389 SSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPI 448

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
            FK+VSF YPTR    IF +LN  I+ G ++CI GPSG GKSTIA LL+ YY+  QG I 
Sbjct: 449 SFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGIS 508

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK--QCFC 550
           I   D+   + +  RR IG+V QEP+L +GTI +NI Y +  +  ++E R  A   +  C
Sbjct: 509 IGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANC 568

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
             F++ FPD  +T +GP G  LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +
Sbjct: 569 SKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIV 628

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
             T  + ++ + +T +SIAHR+STI  S  V+VLG DG VVE G F+EL   P
Sbjct: 629 ARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRP 680

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  453 bits (1165), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 249/599 (41%), Positives = 364/599 (60%), Gaps = 27/599 (4%)

Query: 87  TYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLD--------SLKDIQG 138
           T +DI+ LF L K +   +++++ L+ ++  + M +P VIG +LD        S KD + 
Sbjct: 95  TREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKD-EN 153

Query: 139 KEFS--------------ELMIWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLV 184
            E S              + +I+  +   FF            AN  R+I+L++  E +V
Sbjct: 154 DESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIV 213

Query: 185 AKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGV 244
           A+LR   +K+I+ QD +F D+ KVGDLISR+ +D+ IVS ++T+ +SDG +AV  G  GV
Sbjct: 214 ARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGV 273

Query: 245 GMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKT 304
           GMM              M  P+ + A ++G++IR+ SKKLQE   +LT++SEEQ NG +T
Sbjct: 274 GMMSFISLKLSGVMLF-MVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRT 332

Query: 305 IQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQ 364
           IQS+V E+ E+HK+   +RK++ VG   A  +  FF    +IG+ + L +L  G  ++  
Sbjct: 333 IQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISN 392

Query: 365 QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF 424
             LS+G L++FM+Y  YTG+++F LS F+SEIM+G+GAASRIFE+    P IN T+G   
Sbjct: 393 GTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDP 452

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
           I  +   IEF+++ F YPTR    IF++LN KI  G +VCI+GPSG GKSTI+ LLL YY
Sbjct: 453 ISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYY 512

Query: 485 NPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL--TYTPTKEEIR 542
           +P  G I I G+DI   S +  R+ +G+V QEP+L +GTI +NI Y +       KE + 
Sbjct: 513 DPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLS 572

Query: 543 SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 602
           +  +   C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +PT+L+LDEATSAL
Sbjct: 573 NAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSAL 632

Query: 603 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
           D  SE  +  T  Q   +K  T +SIAHR+STI+ S  V+VL   G VVE G ++EL  
Sbjct: 633 DPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLG 690

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  452 bits (1162), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 250/615 (40%), Positives = 367/615 (59%), Gaps = 27/615 (4%)

Query: 73  QPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDS 132
           +P+  +  + ++  ++KDI RLF L + + K +  AL L+ +S  + M +P VIG ++D 
Sbjct: 69  KPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDV 128

Query: 133 LKD-------IQGKEF---------------SELMIWDMSLKHFFYXXXXXXXXXXXANY 170
            K+         GK                 SE +I  ++L  F+            AN 
Sbjct: 129 AKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANM 188

Query: 171 VRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKI 230
            R+++L++  E LVA+LR   +K  + QDA F D  KVGDLISR+ +DA IVS+S+TQ +
Sbjct: 189 GRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNM 248

Query: 231 SDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN 290
           SDG +++  G  G GMM              +  PL + A V+G++IR+ S+ LQ     
Sbjct: 249 SDGTRSLIQGFVGFGMMSYISWKLTCVMML-LAPPLAVMALVYGRKIRNLSRTLQASVGG 307

Query: 291 LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLS 350
           LT+ +EEQ +  +TIQ++  E+  +  +   +R+++ VG + A  +  FF    ++G+ +
Sbjct: 308 LTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSA 367

Query: 351 FLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELT 410
            L +L  G+ ++    ++VGDL++FM+Y  YTG+++F +S F+SE+M+GAGAA+R+FEL 
Sbjct: 368 VLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELN 427

Query: 411 DLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSG 470
           D KP I+PT+G   +      +EFK V F YPTR    IF +L+ +I+ G +VCIVGPSG
Sbjct: 428 DRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSG 487

Query: 471 KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
            GKST+A LLL +Y+   G ILI GQ+I+  + +  RR +GIVQQEP+L +GTI +NI Y
Sbjct: 488 GGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILY 547

Query: 531 GLTYTPTKEEIRSVAK---QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALI 587
            +      EE   VA+   Q  C  F++ FPD   T +GP GT LSGGQKQRIA+ARA +
Sbjct: 548 TVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFL 607

Query: 588 KKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGND 647
             P +LILDEATSALD  SE  I  T      ++  T +SIAHR+STI+ S  VIVLG +
Sbjct: 608 LDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRN 666

Query: 648 GSVVEQGKFKELFAN 662
           G VVE G F EL +N
Sbjct: 667 GGVVETGTFDELASN 681

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  449 bits (1156), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 252/584 (43%), Positives = 361/584 (61%), Gaps = 10/584 (1%)

Query: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELM-- 145
           +KDI RLF+L + +   +  AL L+ +S  + M +P VIG +LD   D   +E ++    
Sbjct: 85  FKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDAKETKD 144

Query: 146 --IWDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF 203
             ++ +S + FF            AN  R+I+L++  E LVA+LR   +K  + QDA F 
Sbjct: 145 NKLYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAALDQDATFL 204

Query: 204 DTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMG 263
           DT +VGDLISR+ +DA IV++S+TQ +SDG +A+  G  G GMM              + 
Sbjct: 205 DTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMV-LA 263

Query: 264 SPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIR 323
            PL   A ++G++IR+ S++LQ     LT+V+EEQ N  +TIQ++  E++E+ ++   +R
Sbjct: 264 PPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVR 323

Query: 324 KIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTG 383
            +F VG + A  +  FF +  ++G+ + L +L  G+ ++    ++VG+LT+FM+Y  YTG
Sbjct: 324 NVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMMYAVYTG 383

Query: 384 NAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPT 443
           +++F LS F+SE+M+GAGAA+R+FEL D KP I PT G   +      I FK+VSF YPT
Sbjct: 384 SSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIVFKDVSFTYPT 443

Query: 444 RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALST 503
           RP   IF++LN  I+ G +VC VGPSG GKSTIA LLL YY+ S G I    +DI   + 
Sbjct: 444 RPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFGDEDIKNFNL 503

Query: 504 KSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCHNFITRFPDT 560
           +  RR +G VQQEP+L +GTI DNI Y +     ++E R VA+   Q  C  F+  FPD 
Sbjct: 504 RKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANCTKFLANFPDG 562

Query: 561 YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 620
             T +G  G  LSGGQKQRIA+ARA +  P VLILDEATSALD +SE  +     + +K 
Sbjct: 563 LQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAKNLQRRVK- 621

Query: 621 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
           + +T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L + P 
Sbjct: 622 RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPG 665

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  431 bits (1108), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 235/574 (40%), Positives = 344/574 (59%), Gaps = 16/574 (2%)

Query: 87  TYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI 146
           T+  + +L  L K + K +  A+ L+ VS  + M +P VIGT++D           +  I
Sbjct: 30  TWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDH------ASTPDAPI 83

Query: 147 WDMSLKHFFYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTY 206
           + ++   F             AN  R+I+L+I  E LVA+LR   +K ++ QDA F D +
Sbjct: 84  YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDATFLDKH 143

Query: 207 KVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPL 266
           +VGDLISR+ +DA IVS+S+T  +SDG +A   G  G+GMM              M  PL
Sbjct: 144 RVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTM-MVPPL 202

Query: 267 LLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIF 326
            + A ++G +I+  S++LQ+    L++ SEEQ N +KT+Q++  E+ E+ +++  +R +F
Sbjct: 203 GILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVF 262

Query: 327 AVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAI 386
            +G + A  +A FF +  +IG+++ + +L  G+       +++G+L++FM+Y  YTG+++
Sbjct: 263 NIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYTGSSV 319

Query: 387 FNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRG-SKFIPAKGGEIEFKNVSFNYPTRP 445
           F L+GF+SE+M+G GAA R+ EL ++K +I+PT+G S     KG  I F NVSF Y    
Sbjct: 320 FGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFAYSNGK 379

Query: 446 TVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKS 505
           +V     +NF+I  G +VC VG SG GKSTI+ LLL YY    G I I   DISA + + 
Sbjct: 380 SV--LSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRK 437

Query: 506 LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAI 565
            RR +G+VQQEP+L +GTI DNITYGL +  +  ++    K   C  FI       DT +
Sbjct: 438 YRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMGLDTLV 496

Query: 566 GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 625
           GP G  LSGGQ+QRIA+AR  ++ P +LILDEATSALD +SE  IN    Q  +   MT 
Sbjct: 497 GPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQEAGMTT 555

Query: 626 VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           +SIAHRLSTIR S  VIV+  DG VVE G F +L
Sbjct: 556 ISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQL 588

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  197 bits (501), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 195/378 (51%), Gaps = 19/378 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + ++ F  EQ   +K++ S+ +       V +  AF+N+     FT+A   
Sbjct: 324 VAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSA--- 380

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
                  ++  G   V   +LSVGDL             +  L   + E+ Q       +
Sbjct: 381 ----LTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESL 436

Query: 407 FELTDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           F+L   K  I  ++    +P     EI FKNVSF Y   P   I +N +F I  GS   I
Sbjct: 437 FQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAI 494

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           VGPSG GKSTI  L+  +Y+P +G+IL+DG+D+  L  +SLRR IG+V Q+  L + +I 
Sbjct: 495 VGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIW 554

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           DN+ +G     T +EI     +      I + P   DT +G  G ++SGG+KQR+AIAR 
Sbjct: 555 DNVKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARV 613

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
           L+K   ++  DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ +IVL 
Sbjct: 614 LLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLE 673

Query: 646 NDGSVVEQGKFKELFANP 663
           + G V E+GK  EL A P
Sbjct: 674 H-GRVKEEGKHAELLATP 690

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  196 bits (498), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 192/375 (51%), Gaps = 13/375 (3%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAKFFTTASIIGDL 349
           V+ +     + ++ F  E+    K++ S+         V +  AF+N+      ++I   
Sbjct: 304 VALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSG----QNLIFTS 359

Query: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409
           +   ++  G   V    LSVGDL             +  L   + E+ Q       +F+L
Sbjct: 360 ALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL 419

Query: 410 TDLKPRINPTRGSKFIPA-KGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
              K  I  ++    +P  K  EI+F+NV+F Y   P   I  N NF +  G    IVGP
Sbjct: 420 QKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILENANFTLPAGWKTAIVGP 477

Query: 469 SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
           SG GKSTI  L+  +Y+P +G+ILIDG+DI  L  KSLRR IG+V Q+  L + TI +N+
Sbjct: 478 SGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENV 537

Query: 529 TYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIK 588
            +G   T T ++IR    +      I   P   +T +G  G ++SGG+KQR+AIAR L+K
Sbjct: 538 KFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARVLLK 596

Query: 589 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648
              ++  DEATSALD  +E A+  T  +     S T + IAHRL TI  ++ ++VL N G
Sbjct: 597 DTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVLEN-G 655

Query: 649 SVVEQGKFKELFANP 663
            V E+GK  EL + P
Sbjct: 656 RVKEEGKHAELLSKP 670

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  191 bits (484), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/377 (33%), Positives = 196/377 (51%), Gaps = 17/377 (4%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINA--KFFTTASIIG 347
           V+ +     + ++ F  EQ   +K++ S+ +       V +  AF+NA   F  T+++  
Sbjct: 296 VAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTA 355

Query: 348 DLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
                 ++  G   V    LSVGDL             +  L   + E+ Q       +F
Sbjct: 356 ------MMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLF 409

Query: 408 ELTDLKPRI-NPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
           +L   K +I N  +       +  +I F+NVSF Y   P   I +N +F +  G    IV
Sbjct: 410 QLQRNKVKIQNKEKPLMLSSQRPSKIVFENVSFGYD--PDRMILKNSSFTMPAGWKTAIV 467

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
           GPSG GKSTI  L+  +Y+P +G+IL+DG+D+  L  +SLRR IG+V Q+  L + +I +
Sbjct: 468 GPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWE 527

Query: 527 NITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
           N+ +G   + + EEIR   ++    + + + P   DT +G  G ++SGG+KQR+AIAR L
Sbjct: 528 NVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVL 586

Query: 587 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGN 646
           +K   ++  DEATSALD  +E A+  T      + S T V IAHRL TI  ++ +IV+  
Sbjct: 587 LKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-Q 645

Query: 647 DGSVVEQGKFKELFANP 663
            G V E+GK  EL A P
Sbjct: 646 QGQVKEEGKHAELLAKP 662

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 194/377 (51%), Gaps = 17/377 (4%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINA--KFFTTASIIG 347
           V+ +     + ++ F  E+   +K++ S+ K       V +  AF+NA   F  T+++  
Sbjct: 317 VALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTA 376

Query: 348 DLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
                 ++  G+  V +  L+VGDL             +  L   + E+ Q       +F
Sbjct: 377 ------MMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLF 430

Query: 408 ELTDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
           +L      I  T     +P     EI+F+NV+F Y  +P   I +N  F I  G    IV
Sbjct: 431 KLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIAPGKKTAIV 488

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
           GPSG GKSTI  L+  +Y+P QG+IL+DG+DI  L    LRR +G+V Q+  L + TI +
Sbjct: 489 GPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWE 548

Query: 527 NITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
           N+ +G     T  EI +  ++    + I + P   +T +G  G ++SGG+KQR+AIAR L
Sbjct: 549 NVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVL 607

Query: 587 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGN 646
           +K   ++  DEATSALD  +E ++  T  +     + T V IAHRL TI  ++ +IVL N
Sbjct: 608 LKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLEN 667

Query: 647 DGSVVEQGKFKELFANP 663
            G+V E+G    L ANP
Sbjct: 668 -GAVREEGTHNALLANP 683

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  190 bits (482), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 247/510 (48%), Gaps = 28/510 (5%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRS 225
            +N+++  +L   SE  +  LR   ++ I  +  ++F  +  K  ++ + + ND   +   
Sbjct: 764  SNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSL 823

Query: 226  ITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLL-LSAKVFGKQIRDNSKKL 284
            ++Q +S  V + F+  + VG++                 PL+ + + ++G  +++     
Sbjct: 824  VSQFLS--VISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTY 881

Query: 285  QEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTAS 344
            +   ANL  +  E   G+KTI+    +      ++    ++  + ++ A +        +
Sbjct: 882  KTKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITT 941

Query: 345  IIGDLSFLVVLSYGSWLVFQQQLSVGDLT---AFMLYTEYTGNAIFNLSGFFSEIMQGAG 401
             I      ++  YG  LV   + S   +      +L+T  T N++ +      +I +G  
Sbjct: 942  AIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLISQ---IPDISRGQR 998

Query: 402  AAS---RIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIF 450
            AAS   RI E ++       T G +F     GE        +   N+ F YPT   V I+
Sbjct: 999  AASWIYRIIEESEDTKEQTITDG-RFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIY 1057

Query: 451  RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
             NL+  +  G  V IVG SG GKST+ +LL   Y  +   I IDG D++    ++LRR I
Sbjct: 1058 DNLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQI 1117

Query: 511  GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
             +V+Q+P+L  GT+R+N+ YGL ++P + +I  + K    ++FI   P+  +T++    +
Sbjct: 1118 SVVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--S 1175

Query: 571  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            L+SGGQ QR+ IARAL++KP +LILDE TSALD  S   IN    +     S+  +SI H
Sbjct: 1176 LISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITH 1233

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
                +R    V VL  DG + E G F +LF
Sbjct: 1234 NEQMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  125 bits (314), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 165/342 (48%), Gaps = 17/342 (4%)

Query: 334 FINAKFFTTASIIGDLSFLVVLSY--GSWL----VFQQQLSVGDLTAFMLYTEYTGNAIF 387
           FI    +  A+I   L FL +  +  G W     + +  L++ D+          G+ + 
Sbjct: 250 FIKLSLYVAANI-STLRFLSLAMFVQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLN 308

Query: 388 NLSGFFSEIMQGAGAASRIFE-LTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPT 446
              G+   + +G  A  +I   L D K  I+ +   K I     +I F++VSF+YP+RP 
Sbjct: 309 TTLGYLIFLQKGQVALRKIQSFLNDNKVEIDES-ALKQIDISKADISFRHVSFSYPSRPA 367

Query: 447 VPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSL 506
             +  +++     G    IVG SG GKST++ LLL  Y+   G I I    I  +  + L
Sbjct: 368 DDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVL 427

Query: 507 RRHIGIVQQEPILMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++I +V+Q   L + T+ +NI  G      +    +++++   K     + I    +  
Sbjct: 428 IKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGL 487

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
           DT +G  G  LSGGQ+QR+A+ARA ++   VLILDEA SALD+     +     +  + +
Sbjct: 488 DTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGR 547

Query: 622 SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           +  I++  H LS I   + + V+  +G ++E G   +L  +P
Sbjct: 548 TTIILT--HELSQISIQDYLYVV-EEGRIIESGFQGQLMYDP 586

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  186 bits (472), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 187/370 (50%), Gaps = 20/370 (5%)

Query: 303 KTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASIIGDLSFLVVL 355
           + ++ F  EQ    K+N S++        V +  AF+N+     FT+A          ++
Sbjct: 323 EAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNSGQNLIFTSA-------LTAMM 375

Query: 356 SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR 415
             G   +    LSVGDL             +  L   + ++ Q       +F+L   + +
Sbjct: 376 YMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKNEVK 435

Query: 416 INPTRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGK 473
           I   +    +  K G   IEFKNV+F Y   P   I RN +F I  G    +VGPSG GK
Sbjct: 436 ILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIPAGVKTAVVGPSGSGK 493

Query: 474 STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
           STI  L+  +Y+P +G++L++G D+      SLRR IG+V Q+  L + TI +N+ +G  
Sbjct: 494 STILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIWENVKFG-D 552

Query: 534 YTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
            T T E+I +  ++      I + P  Y+T +G  G ++SGG+KQR+AIAR L+K   ++
Sbjct: 553 VTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLAIARVLLKNAPIM 612

Query: 594 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
             DEATSALD  +E  +  T        S T V IAHRL T+  S+ +IVL  +GS+ E+
Sbjct: 613 FFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL-KEGSIFEE 671

Query: 654 GKFKELFANP 663
           G    L + P
Sbjct: 672 GTHLGLLSKP 681

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  185 bits (469), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 177/339 (52%), Gaps = 16/339 (4%)

Query: 328 VGKEAAFINAK---FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGN 384
           V +  AF+N+     FT+A          ++  G   +    L+VGDL            
Sbjct: 325 VSQSLAFLNSGQNLIFTSA-------LTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSV 377

Query: 385 AIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG--EIEFKNVSFNYP 442
            +  L   + E+ Q       +F+L   +  I      K +PA G   EI F+NV+F Y 
Sbjct: 378 PLNFLGSVYRELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY- 436

Query: 443 TRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALS 502
             P   I +N +F I  G  + IVGPSG GKSTI  L+  +Y+P +G+ILI+G D+  + 
Sbjct: 437 -EPDRTILKNASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEID 495

Query: 503 TKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYD 562
             SLR+ IG+V Q+  L + TI +N+ +G     T EE+ +  ++      I++     D
Sbjct: 496 LDSLRKVIGVVPQDTPLFNDTIWENVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTD 554

Query: 563 TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 622
           T +G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E  +  T     K+ S
Sbjct: 555 TIVGERGLMISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGS 614

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            T + IAHRL TI  ++ +IVL  DGSV E+G   EL A
Sbjct: 615 KTSIYIAHRLRTIADADKIIVL-EDGSVKEEGTHTELLA 652

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  185 bits (469), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 128/379 (33%), Positives = 190/379 (50%), Gaps = 19/379 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + ++ F  E+    K+NGS+         V +  AF+N+     FTTA   
Sbjct: 297 VALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTA--- 353

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
                  ++  G   V    L+VGDL             +  L   + ++ Q       +
Sbjct: 354 ----LTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETL 409

Query: 407 FELTDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           F+L   + +I        +P     +I F+NV+F Y   P   I +N +F I  G    I
Sbjct: 410 FKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAI 467

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           VG SG GKSTI  L+  +Y+P  G+ILI+G+DI      +LR+ IG+V Q+  L + TI 
Sbjct: 468 VGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIW 527

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           +N+ +G     T EE+ +V ++      I + P  +DT +G  G ++SGG+KQR+AIAR 
Sbjct: 528 ENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARV 586

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
           L+K   ++  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IVL 
Sbjct: 587 LLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLD 646

Query: 646 NDGSVVEQGKFKELFANPA 664
           N G V E+GK  EL A P 
Sbjct: 647 N-GRVREEGKHLELLAMPG 664

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  184 bits (468), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 125/376 (33%), Positives = 190/376 (50%), Gaps = 13/376 (3%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAKFFTTASIIGDL 349
           V+ +     + ++ F  E+    K+NGS+         V +  AF+N+      ++I   
Sbjct: 300 VALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNSG----QNLIFTS 355

Query: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409
           +   ++  G   V    L+VGDL             +  L   + E+ Q       +F+L
Sbjct: 356 ALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKL 415

Query: 410 TDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
              + +I        +P     +I F+NV+F Y   P   I +N +F I  GS   IVG 
Sbjct: 416 RKNEIKIKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASFTIPAGSKTAIVGS 473

Query: 469 SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
           SG GKSTI  L+  +Y+P  G+ILI+G+DI      +LR+ IG+V Q+  L + TI +N+
Sbjct: 474 SGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENV 533

Query: 529 TYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIK 588
            +G     T EE+ +V ++      I + P  ++T +G  G ++SGG+KQR+AIAR L+K
Sbjct: 534 KFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLLK 592

Query: 589 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648
              ++  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IV  N G
Sbjct: 593 NARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVFDN-G 651

Query: 649 SVVEQGKFKELFANPA 664
            V E+GK  EL A P 
Sbjct: 652 KVREEGKHLELLATPG 667

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  184 bits (468), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 134/395 (33%), Positives = 201/395 (50%), Gaps = 23/395 (5%)

Query: 276 QIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI----RKIFAVGKE 331
           Q R ++ K     A++   S   F  +K    F  E     K+N ++         + K 
Sbjct: 299 QFRRDANKADNKGASIALDSLINFEAVKY---FNNENYLSSKYNSALIDYRNSQIKISKS 355

Query: 332 AAFINAK---FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFN 388
            AF+N+     FTTA     L+ ++ L  G   V    L+VGDL             +  
Sbjct: 356 LAFLNSGQNLIFTTA-----LTGMMYL--GCTGVIGGNLTVGDLVLINQLVFQLSVPLNF 408

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG--EIEFKNVSFNYPTRPT 446
           L   + E+ Q       +F+L   + +I+     K I  + G  EI F+NV+F Y     
Sbjct: 409 LGSVYRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HAD 466

Query: 447 VPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSL 506
             I +N +F I  G    IVGPSG GKSTI  L+  +Y+P +G+ILI+G D+  +   SL
Sbjct: 467 RKILKNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSL 526

Query: 507 RRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIG 566
           R+ IG+V Q+  L + +I +N+ +G        EI  V ++    + I + P +Y+T +G
Sbjct: 527 RKLIGVVPQDTPLFNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVG 585

Query: 567 PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
             G ++SGG+KQR+AIAR L+K  +V+  DEATSALD  +E A+  T     K+ S T +
Sbjct: 586 ERGLMISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSI 645

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            IAHRL TI  ++ +IVL  DG+V E+G   EL A
Sbjct: 646 YIAHRLRTIADADKIIVL-EDGTVREEGTHNELLA 679

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  184 bits (467), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 189/379 (49%), Gaps = 19/379 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + ++ F  E+    K+N S+         V +  AF+N+     FTTA   
Sbjct: 298 VALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTA--- 354

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
                  ++  G   V    L+VGDL             +  L   + ++ Q       +
Sbjct: 355 ----LTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETL 410

Query: 407 FELTDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           F+L   + +I        +P     EI F+NV+F Y   P   I +N +F I  G    I
Sbjct: 411 FKLRKNEVKIKSVERPLMLPEHVPYEITFENVTFGY--HPDRKILKNASFTIPAGWKTAI 468

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           VG SG GKSTI  L+  +Y+P  G+ILI+G+DI      +LRR IG+V Q+  L + TI 
Sbjct: 469 VGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIW 528

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           +N+ +G     T EE+++  ++      I + P  ++T +G  G ++SGG+KQR+AIAR 
Sbjct: 529 ENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIARV 587

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
           L+K   ++  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IVL 
Sbjct: 588 LLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVLD 647

Query: 646 NDGSVVEQGKFKELFANPA 664
           N G+V E GK  EL A P 
Sbjct: 648 N-GTVKEDGKHIELLATPG 665

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  184 bits (466), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/395 (32%), Positives = 198/395 (50%), Gaps = 17/395 (4%)

Query: 276 QIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKE 331
           Q R ++ K     A++   S   F  +K    F  E+    K++ S+ K       V + 
Sbjct: 281 QFRRDANKADNKGASVALDSLINFEAVK---YFNNEKYLADKYHTSLIKYRDSQIKVSQS 337

Query: 332 AAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSG 391
            A++N+      ++I   +   ++  G   V    L+VGDL             +  L  
Sbjct: 338 LAYLNSG----QNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGS 393

Query: 392 FFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPI 449
            + E+ Q       +F+L   + +I        + A  G  EI F+NV+F Y ++    I
Sbjct: 394 VYRELKQSLIDMESLFQLRKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSKR--KI 451

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
             N +F I  G    +VGPSG GKSTI  L+  +Y+P QG+ILI+G D+      SLRR 
Sbjct: 452 LNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRV 511

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
           +G+V Q+  L + TI +N+ +G     T EE+ +V ++      I + P  Y+T +G  G
Sbjct: 512 MGVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERG 570

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 629
            ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T     +S S T V IA
Sbjct: 571 MMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIA 630

Query: 630 HRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
           HRL TI  ++ +IVL  DG+V E+G    L A P 
Sbjct: 631 HRLRTIADADKIIVL-EDGAVKEEGTHSGLLATPG 664

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  186 bits (471), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 246/512 (48%), Gaps = 29/512 (5%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSI 226
            N+ +  LL   SE  V  LR  V++ +  ++  +F  +  K  ++ + V ND     R +
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDL----RDL 832

Query: 227  TQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSKK 283
               +S+ + A+  F+  + +G++                 PL++  + ++G  ++     
Sbjct: 833  RSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETD 892

Query: 284  LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343
             +   A L     +    IKTI+   AE      ++    K+  +  + A       +  
Sbjct: 893  YKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMT 952

Query: 344  SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
            ++I      ++  YG  LV   + +  ++        +T  +  +L     +I +G  AA
Sbjct: 953  NMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAA 1012

Query: 404  SRIFELTD-----LKPRINPTR--GSKFIPAKGGE----IEFKNVSFNYPTRPTVPIFRN 452
            S I+ + D     L+   N  R  G       G E    +  +N++F YP+ PT  +++N
Sbjct: 1013 SWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKN 1072

Query: 453  LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGI 512
            +NF +  G  + I+G SG GKST+  LL   YN   G+I IDG D++  +  SLR+ I +
Sbjct: 1073 MNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISV 1132

Query: 513  VQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLL 572
            V+Q+P+L +GTIRDN+TYGL     + E+    K    H+F+   P   DT I    TLL
Sbjct: 1133 VEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLL 1190

Query: 573  SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAH 630
            SGGQ QR+ IARAL++K  +LILDE TSALD  S   IN    +++K    ++  + I H
Sbjct: 1191 SGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVKKGPPALLTMVITH 1246

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
                +R   ++ VL  DG VVE+G F  L+ N
Sbjct: 1247 SEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  170 bits (430), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 196/413 (47%), Gaps = 28/413 (6%)

Query: 270 AKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVG 329
           A VF + I   S+K    T+   ++     N  + ++ +  ++ E  KF     K   + 
Sbjct: 191 AVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKF-----KEIILN 245

Query: 330 KEAAFINAKFFTTASIIGDLSFLVV------LSYGSWLVFQQQLSVGDLTAFMLYTEYTG 383
               FI + FF  A+  G L FL +        +GS ++ + +L++ D+          G
Sbjct: 246 CNTFFIKSCFFVAANA-GILRFLTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLG 304

Query: 384 NAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP---TRGSKF-IPAKGGEIEFKNVSF 439
           + + N       + +G  A  +I  L     + NP   T   +F +     ++ F NVSF
Sbjct: 305 STLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYATSDLTFANVSF 364

Query: 440 NYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDIS 499
           +YP+RP+  + +N++     G    IVG SG GKST++ LLL +Y+   G I I+G +I 
Sbjct: 365 SYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQ 424

Query: 500 ALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT---------PTKEEIRSVAKQCFC 550
            +  K L  +I +V+Q   L + T+R NI  G T +           +  I+   +    
Sbjct: 425 TIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALL 484

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
             FI   PD  +T IG  G  LSGGQ+QR+AIARA I+   +L LDEA SALD+     +
Sbjct: 485 DRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLL 544

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
                   K K+  I++  H LS I  S++ + L  +G VVE G   EL A+P
Sbjct: 545 MKAIRHWRKGKTTIILT--HELSQI-ESDDYLYLMKEGEVVESGTQSELLADP 594

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  182 bits (462), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 189/378 (50%), Gaps = 19/378 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + ++ F  E+    K+N S+         V +  AF+N+     FTTA   
Sbjct: 297 VALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNSGQNLIFTTA--- 353

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
                  ++  G   V    L+VGDL             +  L   + ++ Q       +
Sbjct: 354 ----LTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETL 409

Query: 407 FELTDLKPRINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           F+L   + +I        +P     +I F+NV+F Y   P   I +N +F I  G    I
Sbjct: 410 FKLRRNEVKIKNAERPLMLPEHVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAI 467

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           VG SG GKSTI  L+  +Y+P  G+ILI+G+DI      +LR+ IG+V Q+  L + TI 
Sbjct: 468 VGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQDTPLFNDTIW 527

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           +N+ +G     T EE+ +V ++      I + P  +DT +G  G ++SGG+KQR+AIAR 
Sbjct: 528 ENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARV 586

Query: 586 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
           L+K   ++  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IVL 
Sbjct: 587 LLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTIADADKIIVLD 646

Query: 646 NDGSVVEQGKFKELFANP 663
           N G V E+GK  EL A P
Sbjct: 647 N-GRVREEGKHLELLATP 663

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  182 bits (461), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 163/521 (31%), Positives = 247/521 (47%), Gaps = 53/521 (10%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRS 225
            + +++   L  +SEN +  LR   ++ I +++ ++F  D  K  +L + V ND     R 
Sbjct: 761  STFLKSFSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDL----RD 816

Query: 226  ITQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLL-LSAKVFGKQIRDNSK 282
            +   IS+ + A+  FI  +  G++                 PL+ L + ++G  ++    
Sbjct: 817  LRSLISEFISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYET 876

Query: 283  KLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKF--- 339
              +   A+L     E   GIKTI+    EQ  + +++    ++  +G++ A I   F   
Sbjct: 877  TYKTTVADLENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRA-IATGFGIA 935

Query: 340  FTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA--------FMLYTEYTGNAIFNLSG 391
             TTA ++   + L    YG  LVF     +G+ T          +L+T  T  ++ N   
Sbjct: 936  ITTALVMCIEAIL--FYYGLKLVF-----IGEYTTMKMFKTFTLLLFTIMTCTSLINQ-- 986

Query: 392  FFSEIMQGAGAASRIFELTDLKPRI-------NPTRGSKFIPAKGGE---IEFKNVSFNY 441
               ++ +G  AASRIF + D   R          TRG   IP        I   N+ F+Y
Sbjct: 987  -IPDVTRGQRAASRIFRILDESDRFLEDSDEHGRTRG---IPKNNSIKSIITINNLQFHY 1042

Query: 442  PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
            P+  +  +F  LN +I     V +V  SG GKST+ +LL   Y      I IDG DI+  
Sbjct: 1043 PSAESSNVFNRLNLQIADNQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEW 1102

Query: 502  STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
               SLR  I IV+Q+P L  G+IR N+ YG        +I  V KQ    +F+T  P+  
Sbjct: 1103 QLTSLRNLIAIVEQKPTLFEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGI 1162

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
            DT +    +LLSGGQ QRI IARAL++K  +LILDE TSALD ES     +    L+KS 
Sbjct: 1163 DTNVDT--SLLSGGQAQRICIARALLRKSKILILDECTSALDAESA----FVIQNLVKSG 1216

Query: 622  --SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
               +  ++I H    +R   NVIVL  DG   +QG F EL+
Sbjct: 1217 LPGVLTIAITHSEPMMRACGNVIVL-QDGETAQQGTFDELY 1256

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 118/422 (27%), Positives = 208/422 (49%), Gaps = 39/422 (9%)

Query: 263 GSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTIQSFVAEQSEMHKFNGS 321
            SPLL+    F  ++ +N  KL+     +   S     N  + ++ +  +  E+ KF   
Sbjct: 179 SSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTWSMNAAQLVKLYCTQDFEIKKF--- 235

Query: 322 IRKIFAVGKEAAFINAKFFTTA--SIIGDLSFLVVLS---YGSWLVFQQQLSVGDLTAFM 376
             K   +     FINA F+ +A  SI+  LS  + +    +GS ++ + ++SV  +    
Sbjct: 236 --KEIVIRCNDYFINAWFYVSANTSILRFLSLAMFVQGFWFGSTMIKKNKMSVDQVITCF 293

Query: 377 LYTEYTGNAIFNLSGFFSEIMQGAGAA-SRIFELTDLKPRINPTRGSKF------IPAKG 429
                 G +I N +     ++Q A    +R+ +  + K  +   R  +       +P   
Sbjct: 294 SSCLMLG-SILNTTLPQIVLLQKAHVGLNRVQDFLEDKSEMATDRDRQTSINLDNVPIS- 351

Query: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
             I F  +SF YP+RP   + +N++   +      IVG SG GKST++ LLL +YN   G
Sbjct: 352 --ISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNG 409

Query: 490 QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRS-VAKQC 548
            I ++G ++ ++    + +++ +V+Q+  L + T+R+N+  GL++    E++ S + + C
Sbjct: 410 CIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNNLLIGLSHISAAEDVDSRLQEAC 469

Query: 549 ---FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
                 N I + P   DT +G  G  LSGGQ+QR+A+ARA ++   V+ILDEA SALD  
Sbjct: 470 RFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALARAYLRDTPVVILDEAISALDAR 529

Query: 606 SEGAINYTFGQLMK-----SKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           +         QLM+     ++S T + + H L+ I  S+ + ++ N G + E+G   EL 
Sbjct: 530 NR-------RQLMENIRIWTRSKTAIILTHELNQILPSDFLYLMEN-GQIKEEGYQNELI 581

Query: 661 AN 662
            N
Sbjct: 582 EN 583

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  178 bits (451), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 198/395 (50%), Gaps = 22/395 (5%)

Query: 276 QIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKE 331
           + R ++ K     A++   S   F  +K    F  E+    K++ S+ K       V + 
Sbjct: 281 RFRRDANKADNKAASVALDSLINFEAVKY---FNNEKYLADKYHTSLMKYRDSQIKVSQS 337

Query: 332 AAFINAK---FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFN 388
            AF+N      FTTA     L+ ++ ++     V Q  L+VGDL             +  
Sbjct: 338 LAFLNTGQNLIFTTA-----LTAMMYMACNG--VMQGSLTVGDLVLINQLVFQLSVPLNF 390

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIP-AKGGEIEFKNVSFNYPTRPTV 447
           L   + ++ Q       +F+L   +  I  +  ++ +P  K  +I F+NV+F Y   P  
Sbjct: 391 LGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PER 448

Query: 448 PIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLR 507
            I  N++F I  G    IVGPSG GKSTI  L+  +Y P QG+IL+ G DI  L   SLR
Sbjct: 449 RILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLR 508

Query: 508 RHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGP 567
           + IG+V Q+  L + TI +N+ +G   +   E +R++ K       +   P    T +G 
Sbjct: 509 KAIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGE 567

Query: 568 HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 627
            G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+ +T  Q   S S T V 
Sbjct: 568 RGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVY 627

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
           +AHRL TI  ++ +IVL   GSV E+G    L A+
Sbjct: 628 VAHRLRTIADADKIIVL-EQGSVREEGTHSSLLAS 661

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 143/512 (27%), Positives = 239/512 (46%), Gaps = 33/512 (6%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSI 226
            N+ +  LL   SE  +  LR  ++  +  ++  +F  ++ K  ++ + V ND     R +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDL----RDL 833

Query: 227  TQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLL-LSAKVFGKQIRDNSKK 283
               +S+ + A+  F+  + +G++                 PL+ + + ++G  ++     
Sbjct: 834  RSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETD 893

Query: 284  LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343
             +   A L     +    IKTI+   AE      ++   +K+  +  + A       +  
Sbjct: 894  YKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVT 953

Query: 344  SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
            ++I      ++  YG  LV   + +   +        +T  +  +L G   +I +G  AA
Sbjct: 954  NMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQIPDISRGQRAA 1013

Query: 404  SRIFELTD-----LKPRINPTR----------GSKFIPAKGGEIEFKNVSFNYPTRPTVP 448
            S I+ + D     L+   N  R          G + IP     I  +N+SF YP+ P VP
Sbjct: 1014 SWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPI----ISIRNLSFAYPSAPNVP 1069

Query: 449  IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR 508
            IF++++  +     + IVG SG GKST+A LL   YN     I+IDG D++  +  SLR+
Sbjct: 1070 IFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRK 1129

Query: 509  HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPH 568
             I +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+   P   DT +  +
Sbjct: 1130 QISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN 1189

Query: 569  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 628
              LLSGGQ QR+ IARAL++K  +LILDE TSALD  S   IN    +      +  + I
Sbjct: 1190 --LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLTLVI 1245

Query: 629  AHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
             H    +R   ++ VL + G VVE+G F  L+
Sbjct: 1246 THSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY 1276

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 214/459 (46%), Gaps = 29/459 (6%)

Query: 264 SPLL-LSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI 322
           SP++ + A +F + I   ++K    T+N  ++     N  + ++ +  +  E  KF   I
Sbjct: 185 SPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQPLERQKFQEII 244

Query: 323 RKIFAVGKEAAFINAKFFTTASIIGDLSFLVV------LSYGSWLVFQQQLSVGDLTAFM 376
                +     FI +  +  A+  G L FL +        +GS ++ + +L++ D+    
Sbjct: 245 -----LSCNTFFIKSCLYVAANA-GILRFLTLTMFVQGFWFGSTMIRKGKLNINDVITCF 298

Query: 377 LYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA----KGGEI 432
                 G+ + +       + +G  A  +I  L +   + N +   + +         ++
Sbjct: 299 HSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNFATSDL 358

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
            F+NVSF YP+RP+  + +N+N K   G    IVG SG GKSTI+ LLL++Y+   G IL
Sbjct: 359 VFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSIL 418

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE---------IRS 543
           I+G++  ++  K L  +I +V+Q   L + T++ NI  G T +    +         I+ 
Sbjct: 419 INGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKD 478

Query: 544 VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 603
             +       I   PD  +T IG  G  LSGGQ+QR+AIARA I+   +L LDEA SALD
Sbjct: 479 ACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAVSALD 538

Query: 604 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           +     +        K K+  I++  H LS I   +++ V+  +G VVE G   EL A+ 
Sbjct: 539 IVHRNLLMKAIRHWRKGKTTIILT--HELSQIESDDHLYVM-QEGRVVESGIQSELLADS 595

Query: 664 AXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGE 702
           A             ++A   I  +   ++I    SF+ +
Sbjct: 596 ATTFSKWYYLQNDFSDAKTIINTETEEESIYTTESFNSQ 634

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  177 bits (450), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 162/311 (52%), Gaps = 19/311 (6%)

Query: 362 VFQQQLSVGDLTAFMLYTEYTGNAIFNLS-------GFFSEIMQGAGAASRIFELTDLKP 414
           V +  L+VGDL             IF LS         + E+ Q       +F L   K 
Sbjct: 373 VMEGSLTVGDLVLI-------NQLIFQLSLPLNFLGSVYRELKQSLIDMESLFRLQKNKI 425

Query: 415 RINPTRGSKFIPAK-GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGK 473
            I      + +P K   +I F+NV+F Y   P   I +N  F I  G    IVGPSG GK
Sbjct: 426 TIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKKTAIVGPSGSGK 483

Query: 474 STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
           STI  L+  +Y P QG+ILIDG+DI  +   SLR+ IG+V Q+  L + TI +N+ +G  
Sbjct: 484 STILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFNDTIWENVKFG-R 542

Query: 534 YTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
              + ++I +  ++      I   P   +T +G  G ++SGG+KQR+AI+R L+K   ++
Sbjct: 543 IDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAISRVLLKDCPLM 602

Query: 594 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
             DEATSALD  +E ++  T  +  + +S T V IAHRL TI  ++ +IVL N+  V E+
Sbjct: 603 FFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKIIVL-NNSRVHEE 661

Query: 654 GKFKELFANPA 664
           G  K L   P 
Sbjct: 662 GDHKTLLKTPG 672

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 192/379 (50%), Gaps = 20/379 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + ++ F  E     K++ S+ K       + +  AF+NA     FT+A   
Sbjct: 293 VALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNAGQNFIFTSA--- 349

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
             LS ++ +  G   V    L+VGDL             +  L   + E+ Q       +
Sbjct: 350 --LSAMMYM--GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEAL 405

Query: 407 FELTDLKPRINPTRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVC 464
           F L + K +I+       +P   G  EI+F+NV+F Y TR    I RN +F I  G    
Sbjct: 406 FNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTRRK--ILRNASFTIPAGVKTA 463

Query: 465 IVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTI 524
           IVGPSG GKSTI  L+  +Y+P  G++L++G+D+      S R+ IG+V Q+  L + TI
Sbjct: 464 IVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQDTPLFNDTI 523

Query: 525 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIAR 584
            +N+ +G     T +E+ +  ++      I + P    T +G  G ++SGG+KQR+AIAR
Sbjct: 524 WENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGGEKQRLAIAR 582

Query: 585 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
            L+K   ++  DEATSALD  +E ++  T  +     S T V +AHRL TI  ++ ++VL
Sbjct: 583 VLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTIADADKILVL 642

Query: 645 GNDGSVVEQGKFKELFANP 663
             +G V E+G   EL + P
Sbjct: 643 -EEGCVREEGSHTELLSRP 660

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  179 bits (453), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 204/414 (49%), Gaps = 37/414 (8%)

Query: 266  LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNG----- 320
            +++ + V+G  ++    + +    +L  +  E   GIKTI+    E + + ++       
Sbjct: 848  IVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHM 907

Query: 321  ---SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL---TA 374
               + R+    G   A I A   +  +I+          Y   LV   Q +   +     
Sbjct: 908  RVIASRRAITTGLGVAVIEALAMSIQAIL--------FYYALKLVIDGQYTTKKMFETLT 959

Query: 375  FMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK-PRINP-------TRGSKFIP 426
             +L+T  T N + +      +I +G  AA+RI ++ D K  R  P       T GS  + 
Sbjct: 960  LLLFTIMTCNILISQ---VPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGS--VS 1014

Query: 427  AKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNP 486
                 I  +NV+F YP+ P++ IF +L  ++  G    +VG SG GKST+  LL   Y P
Sbjct: 1015 ESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRP 1074

Query: 487  SQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK 546
            + G +L++ +D++  + + LRR + +V+Q P + SGT+R+N+ YGL + P + E+  V +
Sbjct: 1075 TSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLR 1134

Query: 547  QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
                H+FI++ P   DT I     LLSGGQ QR+ IARA++K+P +LILDE TSALD  S
Sbjct: 1135 YVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFS 1192

Query: 607  EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
               IN    +     +   +SI H +  ++  + +I L N G V   G F  L 
Sbjct: 1193 SHVINNIVRR--GCPAPLTISITHNVDMMKACDEIIFLKN-GRVAGTGSFDALL 1243

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 103/323 (31%), Positives = 167/323 (51%), Gaps = 15/323 (4%)

Query: 351 FLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSE--IMQGAGAASRIFE 408
           F+    +GS ++ + ++++GD+          G+ I   SG   +  I+Q    A  I  
Sbjct: 257 FVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTI---SGTLQQLVIIQKGSVAVNIVS 313

Query: 409 --LTDLKPRINPTRGSKFIP--AKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVC 464
             L D K      R  + +P     G+I F+NV F+YP+RP   + R+++     G    
Sbjct: 314 KFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTF 373

Query: 465 IVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTI 524
           ++G SG GKS+++ LLL +Y    G I +DG++I  +    L ++I +V+Q   + +GT+
Sbjct: 374 LLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTL 433

Query: 525 RDNITYGLTYTPTKE---EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIA 581
           ++NI  G+     +E   +++ V +     NFI    D  +T IG  G  LSGGQ+Q++A
Sbjct: 434 KENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVA 493

Query: 582 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 641
           IARAL+K P +LILDE+ SALDV   G I        K K+  I++  H L+ I  S + 
Sbjct: 494 IARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQI-GSNDF 550

Query: 642 IVLGNDGSVVEQGKFKELFANPA 664
             L   G  +E G  + L  +P+
Sbjct: 551 CYLIESGQCIEHGLEETLVNDPS 573

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 116/337 (34%), Positives = 174/337 (51%), Gaps = 11/337 (3%)

Query: 328 VGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIF 387
           V +  AF+N+      ++I   +  V++  G   +    L+VGDL             + 
Sbjct: 355 VAQSLAFLNSG----QNLIFTSALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLN 410

Query: 388 NLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG---EIEFKNVSFNYPTR 444
            L   + E+ Q       +F+L      I        +  KG     I F+NV+F Y  +
Sbjct: 411 FLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQ 470

Query: 445 PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
               I +N +F+IE G    IVGPSG GKSTI  LL  +Y+P +G+IL++G D       
Sbjct: 471 R--KILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDID 528

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTA 564
           SLR+ IG+V Q+  L + TI +N+ +G     + +EI  V  +      + + P   +T 
Sbjct: 529 SLRKVIGVVPQDTPLFNDTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETI 587

Query: 565 IGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT 624
           +G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T  +  K  S T
Sbjct: 588 VGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRT 647

Query: 625 IVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            V IAHRL TI  ++ +IVL  +G+V E+GK  EL A
Sbjct: 648 SVYIAHRLRTIADADKIIVL-QEGTVREEGKHSELLA 683

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  175 bits (444), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 186/376 (49%), Gaps = 20/376 (5%)

Query: 294 VSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAK---FFTTASII 346
           V+ +     + +++F  E+    K+  S+ K       V +  AF+N+     FTTA   
Sbjct: 292 VALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNSGQNLIFTTA--- 348

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
                  ++  G   +    L+VGDL             +  L   + E+ Q       +
Sbjct: 349 ----LTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESL 404

Query: 407 FELTDLKPRINPTRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVC 464
           F L +    I+     K +PA  G  +I F+NV+F Y   P   I +N +F I  G    
Sbjct: 405 FNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASFVIPAGWKTA 462

Query: 465 IVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTI 524
           +VGPSG GKST+  L+  +Y+P +G+IL++G DI      SLRR IG+V Q+  L + TI
Sbjct: 463 VVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPLFNDTI 522

Query: 525 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIAR 584
            +N+ +G      +E  RS+ K       + R P   +T +G  G ++SGG+KQR+AIAR
Sbjct: 523 WENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGLMISGGEKQRLAIAR 581

Query: 585 ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
            L+K  +++  DEATSALD  +E A+  T        S T V IAHRL TI  ++ +IVL
Sbjct: 582 VLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADADKIIVL 641

Query: 645 GNDGSVVEQGKFKELF 660
             +G   E+G   EL 
Sbjct: 642 -EEGRPREEGTHHELL 656

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 141/510 (27%), Positives = 238/510 (46%), Gaps = 29/510 (5%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSI 226
            N+ +  LL   SE  +  LR  +++ +  ++  +F  +  K  ++ + V ND     R +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDL----RDL 833

Query: 227  TQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSKK 283
               +S+ + A+  FI  + +G++                 PL++  + ++G  ++     
Sbjct: 834  RSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETD 893

Query: 284  LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343
             +   A L     +    IKTI+   AE      ++    K+  +  + A       +  
Sbjct: 894  YKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMT 953

Query: 344  SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
            ++I      ++  YG  LV   + +   + A      +T  +   L G   +I +G  AA
Sbjct: 954  NMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQRAA 1013

Query: 404  SRIFELTD-----LKPRINPTR------GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRN 452
            S I+ + D     L+   N  R      G+ +  +    +  +N++F YP+ P + I++ 
Sbjct: 1014 SWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKR 1073

Query: 453  LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGI 512
            ++  +  G  V IVG SG GKST+  LL   Y    G I IDG D++  +  SLRR I +
Sbjct: 1074 MDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISV 1133

Query: 513  VQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLL 572
            V+Q+P L  G+IRDN+TYG        E+    K    ++F+   P + DT I  +  LL
Sbjct: 1134 VEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LL 1191

Query: 573  SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAH 630
            SGGQ QR+ IARAL++K  +LILDE TSALD  S   IN     ++K    ++  + I H
Sbjct: 1192 SGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPPALLTMVITH 1247

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
                +R   +V+V   DG +VE+G F  L+
Sbjct: 1248 NEEMMRCCSSVVVF-KDGKIVEEGSFDTLY 1276

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 197/419 (47%), Gaps = 29/419 (6%)

Query: 264 SPLL-LSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI 322
           SP++ L A  F + I   +KK    T    ++     N  + ++ +  +  E  KF   +
Sbjct: 185 SPIIALFAVAFCRMIHIYTKKENTETGKAAQLLTWSMNAAQLVRLYCTQPLERKKFEEIV 244

Query: 323 RKIFAVGKEAAFINAKFFTTASIIGDLSFLVV------LSYGSWLVFQQQLSVGDLTAFM 376
                      FI + F+  A+  G L FL +        +GS ++ + +L++ D+    
Sbjct: 245 SNC-----NTFFIKSCFYLAANA-GVLRFLTLTMFVQGFWFGSTMIRKGRLNINDVITCF 298

Query: 377 LYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF----IPAKGGEI 432
                 G  + N       + +G  A  +I  L +  P+ N +   +     I    G++
Sbjct: 299 HSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGPKRNTSNTIELYQPLIDYATGDL 358

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
            F+NVSF YP+RPT  I +N   K   G    IVG SG GKSTI+ LLL +Y+   G I 
Sbjct: 359 VFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSGSGKSTISNLLLKFYDGYDGSIS 418

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE---------IRS 543
           I+G++I  +  KSL  +I +V+Q   L + T+++NI  G T +    +         I+ 
Sbjct: 419 INGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILLGSTGSIRNADSNTIDNNNLIKE 478

Query: 544 VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 603
             +       I   PD  +T IG  G  LSGGQ+QR+AIARA I+   +L LDEA SALD
Sbjct: 479 ACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRVAIARAFIRDTPILFLDEAISALD 538

Query: 604 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
           +     +        K K+  I++  H+LS I  +++ + L  DG V+E G   EL  +
Sbjct: 539 IVHRNLLMKAIRHWRKGKTTIILT--HQLSQI-EADDYLYLMQDGKVIESGIQSELLVD 594

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 141/512 (27%), Positives = 247/512 (48%), Gaps = 33/512 (6%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRS 225
            +N+++  +L   SEN +  LR   ++ I+++D  +F  DT K  +L + + ND   +   
Sbjct: 774  SNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSL 833

Query: 226  ITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSKKL 284
            +++ +S      F+  + +G++                 PL+++ + V+G  ++      
Sbjct: 834  VSEFLS--AMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTY 891

Query: 285  QEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTAS 344
            +   A L     E   GIKTI+S  AE   +  ++G    + A+  + +       +  +
Sbjct: 892  KTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTN 951

Query: 345  IIGDLSFLVVLSYGSWLVFQQQLS---VGDLTAFMLYTEYTGNAIFNL----------SG 391
            +I      ++  YG  LVF+ + S   + +    +L+T  T  ++ N           + 
Sbjct: 952  MITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSAT 1011

Query: 392  FFSEIM-QGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIF 450
            F   I+ +G  +    FE       + P + SK  P     I+ +N++F YP+   V ++
Sbjct: 1012 FLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPL----IKIQNLTFAYPSETNVNVY 1067

Query: 451  RNLNFKIEQGS-NVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
             +LN ++      + +VG SG GKST+ +LL   Y  +   I +DG D++     +LR  
Sbjct: 1068 EDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQ 1127

Query: 510  IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
            I +V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P   DT I    
Sbjct: 1128 ISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK- 1186

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS--KSMTIVS 627
             LLSGGQ QRI IARAL++KP +LILDE TSALD  S   I      ++K+   ++  + 
Sbjct: 1187 -LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIV 1241

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            I H    +R    + VL N G ++E+G FKEL
Sbjct: 1242 ITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 426 PAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
           PA+   I F N++F+YP+RP+ P+ +N++   E      I+G SG GKST++ LLL +Y+
Sbjct: 351 PAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYD 410

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT------YTPTKE 539
              G I + G D+  ++   L  ++ +V+Q   L + T+R+NI  G++      +   ++
Sbjct: 411 DYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQ 470

Query: 540 EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEAT 599
           +++           +   P   +T IG  G  LSGGQ+QR+AIARA ++   +LILDEA 
Sbjct: 471 KLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAV 530

Query: 600 SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           SALD+     +     Q    K  T + + H LS I   +   V+  +G V E G  K+L
Sbjct: 531 SALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKENGYQKDL 587

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 143/504 (28%), Positives = 239/504 (47%), Gaps = 21/504 (4%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRS 225
            +N+ +  LL I SE  +  LR   +K I+ +  Q+F  + Y+  ++ + + ND     R 
Sbjct: 785  SNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDL----RD 840

Query: 226  ITQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSK 282
            +   +S+ + A+  FI  +  G++                 PL++  + ++G  ++ +  
Sbjct: 841  LRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSET 900

Query: 283  KLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT 342
              +   ANL  +  +  + IKTI+S   E    H +  +  K+  V  + +       + 
Sbjct: 901  DYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISI 960

Query: 343  ASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGA 402
             + I      ++  YG  L+   + +V  +        +T     +L     ++ +G  A
Sbjct: 961  TNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRA 1020

Query: 403  ASRIFEL----TDLKPRINPTR---GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNF 455
            AS ++ +     D K   +P      +  I      ++ KN++F Y + P++ +   L  
Sbjct: 1021 ASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTL 1080

Query: 456  KIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQ 515
            K+  G  + I G SG GK+T+  LL+ +Y+    QI  +G+DI     +SLR  I IV+Q
Sbjct: 1081 KLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQ 1140

Query: 516  EPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGG 575
            +P ++SG+IRDN+        +  E+  V K     +FI   P   DT I    TLLSGG
Sbjct: 1141 KPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGG 1198

Query: 576  QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 635
            Q QRI IARAL++KP +LILDE TSALD  S   IN    + +    +TI+SI H  S +
Sbjct: 1199 QAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESMM 1256

Query: 636  RRSENVIVLGNDGSVVEQGKFKEL 659
               +NV VL N G +VE G +  L
Sbjct: 1257 TSCQNVAVLKN-GKIVEVGTYDSL 1279

 Score =  162 bits (410), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 198/401 (49%), Gaps = 29/401 (7%)

Query: 282 KKLQEVTANLTRVSEEQFN----GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINA 337
           +K   +  N T VS + F      I+ I+    +  ++ KF  SI K         FI  
Sbjct: 205 QKFANLENNETTVSAQIFTETIQNIQLIKLNNLQLKKLMKFQTSISKC-----NKFFIQM 259

Query: 338 KFFTT--ASIIGDLSFLVVLS---YGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
             + +   SI+  L+ L+ +    +GS ++ +  L + ++          G+ I N    
Sbjct: 260 CLYVSLNTSILRTLTLLMFVQGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQ 319

Query: 393 FSEIMQGAGAASRIFELTDLKPRINPTR-GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFR 451
              + +G  A  +I +  D     +P    S  I      I F+N+SF YP+RP   I  
Sbjct: 320 IVVLQKGEVALQKIVDFLDEAD--DPLEINSAPITLINSNISFQNISFAYPSRPNENILN 377

Query: 452 NLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIG 511
            +N   +  +   IVG SG GKST++ LLL +Y   +G ILID  +I  L+ K+L  +I 
Sbjct: 378 QINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIM 437

Query: 512 IVQQEPILMSGTIRDNITYGLT-----YTPTK----EEIRSVAKQCFCHNFITRFPDTYD 562
           IV+Q+  L + TIR+NI +G++     Y   +    E +++        +F+   P+  D
Sbjct: 438 IVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGID 497

Query: 563 TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKS 622
           T IG  G  LSGGQ+QR+A+ARA ++ P +LILDEA SALDV     +     +L +S  
Sbjct: 498 TVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNK 556

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
            TI+ + H L+ I   + + V+ + G ++E GK KEL  +P
Sbjct: 557 TTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITDP 595

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 143/500 (28%), Positives = 227/500 (45%), Gaps = 17/500 (3%)

Query: 170  YVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSIT 227
            +++   L   SE  +  LR   I+ I  QD  +F  D  K  ++ + V ND   +   ++
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVS 867

Query: 228  QKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEV 287
            + +S     + + S G+ +               +    +L +  +G  ++      +  
Sbjct: 868  EFLSSISTLIIVSSVGI-VWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTK 926

Query: 288  TANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIG 347
             A L     E F GI TI+    E   + K+    +K+    K+ A I   F   AS   
Sbjct: 927  VAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRA-ITIGFGVAASNTL 985

Query: 348  DLSFLVVL-SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
             L+   +L  YG  LV     S   +        +T     +L G   +I +G  AA+ I
Sbjct: 986  TLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQIPDISRGQRAATYI 1045

Query: 407  FELTDLKPRINPTRGSKFIPAKGGE---IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463
            F + D +         K    K      I  KN+SF+YP+ P+  I++ L   +  G  +
Sbjct: 1046 FRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETI 1105

Query: 464  CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
             +VG SG GKST+  L+   Y    G I IDG DI+   T  LR  I +V+Q+P    GT
Sbjct: 1106 AVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGT 1165

Query: 524  IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIA 583
            + +N+ YG++   T+ +++         +F+   P+  DT I    +L+SGGQ QR++IA
Sbjct: 1166 VGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIA 1223

Query: 584  RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSENV 641
            RA+++KP +L LDE TSALD  +  AI      L+K     +T + I H    +R  E +
Sbjct: 1224 RAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERI 1279

Query: 642  IVLGNDGSVVEQGKFKELFA 661
             VL N G V E G F +L+A
Sbjct: 1280 AVLQN-GKVAEDGSFDDLYA 1298

 Score =  145 bits (366), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 120/412 (29%), Positives = 188/412 (45%), Gaps = 29/412 (7%)

Query: 263 GSPLLLSAKVFGKQIRDNSKKLQEV-TANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGS 321
           G P+++   V   ++ +   +L+ + ++   ++    F+  + I+ F  +Q E+ KF  S
Sbjct: 187 GVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQQFEIEKFELS 246

Query: 322 IRKI------FAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAF 375
           ++K        ++   A++   +FFT    I    F      G+ ++ Q  L+ GD+   
Sbjct: 247 VKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWF------GNKMIRQGVLTTGDVITC 300

Query: 376 MLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELT----DLKPRINPTRGSKFIPAK--- 428
                  GN + N       + +G  A  +I   T    D     N      FI      
Sbjct: 301 FSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFILNHINA 360

Query: 429 -----GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
                GGEI FKNVSF+YPTRP   + +N++    +     IVG SG GKSTI  LLL  
Sbjct: 361 NKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKS 420

Query: 484 YNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE-IR 542
           Y    G I +DG DI  + T  L  +I +V+Q   L + TI++NI  G       +  +R
Sbjct: 421 YGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVR 480

Query: 543 SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 602
              +       I   P+  DT +G  G  LSGGQKQR+A+ARA ++   +LILDEA S +
Sbjct: 481 EACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGM 540

Query: 603 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           D+     +     +    K MT V + H L+ I   E+ +    +G + E G
Sbjct: 541 DIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESG 589

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 185/365 (50%), Gaps = 14/365 (3%)

Query: 303 KTIQSFVAEQSEMHKFNGSIRKI----FAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358
           + ++ F  E    +K++ S+ K       V +  AF+N+      S+I   +   ++  G
Sbjct: 334 EAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNSG----QSLIFTTALTGMMYMG 389

Query: 359 SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP 418
              V    L+VGDL             +  L   + E+ Q       +F+L   + +I  
Sbjct: 390 CTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNQVKIQN 449

Query: 419 TRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTI 476
               K I    G  EI+F+NV+F Y  +    I +N +F I  G    I GPSG GKST+
Sbjct: 450 CSQPKSISKSDGPFEIKFENVTFGYDGQR--KILKNASFTIPAGMKTAIAGPSGSGKSTV 507

Query: 477 AWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
             L+  +Y+P +G++L++G D+       LR+ IG+V Q+  L + TI +N+ +G     
Sbjct: 508 LKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVKFG-RIEA 566

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILD 596
           + EEI  V  +    + I + P    T +G  G ++SGG+KQR+AIAR L+K   ++  D
Sbjct: 567 SDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFD 626

Query: 597 EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKF 656
           EATSALD  +E ++  T  +   S   T V IAHRL TI  ++ +IVL  +G+V E+G  
Sbjct: 627 EATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EEGTVREEGTH 685

Query: 657 KELFA 661
           +EL A
Sbjct: 686 QELLA 690

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  171 bits (433), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 131/398 (32%), Positives = 198/398 (49%), Gaps = 26/398 (6%)

Query: 276 QIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRK----IFAVGKE 331
           Q R ++ K     A++   S   F  +K    F  E    +K++ S+ +       V + 
Sbjct: 313 QFRRDANKADNKGASVALDSLINFEAVKY---FNNETYLSNKYHDSLLQYRDSTIKVAQS 369

Query: 332 AAFINAK---FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFN 388
            AF+N+     FT+A     L+ ++ L  G   V +  L+VGDL             +  
Sbjct: 370 LAFLNSGQNLIFTSA-----LTMMMYL--GCTGVIEGNLTVGDLVLINQLVFQLSVPLNF 422

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRI-NPTRGSKFIPAKGG----EIEFKNVSFNYPT 443
           L   + E+ Q       +F+L     +I N   G   I  K      EI+F+NV+F Y T
Sbjct: 423 LGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDT 482

Query: 444 RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALST 503
                I +N +F I  G    +VGPSG GKSTI  L+  +Y+P +G++LI+G ++     
Sbjct: 483 NR--KILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDI 540

Query: 504 KSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDT 563
            SLRR +G+V Q+  L + TI +N+ +G       EEI+ V ++      I + P    T
Sbjct: 541 DSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKT 599

Query: 564 AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 623
            +G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T      S + 
Sbjct: 600 IVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTR 659

Query: 624 TIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
           T + IAHRL TI  ++ +IVL  DG V E+G   EL A
Sbjct: 660 TSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLA 696

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  170 bits (431), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 185/368 (50%), Gaps = 20/368 (5%)

Query: 303 KTIQSFVAEQSEMHKFNGSI----RKIFAVGKEAAFINAK---FFTTASIIGDLSFLVVL 355
           + ++ F  EQ   +K+  S+         V +  AF+N+     FT+A          ++
Sbjct: 319 EAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSA-------LTAIM 371

Query: 356 SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR 415
             G   V    L+VGDL             +  L   + E+ Q       +F+L   + +
Sbjct: 372 YLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEIK 431

Query: 416 INPTRGSKFIPAKGG--EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGK 473
           I        +P +    EI+F+NV+F Y       I +N +F I  G    +VGPSG GK
Sbjct: 432 IQNVHRPLMLPNELTPFEIKFENVTFGYDKER--KILKNASFTIPAGWKTAVVGPSGSGK 489

Query: 474 STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
           STI  L+  +Y+P +G+IL++G DI  +   SLR+ IG+V Q+  L + TI +N+ +G  
Sbjct: 490 STILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFGRI 549

Query: 534 YTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
                E ++++ K       I + P   +T +G  G ++SGG+KQR+AIAR L+K   ++
Sbjct: 550 EATDNEILQAIEKAQLAP-LIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSGIM 608

Query: 594 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
             DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL  DG V E+
Sbjct: 609 FFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEE 667

Query: 654 GKFKELFA 661
           G  ++L A
Sbjct: 668 GTHRQLIA 675

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 236/507 (46%), Gaps = 24/507 (4%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTY--KVGDLISRVGNDAFIVSRS 225
              + +  ++   SE  +  LR  V++ I +   ++F     K  ++ +   ND   +   
Sbjct: 766  CTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTL 825

Query: 226  ITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQ 285
            +T+ ++     + + + G+ +               M   +++ + V+G  ++      +
Sbjct: 826  VTEFLATASTFLVVSTCGL-IWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYK 884

Query: 286  EVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASI 345
               A L     E    +KTI+    +    ++++   +++ ++G+  + I          
Sbjct: 885  SAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHT 944

Query: 346  IGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASR 405
            +      ++  YG  LV   + +   +        +T     NL     E+ +G  AA+ 
Sbjct: 945  LTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATY 1004

Query: 406  IF----------ELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNF 455
            I+          E  D+  R  P   +     K   +  K+++F YP  P+  ++ +LN 
Sbjct: 1005 IYRILKEAAATREHQDMHNRTLPISNT---SEKDTMVLVKDLTFAYPATPSKHVYEHLNL 1061

Query: 456  KIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQ 515
             ++  ++V +VG SG GKSTI  LL   Y+  +  I +DG D+S   T SLR  I +V+Q
Sbjct: 1062 NLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQ 1121

Query: 516  EPILMSGTIRDNITYGLTYTPTKE-EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSG 574
               L++GTIR+N+TYGL    T E ++  + K    ++F++R P+  DT +     LLSG
Sbjct: 1122 SANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSG 1179

Query: 575  GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLS 633
            GQ QR+ IARAL+K   +LILDE TSALD  S    N     + K    T I++I H   
Sbjct: 1180 GQAQRLCIARALVKPHRILILDECTSALDALST---NIIIDIVRKGIPNTLIIAITHDEH 1236

Query: 634  TIRRSENVIVLGNDGSVVEQGKFKELF 660
             +R  E+V++L N G++VEQG F EL 
Sbjct: 1237 MMRSCESVLLLKN-GAIVEQGSFVELM 1262

 Score =  139 bits (349), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/380 (27%), Positives = 180/380 (47%), Gaps = 28/380 (7%)

Query: 298 QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT--ASIIGDLSFLVVL 355
           +FN +  ++ + A+  E+ KF+ S+ +       + FI A  ++   +SII  L+  + +
Sbjct: 210 RFNDM--VKFYTAQNEEISKFDTSVTRC-----NSLFIKACLYSALNSSIIRFLTLCMFV 262

Query: 356 S---YGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
               +G+ ++ + +L + D+          G  +       + I +G  A  ++    +L
Sbjct: 263 QGFWFGATMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLEL 322

Query: 413 KPRINPTRGSKFIPAKGGE--IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSG 470
           + +       K  P KG    I F N+SF YP R +     N++ ++E G    I+G SG
Sbjct: 323 EGKTIMQAALK-CPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSG 381

Query: 471 KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
            GKST+A LLL +Y    G I +D   I  L+ + L  +I +V+Q   L + T+R+NI  
Sbjct: 382 SGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILL 441

Query: 531 G-------LTYTPTKEEIRSVAKQC---FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRI 580
           G             +E  R + K C     +  +    D  DT IG  G  LSGGQ+QR+
Sbjct: 442 GSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRV 501

Query: 581 AIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 640
           A+ARA ++   ++I DE+ SALDV     +        + K  T + + H LS I  ++ 
Sbjct: 502 ALARAFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDF 559

Query: 641 VIVLGNDGSVVEQGKFKELF 660
           + ++ + G V E G  ++L 
Sbjct: 560 IYIMEH-GRVCEYGYQEDLL 578

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  170 bits (431), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 125/409 (30%), Positives = 196/409 (47%), Gaps = 27/409 (6%)

Query: 266  LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI 325
            L++ + ++G  ++    + +   A L  V  E   G+KTI+    E     KFN   +  
Sbjct: 863  LVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTA 922

Query: 326  FAVGKEAAFINAKFFT-----TASIIGDLSFLVVLSYGSWLVFQQQLSVGDLT---AFML 377
              +G+  A +           T SI G L +     Y   LV   + +   +      +L
Sbjct: 923  KLMGQRRAIVTGFGVAVSNGLTMSIQGILYY-----YAIKLVIHGEYTTKKMFETFTLLL 977

Query: 378  YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTD--LKPRINPTRGSKFIPA----KGGE 431
            +T  T N   NL     +I +G  AAS+I+ + +   +     T G + +P      G  
Sbjct: 978  FTIMTCN---NLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPI 1034

Query: 432  IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
            I F ++SF YPT PTV I ++L+ +I  G  + IVG SG GKST+  ++   Y      +
Sbjct: 1035 IRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSL 1094

Query: 492  LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 551
             +D  D++  +   LR  I +V+Q+P L  GTIR+N+ YG        ++ ++ K    +
Sbjct: 1095 FVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIY 1154

Query: 552  NFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611
            +F    P+  +T I     LLSGGQ QR+ IARAL+++P +LILDE TSALD  S   IN
Sbjct: 1155 DFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIIN 1212

Query: 612  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
                +     +M  +SI H    +R    V VL + G +VE G  ++L 
Sbjct: 1213 EIIRE--GPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL 1258

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 137/235 (58%), Gaps = 6/235 (2%)

Query: 431 EIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQ 490
           +IE +NV FNYP+RPTVP  +N++  +  G    +VG SG GKS++  LLL  Y+   G 
Sbjct: 345 KIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGS 404

Query: 491 ILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPT---KEEIRSVAKQ 547
           I IDG DI  +  KS+ ++I +V+Q   L + T+R+NI +G   T      E +++  + 
Sbjct: 405 ISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRI 464

Query: 548 CFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESE 607
               NFI   P+  DT IG  G   SGGQ+QRIAIARA ++   +L+LDEA SALD+   
Sbjct: 465 SLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHR 524

Query: 608 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
           G +        +S+  TI+ + H LS I   +++I L  DG VVEQG+ + L  N
Sbjct: 525 GLLMNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLN 576

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  170 bits (431), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 133/508 (26%), Positives = 242/508 (47%), Gaps = 25/508 (4%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSI 226
            N++++ +L   SE  +  LR  +++ +  +  +++   + K  ++ +   ND   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 227  TQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSKKLQ 285
            T+ +S    + F+  + +G++                 PL++  + ++G  +++     +
Sbjct: 799  TEFLS--TMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYK 856

Query: 286  EVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASI 345
               A+L  +  E    IKTI+        +  ++   +K+  + K+   +     +  + 
Sbjct: 857  SAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTT 916

Query: 346  IGDLSFLVVLSYGSWLVFQQQLSVGDLT---AFMLYTEYTGNAIFNLSGFFSEIMQGAGA 402
            I      ++  YG  LV   + +   +      +L+T  T N+   L     ++ +G  A
Sbjct: 917  ITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNS---LVSQIPDVSRGQRA 973

Query: 403  ASRIFELTDLKPRINPTRGS----KFIPAKGGE---IEFKNVSFNYPTRPTVPIFRNLNF 455
            AS +  + D         G     + I  +      IE +N++F+YP  P V ++++LN 
Sbjct: 974  ASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLNL 1033

Query: 456  KIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQ 515
            KI  G  + +VG SG GKST+ +LL   Y+    +ILI+G DI+  S   LR  I +V+Q
Sbjct: 1034 KINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQ 1093

Query: 516  EPILMSGTIRDNITYGLT-YTPTKE-EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLS 573
            +P L  GTIR+NITYG++   P  E E++ + +    H F+   P   DT +     LLS
Sbjct: 1094 KPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDIG--LLS 1151

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA--HR 631
            GGQ QR+ I R L++KP VLILDE TS+LD ++   +      L       I++I   H 
Sbjct: 1152 GGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVITHN 1211

Query: 632  LSTIRRSENVIVLGNDGSVVEQGKFKEL 659
               ++    ++VL + G VVE G+F +L
Sbjct: 1212 RQMMQCCSRLVVL-DVGRVVEDGQFDDL 1238

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 206/412 (50%), Gaps = 25/412 (6%)

Query: 264 SP-LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI 322
           SP +++ A  F + I+  +    + TA    +     +  +T++    +  E+ KF   +
Sbjct: 177 SPFIIVCAACFSRFIQKYASFENKETAAAADLLMWTMDSSQTVKLSCTQSKEIKKFETLV 236

Query: 323 RKIFAVGKEAAFINAKFFTTASIIGDLSFLVV------LSYGSWLVFQQQLSVGD-LTAF 375
            K         FI    FT A+I G L FL +        +GS ++ + +L++ D +T F
Sbjct: 237 SKC-----NDYFIRTSLFTAANI-GILRFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF 290

Query: 376 MLYTEYTGNAIFNLSGFFSEIMQ-GAGAASRIFELTDLKPRI-NPTRGSKFIPAKGGEIE 433
             Y+     +I N +      +Q G  A ++I +  +  P + + T  S  +     +I 
Sbjct: 291 --YSCLMLGSILNTTLHHVIFIQKGQVALAKIQKFINESPELPSKTLTSSGLVYSHVDIS 348

Query: 434 FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI 493
             N++F YP+RPT  + +N++ KI+      IVG SG GKSTI  L++ +Y   +G I++
Sbjct: 349 IDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIV 408

Query: 494 DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE---IRSVAKQCFC 550
             +DI ++    L ++I +V+Q   L + T+++NI  G  YT        + S+      
Sbjct: 409 GDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNILLGSKYTSQTINDGLLSSICSLACL 468

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
            + I+  PD  +T +G  G  LSGGQ+QR+A+ARA ++   +LILDEA SALD+     +
Sbjct: 469 DSVISSLPDGIETRLGTDGITLSGGQQQRVALARAFLRDTDILILDEAVSALDIMQREIL 528

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
                ++ ++K+  I++  H L+ I  ++ + +  N+   +++  FK+   N
Sbjct: 529 MRNISKVRQNKTTIILT--HDLNQINDNDYIYLFENNE--IKENGFKKTLMN 576

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/501 (26%), Positives = 236/501 (47%), Gaps = 18/501 (3%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
            N++++ LL  +SE  V +LR N+++ ++ +D  +    K  ++ +   ND   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 229  KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSA-KVFGKQIRDNSKKLQEV 287
             +S       + S  VG++                 PL +    ++G  ++ +  + +  
Sbjct: 838  LLSSLTSLCVLAS--VGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTA 895

Query: 288  TANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIG 347
             + L  +  E   G+KTI+    E     ++    + +    +  + +        S + 
Sbjct: 896  VSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLV 955

Query: 348  DLSFLVVLSYGSWLVFQQQLSVGDL-TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
             L   ++  YG  LV   +     L   F L    T +++  LS   S   +G  A + +
Sbjct: 956  ILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSS-SRGQRAGTFV 1014

Query: 407  FELTDLKPRINPTRGSKFIP-------AKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQ 459
            F + + +P   P   S  +        ++   +  + ++F YP    V I++N N +I Q
Sbjct: 1015 FGMLE-EPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQ 1073

Query: 460  GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
            G+ V IVG SG GKST+ +L+   Y      + IDG DI      +LR+ I +V+Q+P  
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRF 1133

Query: 520  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQR 579
             +GTIR+N+ YGL  T T  EI  V  +    NF+   P+  +T +  +  L+SGGQ QR
Sbjct: 1134 FNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQR 1191

Query: 580  IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 639
            ++I RAL+++PT+LILDE TSALD  +  AI       +    +T++ I H    ++  +
Sbjct: 1192 LSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCD 1249

Query: 640  NVIVLGNDGSVVEQGKFKELF 660
             ++VL N G+V E G F +LF
Sbjct: 1250 RIVVLKN-GAVAEDGSFDDLF 1269

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 109/408 (26%), Positives = 188/408 (46%), Gaps = 26/408 (6%)

Query: 272 VFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI---RKIFAV 328
           VF K ++  +    E T++ +       N    ++ F  +  E+ KFN ++   +K F  
Sbjct: 191 VFSKFVQKYAALENEQTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVR 250

Query: 329 GKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFN 388
               + IN       S+   + F+    YGS L+ + ++    +      +    ++I  
Sbjct: 251 TLICSSINQAAMRFLSL---MMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINA 307

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGG----------EIEFKNVS 438
           +      + +G  A  +I E  +++P   P + +   P + G          EI F  VS
Sbjct: 308 MLSKVVLLQKGKVACRQIAEAVNVEPEGRPNQYA--FPYEVGHIIALEDQPSEIVFDQVS 365

Query: 439 FNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDI 498
           FNYP RP       ++          IVG SG GKST+  LLL +Y+  +G I ++  ++
Sbjct: 366 FNYPARPDTKALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNL 425

Query: 499 SALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC---FCHNFIT 555
             +    L ++I +V+Q   L +GT+ +NIT  L+  P  +   +V + C        + 
Sbjct: 426 RGIDRSWLLQNITLVEQSCTLFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVF 483

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
             P+   T +G  G  +SGGQ+QR+A+ARA+++   VLILDEA SALD+     +     
Sbjct: 484 DLPEGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIR 543

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
                K+  I++  H LS +   ++ + +   G V+EQG   EL +NP
Sbjct: 544 SWRADKTTIILT--HELSHV-LDDDYLYMMEHGQVIEQGYKSELLSNP 588

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
            YKL209C
          Length = 1293

 Score =  164 bits (415), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 192/408 (47%), Gaps = 17/408 (4%)

Query: 266  LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI 325
            ++L + ++G  ++      +   A L     E    IKTI+   A +  +  +      +
Sbjct: 880  IILVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNL 939

Query: 326  FAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNA 385
              +  + +       +  + I      ++  YG  LVF+ + S   +        +T  +
Sbjct: 940  KKIAHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIIS 999

Query: 386  IFNLSGFFSEIMQGAGAASRIF----ELTDLKPRINPTRGSKFIPAKGGE-----IEFKN 436
              +L     +I +G  AAS ++    E  D K  ++    S  I   G       I  KN
Sbjct: 1000 CTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKN 1059

Query: 437  VSFNYPTRPTVPIFRNLNFKIEQGS-NVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
            + F+YP+  TV I++N+   +      + IVG SG GKST+ +LL   Y      I IDG
Sbjct: 1060 LRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDG 1119

Query: 496  QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 555
             D++   T  LR+ I +V+Q P L  GT+RDN+ YG     ++ EI  V K    + FI 
Sbjct: 1120 TDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIE 1179

Query: 556  RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
              P   D+ I     L+SGGQ QR+ IARAL++KPT+LILDE TSALD  S   IN    
Sbjct: 1180 NLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN---- 1233

Query: 616  QLMKSKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVVEQGKFKELFAN 662
             L+K+   T+++I    S  +  + N + +  DG + EQG F EL  N
Sbjct: 1234 NLVKNGLPTVLTIVITHSKQMMEACNSLAVIKDGRLAEQGNFAELMKN 1281

 Score =  160 bits (405), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 119/414 (28%), Positives = 197/414 (47%), Gaps = 26/414 (6%)

Query: 266 LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI 325
           ++L A +F   I   ++     T    ++     N  + ++ +  +  E+H F   + + 
Sbjct: 187 IILFAILFSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQAYEIHSFKELVGQC 246

Query: 326 FAVGKEAAFINAKFFTTA--SIIGDLS---FLVVLSYGSWLVFQQQLSVGDLTAFMLYTE 380
                   FI + F+ +A  SI+  LS   F+    +G+ +V + +LS+ D+        
Sbjct: 247 -----NDLFIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGKLSIKDVITCFHSCL 301

Query: 381 YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF---IPAKGGEIEFKNV 437
             G+ + N       + +G  A  +I +      R +P+    +   +P   GEI F+N+
Sbjct: 302 MLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQR-SPSLEPPYEPSVPISNGEISFQNI 360

Query: 438 SFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497
           SF YPTRP   + ++++   + G +  I+G SG GKST+A LLL +YN  QG I I   +
Sbjct: 361 SFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLKFYNDYQGSIKIGNTN 420

Query: 498 ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE---------IRSVAKQC 548
           +  ++   L  +I +V+Q   L + T+R+N+  G++ +  K E         ++   +  
Sbjct: 421 VKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQDDIEISQRLKDACRIA 480

Query: 549 FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 608
                I   PD  DT IG  G  LSGGQ+QR+AIARA IK  +VLILDEA SALD+    
Sbjct: 481 MLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVLILDEAVSALDIIHRE 540

Query: 609 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            I          K+  I++  H LS +   + + V   DG V E G  + L  +
Sbjct: 541 LIMKAIKNWRSGKTTIILT--HDLSQLDYDDFLYVF-EDGEVKESGYQQALLQD 591

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  164 bits (415), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 195/412 (47%), Gaps = 28/412 (6%)

Query: 270 AKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVG 329
           A  F + +   S+K  E T+   ++     N  + ++ +  +  E  KF    R I +  
Sbjct: 217 AVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERKKFQ---RIILSCN 273

Query: 330 KEAAFINAKFFTTASIIGDLSFLVV------LSYGSWLVFQQQLSVGDLTAFMLYTEYTG 383
               FI +  F  A+  G L FL +        +GS ++ Q +L++ D+          G
Sbjct: 274 --TFFIKSCLFVAANA-GILRFLTLTMFVQGFWFGSTMIKQGKLNINDVITCFHSCILLG 330

Query: 384 NAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF----IPAKGGEIEFKNVSF 439
           + + N       + +G  A  +I  L +  P+ NP    +     +     ++ F NVSF
Sbjct: 331 STLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPLDYANSDLVFDNVSF 390

Query: 440 NYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDIS 499
           +YP+RP+  +  N + K   G    IVG SG GKST++ LLL +Y+   G I I+G++I 
Sbjct: 391 SYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQ 450

Query: 500 ALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT-------YTPTKEE--IRSVAKQCFC 550
           A+  K L ++I +V+Q   L + T+R NI  G T       Y+  K    I+   +    
Sbjct: 451 AIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALL 510

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
              I   PD  +T IG  G  LSGGQ+QR+A+ARA I+   +L LDEA SALD+     +
Sbjct: 511 DRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLL 570

Query: 611 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
                   K K+  I++  H L  +  S++ + L  +G V+E G   EL A+
Sbjct: 571 MKAIRHWRKGKTTIILT--HELGQV-ESDDHLYLMQEGKVIESGTQSELLAD 619

 Score =  160 bits (404), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 144/515 (27%), Positives = 240/515 (46%), Gaps = 35/515 (6%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSI 226
            N+ +  LL   SE  +  LR  V++ +  +   +F  +  K  ++ + V ND     R +
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDL----RDL 858

Query: 227  TQKISDGVKAV--FIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLS-AKVFGKQIRDNSKK 283
               +S+ + A+  FI  + +G++                 PL++  + ++G  ++ +   
Sbjct: 859  RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETD 918

Query: 284  LQEVTANLTRVSEEQFNGIKTIQSFVAE---QSEMHKFNGSIRKIFAVGKEAAFINAKFF 340
             +     L     +    IKTI+   AE   Q   HK    + +I     + A       
Sbjct: 919  YKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQI---ASKRAIATGFGI 975

Query: 341  TTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA 400
            +  ++I      ++  YG  LV   + +   +        +T  +  +L     +I +G 
Sbjct: 976  SMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQ 1035

Query: 401  GAASRIFELTD-----LKPRINPTRGSKFIPAKGGE------IEFKNVSFNYPTRPTVPI 449
             AAS I+ + D     L+   N  R    I     E      +  +N++F YP+ P+V I
Sbjct: 1036 RAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPSAPSVLI 1095

Query: 450  FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
            ++N+N  +  G  + IVG SG GKST+  LL   Y+   G I +DG D++  +   LRR 
Sbjct: 1096 YKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRRE 1155

Query: 510  IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
            I +V+Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P    T I  + 
Sbjct: 1156 ISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN- 1214

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVS 627
             LLSGGQ QR+ IARAL++KP +LILDE TSALD  S   I     +++K    ++  + 
Sbjct: 1215 -LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKGPPALLTLV 1269

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            I H    +R  +++ V   DG V+E+G F  L+ N
Sbjct: 1270 ITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNN 1303

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  160 bits (405), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 142/509 (27%), Positives = 249/509 (48%), Gaps = 29/509 (5%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFD--TYKVGDLISRVGNDAFIVSRS 225
            + +++  +L   SE  + +LR + +  I  +   +F   T    +L S + ND   +   
Sbjct: 761  STFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDLRGL 820

Query: 226  ITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGK--QIRDNSKK 283
             ++ +S     VF+ S G+ +               +    +L + ++G   Q+ + + K
Sbjct: 821  ASEFLSAITTLVFVASIGL-IWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAYK 879

Query: 284  LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343
              E+    TRV E   + +KTI+    +Q     F   + K+  V K+ +          
Sbjct: 880  -TEIAELETRVHELVIS-MKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVT 937

Query: 344  SIIGDLSFLVVLSYGSWLVFQQQLSVGDLT---AFMLYTEYTGNAIFNLSGFFSEIMQGA 400
            + +  +   ++  +G  LV Q + SV  +      +L++  T  ++ N      EI +G 
Sbjct: 938  NALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQ---VPEISRGQ 994

Query: 401  GAASRIFELTDLKPRIN-----PTRGSKFIPAKGGE--IEFKNVSFNYPTRPTVPIFRNL 453
             AA+ IF++ +    ++     P++   F    G    I+  N+SF + + P   IF +L
Sbjct: 995  RAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSL 1054

Query: 454  NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
            + +I     V IVG SG GKST++ LL   Y    G++ I G DI+     +LRR I IV
Sbjct: 1055 SCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIV 1114

Query: 514  QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLS 573
            +Q+P    GT+R+N+ YGL    +  E+RSV K     +F+   P+  +T +  H  L+S
Sbjct: 1115 EQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMS 1172

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHR 631
            GGQ QR++IAR L+++P ++ILDE TSALD  +  AI     +L+++  K++T++ I H 
Sbjct: 1173 GGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHS 1228

Query: 632  LSTIRRSENVIVLGNDGSVVEQGKFKELF 660
               ++  + V+VL   G V E+G + ELF
Sbjct: 1229 EQLMQICDRVLVL-KKGKVKEEGSYAELF 1256

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 135/234 (57%), Gaps = 4/234 (1%)

Query: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
           G+IEF++VSF YPTRP   + +N++ KI+ G+   IVG SG GKST+A LLL  Y    G
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 490 QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 549
           +I     +I +L    L  +I +V+Q   L +GT++DN+T    Y     E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFAL 473

Query: 550 CHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGA 609
            +  +   P+  DT +G HG  LSGGQ+QR+A+ARA ++   VLILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 610 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           I        K K+  I++  H  + I+  E V ++ ++G+VVE G   +L  NP
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENP 584

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 136/514 (26%), Positives = 233/514 (45%), Gaps = 46/514 (8%)

Query: 170  YVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSIT 227
            +++  +L + SE  +  LR   +  I +QD  +F  D  K  ++ + + ND   +   ++
Sbjct: 808  FLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVS 867

Query: 228  QKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAK-VFGKQIRDNSKKLQE 286
              +S     +F+ + G+                 +  PL +    ++G  ++      + 
Sbjct: 868  GFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTI--PLFIGVTGIYGGVLQKYETDYKT 925

Query: 287  VTANLTRVSEEQFNGIKTIQSFVAEQSEMHKF--------NGSIRKIFAVGKEAAFINAK 338
              A L     E   GIKT++    E    +K+        + S R+    G   A  NA 
Sbjct: 926  AVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNAL 985

Query: 339  FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLT---AFMLYTEYTGNAIFNLSGFFSE 395
                 +I+          YG  LV   + +  +L      +++T  T +A+      FS 
Sbjct: 986  VIGVQAIL--------YYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 396  IMQGAGAASRIFELTDLKP---------RINPT-RGSKFIPAKGGEIEFKNVSFNYPTRP 445
              +G  AA+ +F + + +          R  P  + S   P     I  ++++F YP+  
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPL----IRIQDLTFAYPSAL 1090

Query: 446  TVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKS 505
             V +++ L+  I  G N+ IVG SG GKST+  +L   Y  +   + ID  DI   +  S
Sbjct: 1091 DVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSS 1150

Query: 506  LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAI 565
            LR+HI +V+Q+     G+IRDN+ YGL    T  +I  V       +F+   P   +T I
Sbjct: 1151 LRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRI 1210

Query: 566  GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 625
              +  L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T 
Sbjct: 1211 DTN--LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITT 1266

Query: 626  VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            + I H  + + +S N I+   +G + E+G F+EL
Sbjct: 1267 IVITHN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 122/485 (25%), Positives = 210/485 (43%), Gaps = 49/485 (10%)

Query: 264 SPLLLS-AKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSI 322
           +PL+++ A +F K +   ++     T++   +        + I+ F  EQ E+ KF+ S+
Sbjct: 186 TPLIIALAIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISV 245

Query: 323 RKIFAVGKEAAFINAKFFTTA--SIIGDLSFLVVLS---YGSWLVFQQQLSVGDLTAFML 377
           +K         FIN   +  A  + +  LS ++ +    +G+ ++ + +L+ G +     
Sbjct: 246 KKC-----SKFFINLSKYAAANQASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFS 300

Query: 378 YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTD-----LKPRI--------NPTRGSKF 424
                G  + N       + +G  A  +I  + +     L+ R         +P  G   
Sbjct: 301 ACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFV 360

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
            P    +I F+NVSF+YP+RP      N++          IVG SG GKST++ LLL  Y
Sbjct: 361 SPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLY 420

Query: 485 NPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSG--------TIRDNITYGLTYTP 536
           +  +G I +   DI A     L  +I +V+Q   L +         T +D+         
Sbjct: 421 SDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDD-------NK 473

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILD 596
            +  I+   +       +   PD   T IG +G  LSGGQ+QR+A+ARA+++   VLILD
Sbjct: 474 NEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILD 533

Query: 597 EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKF 656
           E+ SALD+     +          K+  I++  H LS I   ++ + L  DG V E G  
Sbjct: 534 ESISALDIIHRDLLMEVIRNWRAGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYK 590

Query: 657 KELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAET 716
           ++L +  +             +NA     P  I  + E+    + E T  S +   ++E 
Sbjct: 591 RDLLSYTSGRFTEL-------HNAVIPSDPSAIEASHEKAIRLNTEETTGSGIVSEESEE 643

Query: 717 EAETI 721
           E  T+
Sbjct: 644 EDNTV 648

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/402 (31%), Positives = 193/402 (48%), Gaps = 21/402 (5%)

Query: 272  VFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKE 331
            ++G  +     + +   ANL  +  E   G+KTIQS   +Q    KFN  I+ +   G  
Sbjct: 826  LYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNGTY 885

Query: 332  AAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL---TAFMLYTEYTGNAIFN 388
             A          +++  L   ++  YG  LV   + +   L    A +L+T  T   + +
Sbjct: 886  RAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVT---VAS 942

Query: 389  LSGFFSEIMQGAGAASRIFELT--DLKPRINPTRGSKFIPAKG------GEIEFKNVSFN 440
            L     +I +G  + S I ++   D +  I P   S     KG        IE  N+SF 
Sbjct: 943  LVTQLPDITRGQRSISWIDQILKGDNQQTIEPP--SNLSTTKGIWNPNQPVIEVSNLSFT 1000

Query: 441  YPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISA 500
            Y          N+N ++       IVG SG GKST+  L+   Y+ S+G I I   DI+ 
Sbjct: 1001 YAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINK 1060

Query: 501  LSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT 560
             STK L + + ++QQ P+L   TIR+N+ YGLT T   E + +V +     +FI    + 
Sbjct: 1061 WSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNG 1120

Query: 561  YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 620
             D+ +    +LLSGGQ QR+ +AR +++ P VLILDE TSALDV S   IN   G   +S
Sbjct: 1121 LDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RS 1176

Query: 621  KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
             +   + ++H+  TI+  + +  L  DG+V   G ++EL  N
Sbjct: 1177 LAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN 1217

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 149/293 (50%), Gaps = 14/293 (4%)

Query: 357 YGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR- 415
           +GS ++ Q +L++  +          G+ I +  G    + +G  A  R+ ++ D  PR 
Sbjct: 277 FGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRE 336

Query: 416 ----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGK 471
               I+   G   +P     I F NVSF YP R T  +F  +NF I+      ++GPSG 
Sbjct: 337 SLAFIDAISGIDLLP-----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGS 391

Query: 472 GKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYG 531
           GKST+  L+L +Y+   G I++   DI +++   +  +I +V Q P L + TIR+NI   
Sbjct: 392 GKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILAC 451

Query: 532 LTYT--PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589
             +T  P+K E+  + K     N I   PD  DT IG  G  LSGGQ Q++A+ARA  + 
Sbjct: 452 SNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARN 511

Query: 590 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 642
            ++L+LDE  SA+D+     +     +    K  T V I H L  IR ++N++
Sbjct: 512 TSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 137/513 (26%), Positives = 232/513 (45%), Gaps = 42/513 (8%)

Query: 170  YVRVILLRILSENLVAKLRANVIKHIIHQDAQFF--DTYKVGDLISRVGNDAFIVSRSIT 227
            +++  +L    EN + +LR N  + ++ +D  +F        ++ S + ND   + R++ 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDLRDL-RALA 848

Query: 228  QKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPL-LLSAKVFGKQIRDNSKKLQE 286
             +    +  + + S   G++                 P+ +L + ++G  +++   + + 
Sbjct: 849  SEFLAALSTLAVVSL-CGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARYKT 907

Query: 287  VTANLTRVSEEQFNGIKTIQSF-----VAEQSEMHKFN--GSIRK-IFAVGKEAAFINAK 338
              A L     +    +KTI+       VA   EM +    G+ RK     G   A  NA 
Sbjct: 908  CIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSNAL 967

Query: 339  FFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQ 398
             F T SI+        L +G  LV   + + G +   +    +T      L     EI +
Sbjct: 968  TFITQSIL--------LYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISR 1019

Query: 399  GAGAASRIFEL---------TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI 449
            G  AA+ +F+L         + LK R  P   +    +K   I  K++ F+Y       +
Sbjct: 1020 GQRAATYLFKLFGNEHEEGASVLKERHAPIIKT---CSKQTLISIKHLKFSYSNINNPMV 1076

Query: 450  FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
            ++NL+ K+++G  V ++G SG GKST+  LL   Y    G I IDG DI+    K+LR  
Sbjct: 1077 YKNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSC 1136

Query: 510  IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
            I +V+Q+P+  SG+I +N+TYGL    + EE+  +        F+   P    + I    
Sbjct: 1137 IAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ- 1195

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVS 627
             LLSGGQ QR+AI RAL++KP +L+LDE TSALD       ++   + +K      T + 
Sbjct: 1196 -LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLV 1250

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
            + H    +R    ++   N G +VE+G    LF
Sbjct: 1251 VTHSEQMMRSCHRILTF-NKGEIVEEGSIDNLF 1282

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 199/417 (47%), Gaps = 34/417 (8%)

Query: 264 SPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEE----QFNGIKTIQSFVAEQSEMHKFN 319
           SPL++   ++  +   N +K  ++  + T V+ +      N  K ++    +  E+ KF 
Sbjct: 187 SPLVIGFAIYCSR---NVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFR 243

Query: 320 GSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGD-LTAFMLY 378
            S+ K      + +  ++  ++    +    F+    YG+  +    L  GD +T F   
Sbjct: 244 ASVLKCRMNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF--- 300

Query: 379 TEYTGNAIFNLSGFFSEIMQ------GAGAASRI--FELTDLKPRINPTRGSKFIPA--K 428
                + I   S   S + Q      GA    +I  F  +D+         S  +P   +
Sbjct: 301 ----SSCILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWE 356

Query: 429 GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
             +I F+NVSF YP+R   P+ +NLN K+  G    IVG SG GKSTI+ LLL  Y P  
Sbjct: 357 QAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCS 416

Query: 489 GQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC 548
           G I ++  DI  ++ + L R I +V+Q   L   +I++NI   LT    +++ R +++ C
Sbjct: 417 GLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGR-LSQAC 473

Query: 549 ---FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
                   I       DT IG  G  LSGG++QR+A+ARA ++   +LILDEA SA D  
Sbjct: 474 QAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRM 533

Query: 606 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            +  +        K ++  I++  H L+ I   ++ ++L  DG+V+E+G+  +L ++
Sbjct: 534 HKDLLMEAIRFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSD 587

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 129/508 (25%), Positives = 226/508 (44%), Gaps = 30/508 (5%)

Query: 170  YVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYK--VGDLISRVGNDAFIVSRSIT 227
            +++   L    EN +  LR    K+I +++  +F++ +    ++ S V ND   + R++ 
Sbjct: 791  FLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDL-RALA 849

Query: 228  QKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEV 287
             +    V  + + S    +               +    +L    +G  ++      +  
Sbjct: 850  SEFLAAVTTLVVVSFCGLIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKSA 909

Query: 288  TANLTRVSEEQFNGIKTIQSFVAEQSEMHKFN--------GSIRKIFAVGKEAAFINAKF 339
             A++          IKTI+    E+  + ++            ++    G   A  NA  
Sbjct: 910  VASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALT 969

Query: 340  FTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG 399
              T SI+        L YG  LV   + S   +   +    +T     +L     EI +G
Sbjct: 970  LITQSIL--------LYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRG 1021

Query: 400  AGAASRIFELTDLKPRINPT--RGSKFIPAKGGEIE----FKNVSFNYPTRPTVPIFRNL 453
              AA+ +F + D + +       G   + ++G   E     K++ F+Y       ++R L
Sbjct: 1022 QRAATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGL 1081

Query: 454  NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
            N  ++ G  V +VG SG GKST+  L+   Y    G I  DG D++     +LR+ I +V
Sbjct: 1082 NLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVV 1141

Query: 514  QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLS 573
            +Q P L  G+I DN+TYGL+ +  + EIR + +     +F+   P    + I     +LS
Sbjct: 1142 EQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLS 1199

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 633
            GGQ QR+AI RAL++KP +L+LDE TSALD +  G I   F +   S+S T + + H   
Sbjct: 1200 GGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQ 1257

Query: 634  TIRRSENVIVLGNDGSVVEQGKFKELFA 661
             +R    ++   N G+++E G F+ L++
Sbjct: 1258 MMRACNRILTFAN-GNIIEDGSFERLYS 1284

 Score =  132 bits (331), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 129/588 (21%), Positives = 255/588 (43%), Gaps = 39/588 (6%)

Query: 98  VKSDWKLLMSALTLLTVSCGIGMCIPKVI-GTVLDSLKDIQGKEFSEL--MIWDMSLKHF 154
           +K DW LL+  +T+ +V+ G+   +  ++ GTV + L+    +EF  +  ++ +++L+  
Sbjct: 18  LKQDWSLLV-VITVCSVAYGLVPAVTSILTGTVFNLLQQPAAREFGSVNALMHELALRSM 76

Query: 155 FYXXXXXXXXXXXANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISR 214
                          ++ V     L E    +LR  +++  + +   ++D  +      +
Sbjct: 77  --AILATGIASIPLCWLSVSAWMSLGERQAFRLRRKMLQSYLDKSMAWYDANE------Q 128

Query: 215 VGNDAFIVSRSITQKISDGVKA---VFIGSAGVGMMXXXXXXXXXXXXXXM--GSPLLLS 269
           +  D   ++R + +  S   ++   VF     V  +              +   SPL++ 
Sbjct: 129 ISGDFTQLNRCVEELRSSSAESSAIVFQNVVTVAALLGSALYYSWSLTLIIMANSPLVIG 188

Query: 270 -AKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAV 328
            A  F +++   +K+    T++         +  K ++    +  E+ +F   ++K    
Sbjct: 189 FAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQDRELARFEACVQKCRQH 248

Query: 329 GKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIF- 387
             + +  ++  ++    +    F+    YG+      ++++G L    + T ++   +  
Sbjct: 249 FNKMSLFSSLNYSVLRFLTLCMFVQGFWYGN-----SRINIGKLKPGDVVTCFSSCVLLA 303

Query: 388 -NLSGFFSEIM---QGAGAASRIFELTDLKPRINPTRGSKFIPAKG-------GEIEFKN 436
             L+    +I+   +GA    +I    + +      +    I  +          I F+N
Sbjct: 304 STLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERASITFQN 363

Query: 437 VSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQ 496
           V F YPTRP   + + ++     G    ++G SG GKSTI  LLL +Y    G I ++GQ
Sbjct: 364 VHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQ 423

Query: 497 DISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKE-EIRSVAKQCFCHNFIT 555
           D+  ++   L R+I +V+Q   L + T+ +N+T G       E  ++   +     N I 
Sbjct: 424 DVKEINQSELARNIMLVEQTTSLFTETLANNVTIGEAGVDDDEIRLKQACQMAMLGNIIR 483

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
                 +T IG  G  LSGG++QR+A+ARA  +   +LILDEA SA D   +  +     
Sbjct: 484 DLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIHKSLLMEAIR 543

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           +    K+  I++  H LS I  ++ V V+ +DG + E G    L +NP
Sbjct: 544 KWRADKTTIILT--HELSDILDTDYVYVM-SDGQIREHGYKSGLLSNP 588

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 138/508 (27%), Positives = 242/508 (47%), Gaps = 47/508 (9%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            KL  ++ K +I     FF+T  VG +I+R  +D   V  S+    S   K++      V 
Sbjct: 1053 KLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVI 1112

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
            ++              +G  + +  + F   +    K+L  ++ + +  +  E  NG   
Sbjct: 1113 LVGYNMPWFLVFNMFLLG--IYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSI 1170

Query: 305  IQS------FVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT-ASIIGDLSFLVVLSY 357
            I +      F+    E  ++N  I  +F       +++ +  T  A+I+   + L + + 
Sbjct: 1171 IDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATM 1228

Query: 358  GSWLVFQQQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAAS--RIFELTDLKP 414
             +    ++QLS G +   M Y+ E TG+  + +    + +M      S  RI E  +L  
Sbjct: 1229 NT----KKQLSSGMVGLLMSYSLEVTGSLTWIVR---TTVMIETNIVSVERIVEYCELPS 1281

Query: 415  R---INP-TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSG 470
                INP  R  K  P++G  IEFK+ S  Y      P+ +++N KIE    V IVG +G
Sbjct: 1282 EAQSINPEKRPDKNWPSRGS-IEFKDYSTKYRENLD-PVLKDINVKIEPCEKVGIVGRTG 1339

Query: 471  KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
             GKST++  L     P++G+I+IDG +IS L    LR H+ I+ Q+     GT++ N+  
Sbjct: 1340 AGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDP 1399

Query: 531  GLTYTPTKEEIRSVAKQCFCHNFITRF--------------PDTYDTAIGPHGTLLSGGQ 576
               Y  +++E++   +       + +                D  D  I  +G+ LS GQ
Sbjct: 1400 FNRY--SEDELKKAVELAHLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQ 1457

Query: 577  KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 636
            +Q + +ARAL+ +  +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+ 
Sbjct: 1458 RQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVL 1515

Query: 637  RSENVIVLGNDGSVVEQGKFKELFANPA 664
             S+ +IVL ++GSV E     +L +N A
Sbjct: 1516 DSDKIIVL-DEGSVKEFDSPSKLLSNKA 1542

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 99/435 (22%), Positives = 187/435 (42%), Gaps = 87/435 (20%)

Query: 271 KVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGK 330
           K+   Q+R    +++ +T        E  N IK+I+ +  E+  M + N  +R    +  
Sbjct: 459 KLSKTQMRYKDMRIKTIT--------ELLNAIKSIKLYAWEEPMMKRLN-HVRNDMEL-- 507

Query: 331 EAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTE---------- 380
                  K F    I+ +L       Y +W      ++      F L+ +          
Sbjct: 508 -------KNFRKIGIVSNLI------YFAWNCVPLMVACSTFGLFSLFNDSPLSPAIVFP 554

Query: 381 ------YTGNAIFNLSGFFSEIMQGAGAASRI--FELTD-----LKPRINPTRGSKFIPA 427
                    +AI+++    + I++ + +  R+  F L+D        RI+P+   + +P 
Sbjct: 555 SLSLFNILNSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLPV 614

Query: 428 KGGEIEFKNVSFNYPTRPTVP---------------------IFRNLN-FKIEQGSNVCI 465
               IE  N++F + ++  +                        +N++ F+ ++G+ VCI
Sbjct: 615 ----IEMNNITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCI 670

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH--IGIVQQEPILMSGT 523
           VG  G GKST    +L       GQ+        ++  K + R   +    QE  +M+ +
Sbjct: 671 VGRVGAGKSTFLKAIL-------GQLPCMSGSKESIPPKLIIRSSSLAYCSQESWIMNAS 723

Query: 524 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIA 583
           +++NI +G  +     ++    K C     +   PD  +T +G  G  LSGGQK R+++A
Sbjct: 724 VKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLA 781

Query: 584 RALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENV 641
           RA+  +  + +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ +
Sbjct: 782 RAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMI 841

Query: 642 IVLGNDGSVVEQGKF 656
             L N G +VEQG +
Sbjct: 842 YALEN-GEIVEQGNY 855

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 133/519 (25%), Positives = 233/519 (44%), Gaps = 46/519 (8%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
            N   +ILL   +     KL  N+   I++   QFF+T  +G +++R   D   V  ++  
Sbjct: 1022 NLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILNRFSADIDTVDSTLQM 1081

Query: 229  KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVT 288
                  K++F     V ++              M    +   K+F  Q R+  +      
Sbjct: 1082 VFMVFFKSIFSYLITVILITISMPLFLVFCLFLM-VIYIYYQKLFIVQSRELKRMTSISY 1140

Query: 289  ANLTRVSEEQFNGIKTIQS------FVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT 342
            + +  +  E   G+  I++      F    +E  +FN  I  +F       +++ +  T 
Sbjct: 1141 SPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFN--INCVFDYRSTNRWLSIRLQTI 1198

Query: 343  ASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGA 402
             +++  ++ ++ LS  S     + L+ G +   M Y      ++  +      I  G  +
Sbjct: 1199 GALMVLITGMLSLSTIS---SSKPLTAGMVGLLMSYVLQVTTSLMWIVRSSVMIETGIVS 1255

Query: 403  ASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIE 458
              RI E  +L       ++  R +   P+KG  I+FKN S  Y      P+ +N++  I 
Sbjct: 1256 VERIMEYCELPSEAEQIVDDYRPASNWPSKGA-IQFKNYSTRYRANLD-PVLKNISININ 1313

Query: 459  QGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPI 518
             G  V IVG +G GKST+   L     P +G I+IDG DIS +    LR H+ I+ Q+  
Sbjct: 1314 PGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQ 1373

Query: 519  LMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITRFP--DTYDTAI 565
               GT+R N           +   +T +  K  ++ + ++       +  P  D  +  I
Sbjct: 1374 AFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESG-----SELPLNDYLELGI 1428

Query: 566  GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 625
               G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+++DVE++  I  T  +    +  TI
Sbjct: 1429 KESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQATIRESFSDR--TI 1486

Query: 626  VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
            ++IAHR+ T+  S+ ++VL       EQG+ KE F +PA
Sbjct: 1487 ITIAHRIDTVLDSDRILVL-------EQGEVKE-FNSPA 1517

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 102/210 (48%), Gaps = 18/210 (8%)

Query: 455 FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR--HIGI 512
           F+ ++    C+VG  G GK+T+   +L       GQ+        A+  K + R   +  
Sbjct: 654 FRAKKNVLTCVVGRVGSGKTTLLKSIL-------GQLPCTSGSQKAIPPKLIIRGESVAY 706

Query: 513 VQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLL 572
             QE  +M+ +I++NI +G  Y  T   +    K C         PD  +T +G  G  L
Sbjct: 707 CPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITL 764

Query: 573 SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQ----LMKSKSMTIVSI 628
           SGGQK R+++ARA+  +  + +LD+  SA+D     +I +        L+K+K+  I+  
Sbjct: 765 SGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILT 822

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
            + +S +  S+ + VL  DG ++E+  + E
Sbjct: 823 TNDISVLEHSDRIYVL-QDGRIIEESTYAE 851

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 141/513 (27%), Positives = 244/513 (47%), Gaps = 59/513 (11%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            K+  N++  ++H   +FFD   VG +++R   D   V + +   +   +  + I  A + 
Sbjct: 1073 KIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCL-IQCASII 1131

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
             +              +        K +    R+  K+L  +T + + +   E   G+ T
Sbjct: 1132 FLITVITPRFLTVAVIVFVLYFFVGKWYLTASRE-LKRLDSITKSPIFQHFSETLVGVCT 1190

Query: 305  IQSFVAEQ----SEMHKFNGSIRKIFAVGKEAAFINAKFFT-TASIIGDLSFLVVLSYGS 359
            I++F  E+      M+K + + R  F +      +  K+F+    +IG     +VL+ GS
Sbjct: 1191 IRAFGDERRFILENMNKIDQNNRAFFYLS-----VTVKWFSFRVDMIGAF---IVLASGS 1242

Query: 360  WLVFQ-----QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKP 414
            +++         L+   LT  +L+T+    A++ L   +S       +  R+ E + ++ 
Sbjct: 1243 FILLNIANIDSGLAGISLTYAILFTD---GALW-LVRLYSTFEMNMNSVERLKEYSSIEQ 1298

Query: 415  R--INPTRGSKFI---PA--KGGEIEFKNVSFNY-PTRPTVPIFRNLNFKIEQGSNVCIV 466
               +    G   +   P+  K GEIE +N+S  Y P  P  P+ RN++FK++  S + IV
Sbjct: 1299 ENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLP--PVIRNVSFKVDPQSKIGIV 1356

Query: 467  GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
            G +G GKSTI   L     P  G I IDGQDIS +   +LRR I I+ Q+PIL +GTI+ 
Sbjct: 1357 GRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKS 1416

Query: 527  NITYGLTYTPTK-----EEIRSVAKQCF--CHNFITRFPDTYD------TAIGPHGTLLS 573
            N+     Y   K      ++  ++   F    N   RF  T++      T I   G  LS
Sbjct: 1417 NVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLS 1476

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESE----GAINYTFGQLMKSKSMTIVSIA 629
             G++Q + IAR+L+++P +++LDEATS++D +S+    G I   F +       TI++IA
Sbjct: 1477 QGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNK------STILTIA 1530

Query: 630  HRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            HRL ++   + +IV+ + G V E  +  EL  +
Sbjct: 1531 HRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 106/399 (26%), Positives = 172/399 (43%), Gaps = 39/399 (9%)

Query: 283 KLQEVTANLT--RVSE--EQFNGIKTIQSFVAEQSEMHKFNG----SIRKIFAVGKEAAF 334
           K Q+ T   T  R+S+  E    I+ ++ F  E++ +++        +R +       + 
Sbjct: 514 KFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSV 573

Query: 335 INAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYT--GNAIFNLSGF 392
            +  +F T +++  ++F +         F Q   +    AF   + +T     +  LS  
Sbjct: 574 TSFLWFVTPTLVTGVTFAIC-------TFVQHEDLNAPLAFTTLSLFTLLKTPLDQLSNM 626

Query: 393 FSEIMQGAGAASRI--FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPT-VPI 449
            S I Q   +  RI  F   D   + N    S   P K  +IEFKN +  +    + +  
Sbjct: 627 LSFINQSKVSLKRISDFLRMDDTEKYNQLTIS---PDKN-KIEFKNATLTWNENDSDMNA 682

Query: 450 FR--NLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG----QDISALST 503
           F+   LN K + G    I+G +G GKS +   LL   N   G I++       D+     
Sbjct: 683 FKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIP-DC 741

Query: 504 KSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDT 563
           + L        Q   L++ T+++NI +   Y   ++    V   C     +   P    T
Sbjct: 742 EGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--EDRYNKVIDACGLKRDLEILPAGDLT 799

Query: 564 AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSK 621
            IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N   G LMK++
Sbjct: 800 EIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNR 859

Query: 622 SMTIVSIAHRLS-TIRRSENVIVLGNDGSVVEQGKFKEL 659
             T + + H +S T+R +   IVL N G V  QG   EL
Sbjct: 860 --TCILVTHNVSLTLRNAHFAIVLEN-GKVKNQGTITEL 895

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 228/510 (44%), Gaps = 60/510 (11%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSA---G 243
            L    +  I+H    + DT  +G +++R   D    + S+  ++++ ++ +   +A   G
Sbjct: 984  LNLKAVHRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVG 1039

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGI 302
            V +M              +     L    +    R+  K+L+ +  +    +  E   G+
Sbjct: 1040 VCVMCIIYLPWFAIAIPFLFIGFTLITDHYQSTGRE-VKRLEAIQRSFVYNNFNEILGGM 1098

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL-----SFLVVLSY 357
             TI+S+ +E+  + K +  I K+     EA +++       +I  DL     + ++ L  
Sbjct: 1099 DTIKSYGSEERFLAKSDYLINKM----NEAGYLSVALQRWVAIFLDLVAVCFALIITLLC 1154

Query: 358  GSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRIN 417
             +       +SVG L  ++L      N +       ++      +A R+       P   
Sbjct: 1155 VTRAFHISAVSVGVLLTYVLQLPGLLNGVLRA---LTQTENDMNSAERLVSYATELPLEA 1211

Query: 418  PTRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKG 472
              R  +  P +     G+IEFK+V F+Y  RP +PI  ++L+  I+ G  + I G +G G
Sbjct: 1212 AYRRPEVSPPENWPSEGKIEFKHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAG 1269

Query: 473  KSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL 532
            KSTI   L      SQG+ILID  DIS L    LRR + I+ Q+P+L  GTIR N+    
Sbjct: 1270 KSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNL---- 1325

Query: 533  TYTPTKEE---------IRSVAKQCFCHNFITR------------FPDTYDTAIGPHGTL 571
               P  E          +R  A +    N I              F    D  +   G  
Sbjct: 1326 --DPFNEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFKFHLDQLVEEEGAN 1383

Query: 572  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS-KSMTIVSIAH 630
             S G++Q +A+ RAL+++  VLILDEATS++D E++G I     +++K     TI+ IAH
Sbjct: 1384 FSLGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAH 1440

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
            RL+TI   + ++VL   G V E  K K LF
Sbjct: 1441 RLNTILNYDRILVL-EKGEVAEFEKPKVLF 1469

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 104/201 (51%), Gaps = 19/201 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F ++   I++G  + +VGP G GK++    L  + N ++G+I ++G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  Y   K E   V + C     +   P    T IG  G
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR + KK  + + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 629 AHRLSTIRRSENVIVLGNDGS 649
            H+LS + R+  VIVLG DGS
Sbjct: 790 -HQLSLLERASRVIVLGTDGS 809

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  135 bits (340), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 235/515 (45%), Gaps = 32/515 (6%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
            N   ++LL   +    A+L   + K ++     FF+T  VG +I+R  +D   V  ++  
Sbjct: 1012 NLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQW 1071

Query: 229  KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEV- 287
              +   +++   +  V ++              +   + +  + F   +    K+L  V 
Sbjct: 1072 VFAFFFRSILNYAVTVILISYNMPWFLIVNAVLL--IIYIYYQAFYITLSRELKRLTSVS 1129

Query: 288  TANLTRVSEEQFNGIKTIQSFVA-EQSEMHKFNG---SIRKIFAVGKEAAFINAKFFTTA 343
            T+ +  +  E   G   I +F   ++ +   FN    +I   F       +++ +  T  
Sbjct: 1130 TSPIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQFNINCSFNFRSTNRWLSVRLQTIG 1189

Query: 344  SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
            + I   + L+ LS    +  +++LS G +   M Y     +++  +     +I     + 
Sbjct: 1190 AFIVLATALLALST---INSERRLSPGMVGLLMSYALQVTSSLMWIVRMSVQIETNIVSV 1246

Query: 404  SRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQ 459
             RI+E  +L P     I   R  K  P++G EI FKN S  Y T+  + + + +N  I+ 
Sbjct: 1247 ERIYEYCNLTPEAPEVIESCRPKKTWPSEG-EIIFKNYSTKYKTKGDLAL-KGINLSIKP 1304

Query: 460  GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
               + +VG +G GKST++  L      ++G I IDG DIS +  K LR H+GI+ Q+   
Sbjct: 1305 QEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSHLGIIPQDAQA 1364

Query: 520  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF------------PDTYDTAIGP 567
              GT+R N+     Y+ T+E   S+       + +  F                D  I  
Sbjct: 1365 FEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDNSELPASKEKMLDVKISE 1423

Query: 568  HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 627
            +G  LS GQ+Q + ++RAL+    VL+LDEAT+A+D+E++  I  T    +K K  TI++
Sbjct: 1424 NGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRSELKEK--TILT 1481

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            IAHR+ T+  S+ +IVL + G V E    + L +N
Sbjct: 1482 IAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLSN 1515

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 133/277 (48%), Gaps = 20/277 (7%)

Query: 450 FRNLN-FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR 508
             N+N F+ ++G   CIVG  G GKST+   +L       GQ+      +  L  K L R
Sbjct: 638 LENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIR 690

Query: 509 H--IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIG 566
              +    QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P+  +T +G
Sbjct: 691 ASTVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVG 748

Query: 567 PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMK-SKSMT 624
             G  LSGGQK RI++ARA+  +  + +LD+  SA+D E S+  +     + M   ++ T
Sbjct: 749 EKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKT 808

Query: 625 IVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEI 684
           +V   + +S + RS+ + +L   GS+VE+G F E+ ++P             GN   P  
Sbjct: 809 VVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDEFGGNMNYPPS 867

Query: 685 QPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETI 721
           +  + + +IE   S      P+S +    A   +E +
Sbjct: 868 ESAD-NHSIESTNS----KVPSSEINDTAASLYSENM 899

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 132/501 (26%), Positives = 220/501 (43%), Gaps = 58/501 (11%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K I+H    + DT  +G +++R   D   +   +T+ +   + + F    GV +
Sbjct: 967  LNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LLTSQFANIVGVCV 1025

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +    +L A  +    R+  K+L+ V  +    +  E   G+ TI
Sbjct: 1026 MCIVYLPWFAIAIPFLLVIFVLIADHYQSSGRE-IKRLEAVQRSFVYNNLNEVLGGMDTI 1084

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ +++  + K +  I K+     EA ++         +  D+  +V     + L   +
Sbjct: 1085 KAYRSQERFLAKSDFLINKM----NEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTR 1140

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFELTDLKPRINP 418
               +   +  +L T      +  L G  + I++          +A R+       P    
Sbjct: 1141 AFPISAASVGVLLT-----YVLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEAD 1195

Query: 419  TRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGK 473
             R  +  P +     GEI  +NV F+Y  RP +P+  +NLN  IE G  + I G +G GK
Sbjct: 1196 YRKPEMTPPESWPSKGEIVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGK 1253

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
            STI   L      S G+ILID  DIS L    LRR + I+ Q+P+L  GTIR N+     
Sbjct: 1254 STIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL----- 1308

Query: 534  YTPTKEE---------IR--SVAKQCFCHNFITRFPDT-----------YDTAIGPHGTL 571
              P  E          +R  ++AK       + + PD             D A+   G+ 
Sbjct: 1309 -DPFDERTDDELWDALVRGGAIAKNDLSEAKLQK-PDKNGTHGRMHKFHLDQAVEEEGSN 1366

Query: 572  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
             S G++Q +A+ RAL+++  +LILDEATS++D E++G I     +  +    TI+ IAHR
Sbjct: 1367 FSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHR 1424

Query: 632  LSTIRRSENVIVLGNDGSVVE 652
            L TI   + ++VL   G V E
Sbjct: 1425 LQTIVNYDRILVL-EKGEVAE 1444

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 20/213 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F++LNF+I++G  + I GP G GKS++   +      + G+I ++G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + +  +RDNI +G  +   KE+   V + C     +   P    T IG  G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++     ++ +K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            H+LS I R+  VIVLG DG  V+ G   EL A
Sbjct: 767 -HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 230/486 (47%), Gaps = 51/486 (10%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXX 257
            FF+T  +G +++R  ND +    I+ R+ +Q   + VK VF+ +     +          
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMA-----VICATTWQFIF 1093

Query: 258  XXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMH 316
                +G   +   + + +  R+  ++L  +T + +    +E   GI TI+ +  E+    
Sbjct: 1094 VIIPLGVFYIYYQQYYLRTSRE-LRRLDSITRSPVYSHFQETLGGITTIRGYNQEK---- 1148

Query: 317  KFNGSIRKIFAVGKEAAF---INAKFFTT--ASIIGDLSFLVVLSYGSWLVFQQQLSVGD 371
            +F G I +       +AF   INA  +      +IG +   ++L   +  +F+  L  G 
Sbjct: 1149 RF-GHINQCRVDNNMSAFYPSINANRWLAFRLELIGSI---IILGAATLSIFR--LKEGT 1202

Query: 372  LT--------AFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK---PRI-NPT 419
            LT        ++ L    T N I  ++    E+     +  R+ E   L+   PRI    
Sbjct: 1203 LTPGMVGLSLSYALQITQTLNWIVRMT---VEVETNIVSVERVKEYAQLESEAPRIVEEK 1259

Query: 420  RGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
            R  +  P +G +I+F+N S  Y  RP +  + +N+N  I     V IVG +G GKS++  
Sbjct: 1260 RPDEMWPTEG-DIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTL 1316

Query: 479  LLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538
             L      + G I+IDG  I+ +    LR  + I+ Q+  +  GT+R+NI    T   T 
Sbjct: 1317 ALFRIIEATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTD 1374

Query: 539  EEIRSVAKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDE 597
            EEI  V +       +     D  D  +   G+ LS GQ+Q + +ARAL+    +L+LDE
Sbjct: 1375 EEIWRVLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDE 1434

Query: 598  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFK 657
            AT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ +IVL + G +VE     
Sbjct: 1435 ATAAVDVETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPD 1491

Query: 658  ELFANP 663
            EL A P
Sbjct: 1492 ELLAKP 1497

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 113/226 (50%), Gaps = 18/226 (7%)

Query: 436 NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
           N +F +  +P   +  +N+NF+ ++G   CIVG  G GKS +              IL D
Sbjct: 628 NATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALI-----------QSILGD 676

Query: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554
              +   +T  +  ++  V Q P +M+GT+++NI +G  Y   +E      K C     +
Sbjct: 677 LFRVKGFAT--VHGNVAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKACALTIDL 732

Query: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 613
               D   T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + + 
Sbjct: 733 GILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHV 792

Query: 614 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            G      S T V   +++S +  ++++ +L N G +V+QG ++E+
Sbjct: 793 LGPTGLLHSKTKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEV 837

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 133/504 (26%), Positives = 222/504 (44%), Gaps = 48/504 (9%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K ++H    F DT  +G +++R   D   +   +T+ +   V       AGV +
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVRLFVYQT-ANIAGVII 986

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +G   ++ A  +    R+  K+L+ V  +    +  E  +G+ TI
Sbjct: 987  MCIIYLPWFAIAVPFLGLIFIIVADHYQSSGRE-IKRLEAVQRSFVYNNFNEVLSGMDTI 1045

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ +E   + K +  I ++     EA ++        SI  D+  +      + L   +
Sbjct: 1046 KAYKSENRFLMKSDFLINRM----SEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTR 1101

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAG---AASRIFELTDLKPRINPTRGS 422
            Q  +   +  +L T Y       L+G    + Q      +  RI       P+    R  
Sbjct: 1102 QFDISAASVGVLLT-YVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQEAAYRKP 1160

Query: 423  KFIPAK----GGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIA 477
            +  P +     GE+ F NVS +Y  RP +P + + ++  I+ G  + I G +G GKSTI 
Sbjct: 1161 EMTPQEPWPSNGEVVFDNVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIM 1218

Query: 478  WLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT-YG----- 531
              L      ++G++LIDG D S L    LRR + I+ Q+P+L  G+IR N+  +G     
Sbjct: 1219 SALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDE 1278

Query: 532  -------LTYTPTKEEIRSVAKQ--------CFCHNFITRFPDTYDTAIGPHGTLLSGGQ 576
                    + T   EE+  V  Q           H F        D  +   GT  S G+
Sbjct: 1279 ELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGE 1332

Query: 577  KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 636
            +Q +A+ RAL+++  +LILDEATS++D E++  I     Q  +    TI+ IAHRL TI 
Sbjct: 1333 RQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTIL 1390

Query: 637  RSENVIVLGNDGSVVEQGKFKELF 660
              + ++VL N G+V E    + LF
Sbjct: 1391 NYDRLVVLDN-GTVKEFDTPRSLF 1413

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 105/211 (49%), Gaps = 20/211 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F+NLNF+I++G  V I G  G GKS++   L  +   ++G I  +G         SL   
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL--- 618

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G ++   +   + V + C     +   P    T IG  G
Sbjct: 619 --LLCGYPWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDILPAGDFTEIGERG 674

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ K   + + D+  SA+D    +  ++     ++  K+  + + 
Sbjct: 675 ITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGKTRILAT- 733

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            H+LS I R+  VI LG  GS  + G  +EL
Sbjct: 734 -HQLSLIERASRVIFLGAGGS-FDIGTVEEL 762

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 143/525 (27%), Positives = 232/525 (44%), Gaps = 48/525 (9%)

Query: 168  ANYVRVILLRILSENLVAK-LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IV 222
            AN ++ I+L I      +K L +++   I      FF+T  +G +++R  ND +    I+
Sbjct: 999  ANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEIL 1058

Query: 223  SRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSK 282
             RS +Q   + ++  F       ++              M    +   + F +  R+  +
Sbjct: 1059 GRSFSQFFQNTIRVSF-----TIVVICSTTWQFIFLIIPMAFLYIYYQQYFLRTSRELRR 1113

Query: 283  KLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT 342
                  + L    +E   G+ TI+ F  +   +H     +         +   N      
Sbjct: 1114 LDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRVDSNMMAYYPSINSNRWLAFR 1173

Query: 343  ASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIM 397
               +G L   ++L   +  +F+  L  G LTA M+     Y      ++  +     ++ 
Sbjct: 1174 LEFLGSL---IILGAATLSIFR--LKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVE 1228

Query: 398  QGAGAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRN 452
                +  RI E + L       I   R S+  P+KG  IEFKN S  Y  RP +  + +N
Sbjct: 1229 SNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPSKGA-IEFKNYSTRY--RPELDLVLKN 1285

Query: 453  LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGI 512
            +N KI     V IVG +G GKS++   L      S G I IDG +I+ L    LR  + I
Sbjct: 1286 INLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSI 1345

Query: 513  VQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF----PDT-------- 560
            + Q+  +  G+IR+NI    T   +++EI +  +       I +     P++        
Sbjct: 1346 IPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQS 1403

Query: 561  ---YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617
                D  I   G+ LS GQ+Q I +ARAL+    VLILDEAT+A+DVE++  I +T    
Sbjct: 1404 SNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTA 1463

Query: 618  MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
             K +  TI++IAHR++TI  S+ +IVL N G V E  K + L  N
Sbjct: 1464 FKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDKPEILLTN 1505

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 136/290 (46%), Gaps = 31/290 (10%)

Query: 386 IFNLSGF--------FSEIMQGAGAASRIFE-LTDLKPRINPTRGSKFIPAKGGEIEFK- 435
           +FNL  F         S  ++ + + SR++  LT+ + + +  +   F+  + GE   K 
Sbjct: 558 LFNLLNFPLVAVPITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVK-QNGETTVKI 616

Query: 436 --NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQIL 492
             N +F +  +P   +  +N+NF+  +G   CIVG  G GKS     +L           
Sbjct: 617 GDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL----------- 665

Query: 493 IDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 552
             G         S+  ++  V Q   +M+GT++DNI +G  Y P  E      K C    
Sbjct: 666 --GDLFRVKGFASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTI 721

Query: 553 FITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAIN 611
            ++  PD   T +G  G  LSGGQK R+++ARA+  +  + +LD+  +A+D   S+  I 
Sbjct: 722 DLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQ 781

Query: 612 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
              G     KS T +   +++  +  ++++ +L N G + EQG + ++ A
Sbjct: 782 NVLGAKGLLKSKTRILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMA 830

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 131/479 (27%), Positives = 218/479 (45%), Gaps = 25/479 (5%)

Query: 185  AKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIG 240
            A+L   + K ++     FF+T  VG +++R  ND +    ++ RS +Q      K VF  
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFT- 1073

Query: 241  SAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQF 299
                 M+                S L L  + +  +     ++L  VT +      +E  
Sbjct: 1074 -----MIVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETL 1128

Query: 300  NGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGS 359
             G+ T++SF  +   +H     I         +   N         +G +  L       
Sbjct: 1129 TGVTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSV 1188

Query: 360  WLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR---I 416
            + + Q +L+ G L   + Y      ++  +     E+     +  RI E TDLKP    I
Sbjct: 1189 FRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMI 1248

Query: 417  NPT-RGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKS 474
             PT R  K  PA  G+I+F++ S  Y  RP +  I  ++N  I     V IVG +G GKS
Sbjct: 1249 IPTSRPPKNWPA-NGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKS 1305

Query: 475  TIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTY 534
            ++   L      + G+ILID   I ++    LR  + I+ Q+  +  GT R+NI     +
Sbjct: 1306 SLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF 1365

Query: 535  TPTKEEIRSVAKQCFC-HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
              T +EI +  +      + +T   +  +T++   G+ LS GQ+Q + +ARAL+    +L
Sbjct: 1366 --TDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKIL 1423

Query: 594  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            +LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G + E
Sbjct: 1424 VLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGRIAE 1479

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 110/229 (48%), Gaps = 18/229 (7%)

Query: 436 NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
           + ++ +  +P   +  +N+NF+  +G   CIVG  G GKS +   +L             
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML------------- 665

Query: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554
           G       + +L   +  V Q   +M+GTI+DNI +G  Y    E      K C     +
Sbjct: 666 GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLDL 723

Query: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 613
              PD   T +G  G  LSGGQK R+A+ARA+  K  V  LD+  +A+D   S+  + Y 
Sbjct: 724 NTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYV 783

Query: 614 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            G     K+ T +   +++  +  ++++ +L N G +V+QG + ++ +N
Sbjct: 784 IGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQVNSN 831

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 138/489 (28%), Positives = 231/489 (47%), Gaps = 55/489 (11%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVF-IGSAGVGMMXXXXXXXXX 256
            FF+T  +G +++R  ND +    ++ R+ +Q   + VK  F IG   V            
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQFIFVIV-- 1100

Query: 257  XXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EEQFNGIKTIQSFVAE 311
                    PL +    + +     S++L+ + + +TR       +E   GI TI+ +  +
Sbjct: 1101 --------PLGVFYIYYQQYYLRTSRELRRLDS-ITRSPVYSHFQETLGGIVTIRGY-GQ 1150

Query: 312  QSEMHKFNGSIRKIFAVGKEAAF---INAKFFTT--ASIIGDLSFLVVLSYGSWLVFQQQ 366
            Q    + N    +       +AF   +NA  +      +IG +  L     G+  +   +
Sbjct: 1151 QKRFSQIN----QCRVDNNMSAFYPSVNANRWLAYRLELIGSIIIL-----GAATLSVMR 1201

Query: 367  LSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----IN 417
            L  G LTA M+     Y      ++  +     E+     +  RI E  DLK      I 
Sbjct: 1202 LKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIE 1261

Query: 418  PTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTI 476
              R  +  P +G +I+F++ S  Y  RP +  + +++NF I+    + IVG +G GKS++
Sbjct: 1262 DHRPQETWPEEG-DIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSL 1318

Query: 477  AWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
               L      S+G I+ID  DIS +    LR  + I+ Q+  +  GTIR+NI     Y  
Sbjct: 1319 TLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNQY-- 1376

Query: 537  TKEEIRSVAKQCFCHNFI-TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595
            T E+I  V +     + I T   D  DT +   G+ LS GQ+Q + +ARAL+    +L+L
Sbjct: 1377 TDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVL 1436

Query: 596  DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
            DEAT+A+DVE++  +  T     K +  TI++IAHR++TI  ++ ++VL N GS+ E  +
Sbjct: 1437 DEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDE 1493

Query: 656  FKELFANPA 664
             K+L  N +
Sbjct: 1494 PKKLLENKS 1502

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 131/285 (45%), Gaps = 37/285 (12%)

Query: 436 NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
           + +F +  +P   +  +N+NF+ ++G   CIVG  G GKS +              IL D
Sbjct: 630 DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALI-----------QSILGD 678

Query: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554
              +   +T  +  ++  V Q   +M+GT++DNI +G  Y    E      K C     +
Sbjct: 679 LFRVKGFAT--IHGNVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTIDL 734

Query: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 613
           +   D   T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 735 SVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 794

Query: 614 FGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXX 671
            G   L+ +K+  + +  +++S +  +++V +L N G +V+QG + E+  + A       
Sbjct: 795 LGPNGLLHTKTKVLAT--NKVSVLSVADSVSLLEN-GEIVQQGSYDEIMKDGASQLNKLI 851

Query: 672 XXXXXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAET 716
                 +N                +P+ S   TPASS T  + +T
Sbjct: 852 MEYGKKSNG---------------NPASSNAITPASSSTNIREQT 881

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 131/496 (26%), Positives = 218/496 (43%), Gaps = 48/496 (9%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K I+H    + DT  +G +++R   D   +   +T+ +   + + F    GV +
Sbjct: 967  LNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCV 1025

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +    +L A  +    R+  K+L+ V  +    +  E   G+ TI
Sbjct: 1026 MCIVYLPWFAIAIPFLLVIFVLIADHYQSSGRE-IKRLEAVQRSFVYNNLNEVLGGMDTI 1084

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ +++  + K +  I K+     EA ++         I  D+  +      + L   +
Sbjct: 1085 KAYRSQERFLAKSDFLINKM----NEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTR 1140

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFELTDLKPRINP 418
               +   +  +L T      +  L G  + I++          +A R+       P    
Sbjct: 1141 AFPISAASVGVLLT-----YVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEAS 1195

Query: 419  TRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGK 473
             R  +  P +     GEI F+NV F Y  RP +PI  +NLN  I+ G  + I G +G GK
Sbjct: 1196 YRKPEMTPPESWPSMGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGK 1253

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
            STI   L      + G+ILID  DIS L    LRR + I+ Q+P+L  GTIR N+     
Sbjct: 1254 STIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNE 1313

Query: 534  YTP-------------TKEEIRSVAKQ----CFCHNFITRFPDTYDTAIGPHGTLLSGGQ 576
             T               K+++  V  Q       H  + +F    D A+   G+  S G+
Sbjct: 1314 RTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGE 1371

Query: 577  KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 636
            +Q +A+ RAL+++  +LILDEATS++D E++G I     +  +    TI+ IAHRL TI 
Sbjct: 1372 RQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIV 1429

Query: 637  RSENVIVLGNDGSVVE 652
              + ++VL   G V E
Sbjct: 1430 NYDRILVL-EKGEVAE 1444

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 20/213 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F++LNF I++G  + I GP G GKS++   +      + G++ ++G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + ++RDNI +G  +   KE+   V + C     +   P    T IG  G
Sbjct: 652 --LMCGYPWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ KK  + + D+  SA+D    +  ++     ++ +K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            H+LS I R+  VIVLG DG  V+ G   EL A
Sbjct: 767 -HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 155/312 (49%), Gaps = 28/312 (8%)

Query: 367  LSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP----TRGS 422
            LS G +   M Y     N +  +     ++     +  RI E  DL P   P    +R  
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 423  KFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLH 482
            K  P++G  I FKN S  Y      P+ R+L+ +I+    + IVG +G GKST++  L  
Sbjct: 1281 KNWPSQG-LIRFKNYSTRYRANLD-PVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFR 1338

Query: 483  YYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIR 542
               PS+G I IDG DIS +  K LR ++ I+ Q+     GT+R N+     Y  + EEI 
Sbjct: 1339 ILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIW 1396

Query: 543  SVAKQCFCHNFITRFP----------DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTV 592
               +       I +            D   T I  +G+ LS GQ+Q + ++RAL+ +  +
Sbjct: 1397 KALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRI 1456

Query: 593  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL       +
Sbjct: 1457 LVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------D 1507

Query: 653  QGKFKELFANPA 664
            +G+ KE F +P+
Sbjct: 1508 KGEVKE-FDSPS 1518

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 114/244 (46%), Gaps = 30/244 (12%)

Query: 455 FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLRRH-IGI 512
           F++ +G  VC+VG  G GKST    LL       GQ+  I      A  T   R + + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 513 VQQEPILMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGP 567
             Q+  +M+ +++DN+ +G      TY  T E  + V         +    D  +T +G 
Sbjct: 702 CSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDETLVGE 754

Query: 568 HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES-----EGAINYTFGQLMKSKS 622
            G  LSGGQK R+++ARA+  +  V +LD+  SA+D E      E  ++   G L+K+K 
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLKNK- 812

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXXXXXXXGNNAAP 682
            T++   + +S ++ S+++  L  DG +VE G F ++                   N   
Sbjct: 813 -TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESENTKA 870

Query: 683 EIQP 686
           +I+P
Sbjct: 871 KIEP 874

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 161/323 (49%), Gaps = 26/323 (8%)

Query: 352  LVVLSYG----SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
            L+VLS G    S L    QLS G +   M Y     +++  +      I     +  RI 
Sbjct: 1189 LIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIV 1248

Query: 408  ELTDLKPRINPTRGSKFIPAKG---GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVC 464
            E  D+ P     +    +       G+IEFKN S +Y      P+ +++N  I  G  + 
Sbjct: 1249 EYCDISPEAPEVKEEHRLDDNWPNQGQIEFKNYSTSYRENLD-PVLKHINLVISPGEKIG 1307

Query: 465  IVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTI 524
            +VG +G GKST++  L     P+ G I ID  DI+++  + LR HI I+ Q+     GTI
Sbjct: 1308 VVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTI 1367

Query: 525  R-----------DNITYGLTYTPTKEEIRSVAKQCFC---HNFITRFPDTYDTAIGPHGT 570
            R           D++ + +  +  K  + ++AK+      ++  +R     D  +   G+
Sbjct: 1368 RSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRLESPLDIPVREAGS 1427

Query: 571  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
             LS GQKQ + +ARAL+ K  +L+LDEAT+++DVE++  I  T  +    +  TI++IAH
Sbjct: 1428 NLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILTIAH 1485

Query: 631  RLSTIRRSENVIVLGNDGSVVEQ 653
            RL T+  S+ +IVL  DG  V++
Sbjct: 1486 RLDTVFDSDRIIVL--DGGEVKE 1506

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 109/215 (50%), Gaps = 18/215 (8%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSL--RRHIG 511
           NF++ + S +C+VG  G GKSTI   +L       GQ+     +   LS +       + 
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCIL-------GQLPCISGNNDHLSPQFQINATTVA 691

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              QE  +M+ +++DNI +G  Y   +   ++  K C     I   PD  +T +G  G +
Sbjct: 692 YCPQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGIV 749

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVS 627
           LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS  IV 
Sbjct: 750 LSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVL 807

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
             + +S ++ S  + +L N  S+ ++G + ++  N
Sbjct: 808 ATNTISVLKHSTKIYLLENK-SIAQEGNYDDIMNN 841

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 129/502 (25%), Positives = 219/502 (43%), Gaps = 60/502 (11%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K I+H    + DT  +G +++R   D   +   +T+ +   + + F    GV +
Sbjct: 968  LNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCV 1026

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +    +L A  +    R+  K+L+ V  +    +  E   G+ TI
Sbjct: 1027 MCIVYLPWFAIAIPFLLIIFVLIADHYQSSGRE-IKRLEAVQRSFVYNNLNEVLGGMDTI 1085

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ +++  + K +  I K+     EA ++         I  D+  +V     + L   +
Sbjct: 1086 KAYRSQERFLAKSDFLINKM----NEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTR 1141

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG-------AGAASRIFELTDLKPRINP 418
               +   +  ++ T      +  L G  + +++          +A R+       P    
Sbjct: 1142 AFPISAASVGVMLT-----YVLQLPGLLNTLLRALTQTENDMNSAERLVSYATELPLEAD 1196

Query: 419  TRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGK 473
             R  +  P +     GEI FKNV F+Y  RP +P+  +NLN  I+ G  + I G +G GK
Sbjct: 1197 YRKPEMAPPESWPSKGEIAFKNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGK 1254

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
            STI   L      S G+ILID  +IS +    LRR + I+ Q+P+L  GTIR N+     
Sbjct: 1255 STIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL----- 1309

Query: 534  YTPTKEEIR-----------SVAKQCF------------CHNFITRFPDTYDTAIGPHGT 570
              P  E              ++AK                H  + +F    D A+   G+
Sbjct: 1310 -DPFNERTEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGS 1366

Query: 571  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
              S G++Q +A+ RAL+++  +LILDEATS++D E++G I     +  +    TI+ IAH
Sbjct: 1367 NFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAH 1424

Query: 631  RLSTIRRSENVIVLGNDGSVVE 652
            RL TI   + ++VL   G V E
Sbjct: 1425 RLKTIVNYDRILVL-EKGEVAE 1445

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 110/213 (51%), Gaps = 20/213 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F++L+F+I++G  + I GP G GKS++   +      + G+I ++G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T++DNI +G  +   KE+   V   C     +   P    T IG  G
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++     L+++K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT- 766

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            H+LS I ++  VIVLG DG  V+ G   EL A
Sbjct: 767 -HQLSLIEKASRVIVLGTDGD-VDIGTVDELKA 797

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 223/509 (43%), Gaps = 54/509 (10%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K I+H    + DT  +G +++R   D   +   +T+ I   + + F    GV +
Sbjct: 968  LNLKAVKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCV 1026

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF---GKQI-RDNSKKLQEVTANLTRVSEEQFNGI 302
            +              +    +L A  +   G++I R  + +   V  NL  V      G+
Sbjct: 1027 LCIVYLPWFAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEV----LGGM 1082

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLV 362
             TI+++ ++   M K +  I K+     E +++        +I  D+  +      S L 
Sbjct: 1083 DTIKAYKSQDRYMTKMDFLINKM----NEVSYMVVSVQRWVAIFLDMIAVAFALIISLLC 1138

Query: 363  FQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG-------AGAASRIFELTDLKPR 415
              +Q  +      +L T      +  L G  + +++          +A R+       P+
Sbjct: 1139 VTRQFHISPSAVGVLLT-----YVLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQ 1193

Query: 416  INPTRGSKFIPAKG----GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSG 470
                R S + P       GE+ F++VSF Y  RP +P + +N+N  I  G  + I G +G
Sbjct: 1194 EAAYRKSDYSPPDNWPTNGEVIFEDVSFAY--RPGLPTVLKNVNLSIAGGEKIGICGRTG 1251

Query: 471  KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
             GKSTI   L      + G+I IDG D   L    LRR + I+ Q+P+L  GTIR N+  
Sbjct: 1252 AGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDP 1311

Query: 531  GLTYTPT-------------KEEIRSVAKQ----CFCHNFITRFPDTYDTAIGPHGTLLS 573
               ++               K+++  +  Q       +N + +F    D  +   G   S
Sbjct: 1312 FNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFS 1369

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 633
             G++Q +A+ RAL+++  +LILDEATS++D E++G I        + +  TI+ IAHRL 
Sbjct: 1370 LGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLK 1427

Query: 634  TIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            TI   + ++VL   G V E  K + LF N
Sbjct: 1428 TILNYDRILVL-EKGEVAEFDKPEILFNN 1455

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 125/248 (50%), Gaps = 20/248 (8%)

Query: 413 KPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKG 472
           K   N    ++ I    GE + +  + N     T   F NLNF+I++G  + I GP G G
Sbjct: 580 KKDTNKDNKNQVIVDAIGEEDNERSTSNGEGTKTFTKFSNLNFEIKKGEFIMITGPIGTG 639

Query: 473 KSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL 532
           KS++   +  +   + G++ I+G             H+ ++   P + + T+RDNI +G 
Sbjct: 640 KSSLLNAMAGFMPQTTGELDING-------------HM-LLCGYPWIQNATVRDNIIFGS 685

Query: 533 TYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTV 592
            Y   +E+ + V + C     I   P    T IG  G  LSGGQK RI +AR++ K   +
Sbjct: 686 PYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERGITLSGGQKARINLARSVYKNKDI 743

Query: 593 LILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVV 651
            + D+  SA+D    +  ++  F Q ++SK+  + +  H+LS I +++ VIVL  +GS V
Sbjct: 744 YLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT--HQLSLIEKADRVIVLSTNGS-V 800

Query: 652 EQGKFKEL 659
           + G  +EL
Sbjct: 801 DIGTVEEL 808

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 137/511 (26%), Positives = 224/511 (43%), Gaps = 60/511 (11%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAV---FIGSAG 243
            L    +K I+H    + DT  +G +++R   D    + S+  ++++ V+ +   F    G
Sbjct: 999  LNLRAVKRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVG 1054

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGI 302
            V +M              +    +L A  +    R+  K+L+ +  +    +  E   G+
Sbjct: 1055 VCIMCIIYLPWFAIAIPFLFVGFVLIADHYQSSGRE-IKRLEAIQRSFVYNNFNEVLGGM 1113

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLV 362
             TI+S+ +E   + K +  I K+   G     +         +I     L++        
Sbjct: 1114 DTIKSYRSENRFIAKSDFLIDKMNEAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRA 1173

Query: 363  FQ-QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI--------FELTDLK 413
            F     SVG L  ++L      N +       ++      +A R+         E    K
Sbjct: 1174 FPISAASVGVLLTYVLQLPGLLNGVLRS---LTQTENDMNSAERLVTYATELPLEADYRK 1230

Query: 414  PRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKG 472
            P ++P       P KG EI F+NV F+Y  RP +P + +NL+  I+ G  + I G +G G
Sbjct: 1231 PEVSPPEE---WPTKG-EIHFENVDFSY--RPGLPTVLKNLSLDIKSGEKIGICGRTGAG 1284

Query: 473  KSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL 532
            KSTI   L      S G+++ID  DIS +    LRR + I+ Q+P+L  GTIR N+    
Sbjct: 1285 KSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLD--- 1341

Query: 533  TYTPTKEE------IRSVA-KQCFCHNFITRFPDT-----------YDTAIGPHGTLLSG 574
             +   ++E      +R  A +Q   +    + PD             D  +   G   S 
Sbjct: 1342 PFNEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKFHLDQLVEEEGANFSL 1401

Query: 575  GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY----TFGQLMKSKSMTIVSIAH 630
            G++Q +A+ RAL+++  +LILDEATS++D E++G I       FG        TI+ IAH
Sbjct: 1402 GERQLLALTRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TILCIAH 1455

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            RL TI   + ++VL   G V E    K LFA
Sbjct: 1456 RLKTILTYDRILVL-EKGEVAEFDTPKTLFA 1485

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 112/211 (53%), Gaps = 20/211 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F +LNF+I++G  + +VGP G GK+++      + N   G+I I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + +++DNI +G  Y   K +   V + C   + +   P    T IG  G
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ K+  + + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            H+LS + R+  VIVLGNDGS  + G  +EL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 141/530 (26%), Positives = 245/530 (46%), Gaps = 53/530 (10%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
            N   +++L   S     KL  N+ K +I     FF+T  VG +I+R  +D   V  S+  
Sbjct: 1036 NLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 229  KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVT 288
              S   K++      V ++              +   + +  + F   +    K+L  ++
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLL--VIYIYYQTFYIVLSRELKRLISIS 1153

Query: 289  AN-LTRVSEEQFNGIKTIQS------FVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFT 341
             + +  +  E  NG   I +      F+    E  ++N  I  +F       +++ +  T
Sbjct: 1154 YSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVRLQT 1211

Query: 342  T-ASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQG 399
              A+I+   + L + +  +    ++QLS G +   M Y+ E TG+  + +    + +M  
Sbjct: 1212 IGATIVLATAMLALTTMNT----KKQLSSGMVGLLMSYSLEVTGSLTWIVR---TTVMIE 1264

Query: 400  AGAAS--RIFELTDLKPR---INP-TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNL 453
                S  RI E  +L      INP  R  +  P+KG  IEFKN S  Y      P+ +++
Sbjct: 1265 TNIVSVERIVEYCELPSEARSINPENRPDESWPSKGS-IEFKNYSTKYRENLD-PVLKDI 1322

Query: 454  NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
            N +I+    + IVG +G GKST++  L     P++G I+ID  +IS L    LR H+ I+
Sbjct: 1323 NVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLAII 1382

Query: 514  QQEPILMSGTIRDNITYGLTYT--------------PTKE-----EIRSVAKQCFCHNFI 554
             Q+     GT+R N+     Y+              P  E     EIR        +  +
Sbjct: 1383 PQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENGNV 1442

Query: 555  TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF 614
            +   D  +  I  +GT LS GQ+Q + +ARAL+ +  +L+LDEAT+++D+E++  I  T 
Sbjct: 1443 S---DVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTI 1499

Query: 615  GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
             +  K +  TI++IAHR+ T+  S+ +IVL ++G+V E     +L ++ A
Sbjct: 1500 RREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKA 1546

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 102/448 (22%), Positives = 189/448 (42%), Gaps = 71/448 (15%)

Query: 297 EQFNGIKTIQSFVAEQSEMHKFNG--------SIRKIFAVGKEAAFI--NAKFFTTASII 346
           E  N IK+I+ +  E+  M + N         + RKI  V     F         T S  
Sbjct: 477 EILNAIKSIKLYAWEEPMMERLNHVRNDMELQNFRKIGIVSNLIYFAWNCVPLMVTCSTF 536

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
           G  S          +VF        L+ F +      +AI+++    + I++ + +  R+
Sbjct: 537 GLFSLFSDTPLSPAIVFPS------LSLFNI----LNSAIYSVPSMINTIIETSVSMERL 586

Query: 407 --FELTD-----LKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP----------- 448
             F L+D        RI+P+   + +P     IE  N++F + ++  +            
Sbjct: 587 KSFLLSDEIDDSFIERIDPSMSERTLPV----IEMNNITFLWKSKEALASGQFEGNSNAD 642

Query: 449 ----------IFRNLN-FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497
                       +N++ F+ ++G  VC+VG  G GKST    +L       GQ+      
Sbjct: 643 EESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKGIL-------GQLPCMSGS 695

Query: 498 ISALSTKSLRR--HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 555
             ++  K + R   +    QE  +M+ ++R+NI +G  +     ++    K C     + 
Sbjct: 696 KGSIPPKLIIRASSLAYCSQESWIMNSSVRENILFGHKFDKAYYDL--TIKACQLLPDLK 753

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF 614
             PD  +T +G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  + Y  
Sbjct: 754 ILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVL 813

Query: 615 -GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF----ANPAXXXXX 669
            G+    K+ TI+   + +  ++ S+ +  L N G ++EQG ++ +      N       
Sbjct: 814 IGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYEGVMNRENTNSKLKKLL 872

Query: 670 XXXXXXXGNNAAPEIQPQEISQTIEEDP 697
                   N +  +IQ +  S++  ++P
Sbjct: 873 EEFDSPIDNGSKSDIQTEHRSESDMDEP 900

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 131/510 (25%), Positives = 234/510 (45%), Gaps = 32/510 (6%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKH-IIHQDAQFFDTYKVGDLISRVGNDAF----IV 222
            A  ++ I+L +      +K   N++ + ++     FF+T  +G +++R  ND +    ++
Sbjct: 1006 ATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALL 1065

Query: 223  SRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSK 282
             R+ +Q   + VK  F  +     +              +G   +   + + +  R+  +
Sbjct: 1066 GRTFSQFFVNAVKVTFTIT-----VICATTWQFIFIIIPLGVFYIYYQQYYLRTSRE-LR 1119

Query: 283  KLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFT 341
            +L  +T + +    +E   G+ T++ +  ++   H     I    +    +   N     
Sbjct: 1120 RLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAY 1179

Query: 342  TASIIGDLSFLVVLSYGSWLVFQQQLS---VGDLTAFMLYTEYTGNAIFNLSGFFSEIMQ 398
               +IG +  L   +   + + Q  L+   VG   ++ L    T N I  ++    E+  
Sbjct: 1180 RLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWIVRMT---VEVET 1236

Query: 399  GAGAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNL 453
               +  RI E  DLK      I   R  K  PA+G +I F N S  Y  RP +  + + +
Sbjct: 1237 NIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQG-DIRFNNYSTRY--RPELDLVLKQI 1293

Query: 454  NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
            N  I+    V IVG +G GKS++   L      S+G I+IDG  I+ +    LR  + I+
Sbjct: 1294 NIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHKLSII 1353

Query: 514  QQEPILMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITRFPDTYDTAIGPHGTLL 572
             Q+  +  GT+R+NI     Y  + E I R++       + ++   D  D  +   G+ L
Sbjct: 1354 PQDSQVFEGTVRENIDPINQY--SDEAIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNL 1411

Query: 573  SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 632
            S GQ+Q + +ARA++    +L+LDEAT+A+DVE++  +  T     K +  TI++IAHRL
Sbjct: 1412 SVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRL 1469

Query: 633  STIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            +TI  S+ +IVL N G V E     +L +N
Sbjct: 1470 NTIMDSDRIIVLDN-GKVAEFDTPGQLLSN 1498

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/392 (22%), Positives = 173/392 (44%), Gaps = 59/392 (15%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           TRV  E  N IK+++ +  E+    K      N  ++ +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF--------FSEIMQ 398
              +F V        V+ +  +   LT  +++   T   +FNL  F         +  ++
Sbjct: 545 SCCTFAV-------FVYTEDRA---LTTDLVFPALT---LFNLLSFPLMIIPMVLNSFIE 591

Query: 399 GAGAASRIFEL---TDLKP----RINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-F 450
            + +  R+F      +L+P    R+        I    G+    + +F +  +P   +  
Sbjct: 592 ASVSIGRLFSFFTNEELQPDSVQRLPNVENIGDIAINIGD----DATFLWQRKPEYKVAL 647

Query: 451 RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
           +N++F+  +G+  CIVG  G GK+ +   +L      +G   + G              I
Sbjct: 648 KNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG-------------CI 694

Query: 511 GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
             V Q P +M+GT+++NI +G  Y    E      K C     +    D   T +G  G 
Sbjct: 695 AYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDLAILMDGDKTLVGEKGI 752

Query: 571 LLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVS 627
            LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + +
Sbjct: 753 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRILAT 812

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             +++S +  ++++ +L N G +++QG + ++
Sbjct: 813 --NKVSALSIADSIALLDN-GEIIQQGAYSDI 841

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 133/482 (27%), Positives = 230/482 (47%), Gaps = 41/482 (8%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXX 257
            FF+T  +G +++R  ND +    ++ R+ +Q   + VK  F       ++          
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSF-----TIIVICFTTWQFIF 1092

Query: 258  XXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMH 316
                +G   +   + F +  R+  ++L  +T + +    +E   GI TI+ +     + H
Sbjct: 1093 IIIPLGVFYIYYQQYFLRTSRE-LRRLDSITKSPIFSHFQETLGGITTIRGY----QQQH 1147

Query: 317  KFNGSIRKIFAVGKEAAF---INAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLT 373
            +F   I +       +AF   +NA  +  A  +  +  L++L   +  VF+  L  G LT
Sbjct: 1148 RFT-HINQCRVDNNMSAFYPSVNANRWL-AYRLETIGSLIILGAATLSVFR--LRQGTLT 1203

Query: 374  AFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----INPTRGSKF 424
            A M+     Y      ++  +     E+     +  RI E +DLK      I   R ++ 
Sbjct: 1204 AGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAET 1263

Query: 425  IPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
             P +G +I+F++ S  Y  RP +  I +++N  I+    V IVG +G GKS++   L   
Sbjct: 1264 WPDEG-DIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRI 1320

Query: 484  YNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRS 543
               S G+I+ID   I+ +    LR  + I+ Q+  +  GT+R+NI     Y  T E+I +
Sbjct: 1321 IEASSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWN 1378

Query: 544  VAKQCFCHNFITRFPDT-YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 602
            V       + I    D   +  +   G  LS GQ+Q + +ARAL+    +L+LDEAT+A+
Sbjct: 1379 VLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAV 1438

Query: 603  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            DVE++  I  T     K +  TI++IAHR++TI  S+ +IVL N G++ E    ++L  N
Sbjct: 1439 DVETDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLEN 1495

Query: 663  PA 664
            P+
Sbjct: 1496 PS 1497

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/398 (21%), Positives = 175/398 (43%), Gaps = 61/398 (15%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           TRV  E  N IK+++ +  E     K      N  ++ +  +G   A ++ +F       
Sbjct: 481 TRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQF------- 533

Query: 347 GDLSFLV-VLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF--------FSEIM 397
             + FLV   ++ +++  + +    DL        +    +FNL  F         + I+
Sbjct: 534 NVVPFLVSCCTFAAFIYTENRPLTTDLV-------FPALTLFNLLHFPLMVIPNVLTMII 586

Query: 398 QGAGAASRIFEL-------TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI- 449
           + + +  R+F          D   R+        +    G+    + +F +  +P   + 
Sbjct: 587 ETSVSIGRLFSFLTNEELQKDAVQRLPKVTNIGDVAINVGD----DATFLWQRKPEYKVA 642

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
            +N+NF+ ++G   CIVG  G GKS +              IL D   +   +T  +  +
Sbjct: 643 LKNINFQAKKGELTCIVGKVGSGKSAMI-----------QSILGDLFRVKGFAT--IHGN 689

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
           +  V Q   +M+GT+++NI +G  Y   ++  +   K C     +    D   T +G  G
Sbjct: 690 VAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTIDLAVLMDGDQTLVGEKG 747

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIV 626
             LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +  G   L+ +K+  + 
Sbjct: 748 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLA 807

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
           +  +++S +  +++V +L N G +V+QG + E+  + +
Sbjct: 808 T--NKVSVLSIADSVSLLEN-GEIVQQGTYDEIMKDDS 842

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 132/515 (25%), Positives = 236/515 (45%), Gaps = 42/515 (8%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKH-IIHQDAQFFDTYKVGDLISRVGNDAF----IV 222
            A  ++ I+L +      +K   N++ + ++     FF+T  +G +++R  ND +    ++
Sbjct: 1006 ATLIQTIVLWVFCTIHASKYLHNLMANSVLRAPMAFFETTPIGRILNRFSNDIYKVDALL 1065

Query: 223  SRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSK 282
             R+ +Q   + VK +F  +     +              +G   +   + + +  R+  +
Sbjct: 1066 GRTFSQFFVNAVKVIFTIT-----VICATTWQFIFIIIPLGVCYIYYQQYYLRTSRE-LR 1119

Query: 283  KLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFT 341
            +L  +T + +    +E   G+ T++ +  ++   H     I    +    +   N     
Sbjct: 1120 RLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAY 1179

Query: 342  TASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA--------FMLYTEYTGNAIFNLSGFF 393
               +IG +   ++L   +  VF+  L  G LTA        + L    T N I  ++   
Sbjct: 1180 RLELIGSI---IILGAATLSVFR--LKQGTLTAGMAGISLSYALQITQTLNWIVRMT--- 1231

Query: 394  SEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAK----GGEIEFKNVSFNYPTRPTVP- 448
             E+     +  RI E  DLK    P      +P K     G+I+F N S  Y  RP +  
Sbjct: 1232 VEVETNIVSVERIKEYADLKSEA-PLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDL 1288

Query: 449  IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR 508
            + +++N  I+    + IVG +G GKS++   L      S G I+IDG  I+ +    LR 
Sbjct: 1289 VLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRH 1348

Query: 509  HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITRFPDTYDTAIGP 567
             + I+ Q+  +  G++R+NI     Y  T E I R++       + ++   D  D  +  
Sbjct: 1349 RLSIIPQDSQVFEGSLRENIDPTNQY--TDEAIWRALELSHLKEHVLSMSNDGLDAQLTE 1406

Query: 568  HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 627
             G  LS GQ+Q + +ARA++    +LILDEAT+A+DVE++  +  T     K +  TI++
Sbjct: 1407 GGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILT 1464

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            IAHRL+TI  S+ +IVL N G+V E     +L +N
Sbjct: 1465 IAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSN 1498

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 86/392 (21%), Positives = 172/392 (43%), Gaps = 59/392 (15%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           TRV  E  N IK+++ +  E+    K      N  ++ +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLV 544

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF--------FSEIMQ 398
              +F V        V+ +  +   LT  +++   T   +FNL  F         +  ++
Sbjct: 545 SCCTFAV-------FVYTEDRA---LTTDLVFPALT---LFNLLSFPLMIIPMVLNSFIE 591

Query: 399 GAGAASRIFEL---TDLKP----RINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-F 450
            + +  R+F      +L+P    R+        +    G+    + +F +  +P   +  
Sbjct: 592 ASVSIGRLFTFFTNEELQPDSVQRLPKVENFGDVAINVGD----DATFLWQRKPEYKVAL 647

Query: 451 RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
           +N+NF+ ++G   C+VG  G GK+ +   +L      +G   + G              +
Sbjct: 648 KNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVHGS-------------V 694

Query: 511 GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
             V Q P +M+GT+ +NI +G  Y    E      K C     +    D   T +G  G 
Sbjct: 695 AYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTIDLAILMDGDKTLVGEKGI 752

Query: 571 LLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVS 627
            LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + +
Sbjct: 753 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLAT 812

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             +++S +  +++V +L N G ++++G + E+
Sbjct: 813 --NKVSALSIADSVALLDN-GEIIQKGTYDEI 841

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 129/490 (26%), Positives = 223/490 (45%), Gaps = 37/490 (7%)

Query: 194  HIIHQDA------QFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAG 243
            H I  DA       FF+T  +G +++R  ND F    ++ R+  Q   + +K  F     
Sbjct: 1012 HNIMADAVFKAPMSFFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIKVSF----- 1066

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGI 302
              ++              MG+  +   + + +  R+  ++L  VT +      +E   GI
Sbjct: 1067 TIIVICFSTWQFILVILPMGTLYIYYQQYYLRTSRE-LRRLDSVTRSPIYAHFQETLGGI 1125

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLV 362
             TI+ +  ++  +H     +    +    +   N         IG +  L   S     +
Sbjct: 1126 STIRGYNQQKRFVHINQARVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVLRL 1185

Query: 363  FQQQLS---VGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR---- 415
             Q  L+   +G   ++ L    + N I  ++    E+     +  RI E  +L+      
Sbjct: 1186 KQGALTPGMIGLSVSYALQITQSLNWIVRMT---VEVETNIVSVERIKEYANLESEAPAV 1242

Query: 416  INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKS 474
            I   R S+  P++G  I+F+N S  Y  RP + +  +++N  I+    + IVG +G GKS
Sbjct: 1243 IESNRPSEDWPSQGS-IKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKS 1299

Query: 475  TIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTY 534
            ++   L      + G+I IDG  I ++  + LR H+ I+ Q+  L  GTIR+NI     Y
Sbjct: 1300 SLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY 1359

Query: 535  TPTKEEIRSVAKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
              T E+I    +     + +     +  D  +   G+ LS GQ+Q + +ARAL+    +L
Sbjct: 1360 --TDEQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKIL 1417

Query: 594  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
            +LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ ++VL + G V E 
Sbjct: 1418 VLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEF 1474

Query: 654  GKFKELFANP 663
                 L  NP
Sbjct: 1475 DTPDNLLKNP 1484

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 94/402 (23%), Positives = 176/402 (43%), Gaps = 55/402 (13%)

Query: 282 KKLQEVTANL----TRVSEEQFNGIKTIQSFVAEQSEMHKFN-----GSIRKIFAVGKEA 332
           KKLQ+V        TR+  E  N IK+++ +  E+    K +       ++ +  +G   
Sbjct: 460 KKLQKVQMKYKDGRTRLISEILNNIKSLKLYAWEEPYRKKLDYVRNEKELKNLRRMGITN 519

Query: 333 AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
           A  + +F         + FLV  S     ++ Q      LT  +++   T   +FNL  F
Sbjct: 520 ACASFQF-------NVIPFLVSCSTFGVFIWTQD---APLTTDLVFPALT---LFNLLAF 566

Query: 393 --------FSEIMQGAGAASRI--FELTDLKPRINPTRGSKFIPAKGGEIEFK---NVSF 439
                    +  ++ + + +R+  F   +   R +  R SK    K GE+      + +F
Sbjct: 567 PLAVIPTAITAFVEASVSITRLQSFLTNEELQRDSVQRKSKV--TKKGEVAVNVGADATF 624

Query: 440 NYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDI 498
            +  +P   +  +N+NF  ++G   C+VG  G GKS +   +L             G   
Sbjct: 625 LWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL-------------GDLF 671

Query: 499 SALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFP 558
                 S+   I  V Q P +M+GT++DNI +G  Y  +   +    K C     +   P
Sbjct: 672 RVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDLAVLP 729

Query: 559 DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQL 617
               T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +  G  
Sbjct: 730 KGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPN 789

Query: 618 MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
               S T V   ++++ +  ++++ +L N G +++QG + ++
Sbjct: 790 GLLASKTKVLATNKITVLSIADHIALLEN-GEIIQQGSYDDV 830

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 129/489 (26%), Positives = 223/489 (45%), Gaps = 43/489 (8%)

Query: 195  IIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXX 250
            ++     FF+T  +G +++R  ND +    ++ R+ +Q   + VK  F            
Sbjct: 1018 VLRAPMSFFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTF---------TIV 1068

Query: 251  XXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EEQFNGIKTI 305
                       +  PL +    + +     S++L+ + + +TR       +E   G+ TI
Sbjct: 1069 VICTSTWQFILVVLPLSVLYIYYQQYYLRTSRELRRLDS-VTRSPIYAHFQETLGGVSTI 1127

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            + +  ++   H     I    +    A   N         +G +   ++L   +  VF+ 
Sbjct: 1128 RGYGQQKRFAHINQARIDNNMSAFYPAVNANRWLAFRLEFLGSI---IILGAATLSVFR- 1183

Query: 366  QLSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----I 416
             L  G LTA M+     Y      ++  +     E+     +  RI E  +LKP     I
Sbjct: 1184 -LKQGTLTAGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAII 1242

Query: 417  NPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKST 475
              +R  K  P++G +I F++ S  Y  RP +  I R++N  I+    V IVG +G GKS+
Sbjct: 1243 ESSRPPKGWPSQG-DIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSS 1299

Query: 476  IAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
            +   L      ++G I IDG     +    LR  + I+ Q+  + +GT+R+N+    T  
Sbjct: 1300 LTLALFRIIEAAEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEE 1357

Query: 536  PTKEEI-RSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI 594
             T EEI  ++       + ++   D   T +   G+ LS GQ+Q + +ARAL+    +L+
Sbjct: 1358 FTDEEIWHALELSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILV 1417

Query: 595  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
            LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ +IVL N+G V E  
Sbjct: 1418 LDEATAAVDVETDRVIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFD 1474

Query: 655  KFKELFANP 663
              + L   P
Sbjct: 1475 TPENLLQRP 1483

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 117/235 (49%), Gaps = 21/235 (8%)

Query: 430 GEIEFK---NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
           G+I  K   + +F +  +P   +  +N+NF+ ++G   CIVG  G GKS +   +L    
Sbjct: 614 GDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGSGKSALIQSILGDLF 673

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
             +G   I G              +  V Q P +M+GT+++NI +G  Y P+  E     
Sbjct: 674 RVKGFATIHGS-------------VAYVSQIPWIMNGTVKENILFGHKYDPSFYE--KTV 718

Query: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
           K C  +  ++  P    T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D  
Sbjct: 719 KACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 778

Query: 606 -SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            ++  ++   G      S T V   ++++ +  ++++ +L N G +V+QG + E+
Sbjct: 779 VAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALLEN-GEIVQQGSYDEV 832

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 129/523 (24%), Positives = 235/523 (44%), Gaps = 46/523 (8%)

Query: 169  NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228
            N   +I+L   S     KL  N+ K +I     FF+T  VG +I+R  +D   V  S+  
Sbjct: 1036 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 229  KISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVT 288
              S   K++      + ++              +   + +  + F   +    K+L  ++
Sbjct: 1096 VFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLL--VIYIYYQTFYIVLSRELKRLISIS 1153

Query: 289  AN-LTRVSEEQFNGIKTIQSFVAEQSEMH----KFNGSIRKIFAVGKEAAFINAKFFTT- 342
             + +  +  E  NG   I ++   +  ++    K   +I  +F       +++ +  T  
Sbjct: 1154 YSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIG 1213

Query: 343  ASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGA 402
            A+I+   + L + +  +    + QLS G +   M Y+    +++  +      I     +
Sbjct: 1214 ATIVLATALLALATINT----KNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVS 1269

Query: 403  ASRIFELTDLKPR---INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQ 459
              RI E  +L P    INP +         G IEFKN S  Y      P+ +++N  I+ 
Sbjct: 1270 VERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKYRENLD-PVLKDINVSIQP 1328

Query: 460  GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
               + IVG +G GKST++  L     PS+G+I+ID  +IS L    LR ++ I+ Q+   
Sbjct: 1329 CEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQA 1388

Query: 520  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF------------------PDTY 561
              GT+R N+     Y  +++E++   +     + + +                    D  
Sbjct: 1389 FEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDIL 1446

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
            D  I  +G+ LS GQ+Q + +ARAL+    +L+LDEAT+++D+E++  I  T  +  K +
Sbjct: 1447 DVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR 1506

Query: 622  SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
              TI++IAHR+ T+  S+ +IVL       ++G  KE F +P+
Sbjct: 1507 --TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDSPS 1539

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 108/208 (51%), Gaps = 14/208 (6%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR--HIG 511
           +F+ ++G  +C+VG  G GKST    +L       GQ+        +L+ K + R   + 
Sbjct: 659 HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 711

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              QE  +M+ ++R+NI +G  +     ++    K C     +   PD  +T +G  G  
Sbjct: 712 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 769

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIA 629
           LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I +   G+    K+ TI+   
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 829

Query: 630 HRLSTIRRSENVIVLGNDGSVVEQGKFK 657
           + +S ++ S+ +  L N G +VEQG ++
Sbjct: 830 NTVSILKHSQMIYALEN-GEIVEQGNYE 856

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/516 (25%), Positives = 227/516 (43%), Gaps = 68/516 (13%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L  N +  ++H    + DT  +G +++R   D    + S+  ++++ V+ +      +  
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNI-- 1000

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF-GKQIRDNSKKLQEVTA--------NLTRVSEE 297
            +              +  P L    V      +  S++++ + A        NL  V   
Sbjct: 1001 VAVIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEV--- 1057

Query: 298  QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL-----SFL 352
               G+ TI+S+  ++    K +  I K+     EA ++        SI  D+     + +
Sbjct: 1058 -LGGMDTIKSYKGQKRFQAKSDYLINKM----NEAGYLLVSVQRWVSIFLDMVAIIFALI 1112

Query: 353  VVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI------ 406
            + L   + +      SVG L  ++L      N++       ++      +A R+      
Sbjct: 1113 IALLSVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRA---LTQTENDMNSAERLVNYATK 1169

Query: 407  --FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNV 463
               E    KP ++P       P+KG EI F +V F Y  R  +P+  + LN  I+ G  +
Sbjct: 1170 LPLEAAYKKPELSPPES---WPSKG-EIRFLDVDFAY--RSGLPVVLKGLNLDIKSGEKI 1223

Query: 464  CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
             I G +G GKSTI   L      + G+ILID  DIS L    LRR + I+ Q+P+L  GT
Sbjct: 1224 GICGRTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGT 1283

Query: 524  IRDNITYGLTYTPT-------------KEEIRSVAKQCF----CHNFITRFPDTYDTAIG 566
            IR N+     Y  +             KE +  V  +       H  + +F    D  + 
Sbjct: 1284 IRKNLDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVE 1341

Query: 567  PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
              G+  S G++Q +A+ RAL+++  +LILDEATS++D E++G I     +  +  + TI+
Sbjct: 1342 EEGSNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTIL 1399

Query: 627  SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
             IAHRL TI + + ++VL   G + E  +  +LF++
Sbjct: 1400 CIAHRLKTILQYDRILVL-EKGVIAEFDQPFKLFSD 1434

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 103/201 (51%), Gaps = 19/201 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F NL+F+I +G  + I GP G GKS++      + N ++G+I ++G  +           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNGDLLFC--------- 638

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
                  P + + T++DNI +G  +   KE+  +V + C     +   P    T IG  G
Sbjct: 639 -----GYPWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +ARA+ K   + + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 629 AHRLSTIRRSENVIVLGNDGS 649
            H+LS I +++ VIVLG DGS
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS 770

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 135/524 (25%), Positives = 230/524 (43%), Gaps = 84/524 (16%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    ++ I+H    + DT  +G +++R   D   +   +T+ I      + +   G  +
Sbjct: 933  LNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR-----LMLSQVG-NL 986

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF--------GKQIRDNSKKLQEVTANLTRVS-EE 297
            +              +  P LL   V         G++I    K+L+ V  +    +  E
Sbjct: 987  IGVIVMCIVYLPWFAIAVPFLLIIFVLICDHYQSTGREI----KRLEAVQRSFVYNNFNE 1042

Query: 298  QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSY 357
               G+ TI+++ +++  + K +  I K+     EA ++        +I+ D   +V    
Sbjct: 1043 VLGGMDTIKAYGSQERFLAKTDYLINKM----NEAGYLIVAVQRWVAILLDSVAVVFALI 1098

Query: 358  GSWLVFQQQ--LSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG-------AGAASRI-- 406
             + L   +   +S G +   + Y       +  L G  + I++          +A R+  
Sbjct: 1099 ITLLCVTRAFPISAGSVGVLLTY-------VLQLPGLLNTILRALTQTENDMNSAERLVT 1151

Query: 407  ------FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQ 459
                   E    KP ++P       P KG +I+F +V+F Y  RP +P+  +N+N KI  
Sbjct: 1152 YATELPLEAAYRKPEVSPPES---WPEKG-DIDFIDVNFAY--RPGLPVVLKNMNLKINN 1205

Query: 460  GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
            G  + I G +G GKSTI   L      S G+I+IDG DI  +    LR+ + I+ Q+P+L
Sbjct: 1206 GEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVL 1265

Query: 520  MSGTIRDNITYGLTYTPTKEE---------IRS-VAKQCFCHNFITRFPDT--------- 560
              GTIR N+       P KE          IR+ V ++   ++     PD          
Sbjct: 1266 FRGTIRKNL------DPFKECSDDLLWDALIRTGVVERENLNDIKLEKPDENNSYSNMHK 1319

Query: 561  --YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLM 618
               D  +   G+  S G++Q +A+ RAL++   +LILDEATS++D E++G I      + 
Sbjct: 1320 FHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI--VS 1377

Query: 619  KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            +    TI+ IAHRL TI   + ++VL   G + E  K  ELF +
Sbjct: 1378 EFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFND 1420

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 107/213 (50%), Gaps = 24/213 (11%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F +LN +I +G  + + GP G GK+++   +  +   + G++ ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITRFPDTYDTAIGP 567
             ++   P +++ T+RDNI +G  Y    EE R   + + C     +   P    T IG 
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 568 HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIV 626
            G  LSGGQK RI +ARA+ K   + + D+  SA+D    +  ++     ++K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           +  H+LS I R++ +IV+G +GS  + G   EL
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 127/516 (24%), Positives = 228/516 (44%), Gaps = 46/516 (8%)

Query: 172  RVILLRILSENLVAKLRANVIKH-IIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKI 230
            R I++ +      +KL  N + H ++     FF+T  VG +++R  +D   +       I
Sbjct: 1051 RTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVGRIVNRFSSDVNSIDEDFQHII 1110

Query: 231  SDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDN-SKKLQEVTA 289
            S      F   + +  +              + + +LL    + + +    S++L+ +T+
Sbjct: 1111 S------FFFRSMLDYLITIVIITVSMPWFLLFNTILLGIYYYYQTLYVVLSRELKRLTS 1164

Query: 290  ----NLTRVSEEQFNGIKTIQSF----VAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFT 341
                 +  +  E   G   I ++    +           +I  IF       +++ +  T
Sbjct: 1165 ISYSPVMSLLSETLGGHVVINAYKHANIFNYYNFENIQTNINFIFNFRSTNRWLSMRLQT 1224

Query: 342  TASIIGDLSFLVVL-SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA 400
              ++I  ++ L+ L S G+       +S G +   M Y     +++  +      I    
Sbjct: 1225 IGAVIVLITSLMALASLGT----SNPISAGLIGLLMSYALQVSSSLMWIIRMAVNIETTI 1280

Query: 401  GAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFK 456
             +  RI E  DLKP     I  +R  K  P K GEI F++ +  Y      P+ ++++ +
Sbjct: 1281 VSVERIIEYRDLKPEGIRVIEDSRPPKNWP-KRGEITFEHYTTKYRENLD-PVLKDIDLR 1338

Query: 457  IEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQE 516
            I+    + +VG +G GKST+   L     P +G+I IDG DIS L    LRR + I+ Q+
Sbjct: 1339 IKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQD 1398

Query: 517  PILMSGTIRDNITYGLTYTPTK--EEIRSVAKQCFCHNFITRFPDT-------YDTAIGP 567
                 GT+R N+     +T  +  + +     +      ++  PD         DT I  
Sbjct: 1399 AQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPDDENKPTDLLDTQISD 1458

Query: 568  HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 627
            +G  LS GQ+Q + ++RAL+    +LILDEAT+A+D E++  I  T     K +  TI++
Sbjct: 1459 NGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TILT 1516

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
            IAHR+ T+  S+ ++VL       ++G+ KE F  P
Sbjct: 1517 IAHRIDTVLDSDKIMVL-------DKGEVKE-FDTP 1544

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 111/494 (22%), Positives = 203/494 (41%), Gaps = 77/494 (15%)

Query: 268 LSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIR---K 324
           L  K+F  Q++   K+++ VT        E  N +K+I+ +  E+  + + N  +R   +
Sbjct: 452 LYKKLFKTQMQYKDKRIKTVT--------EILNSMKSIKLYAWEKPMLDRLN-HVRNDLE 502

Query: 325 IFAVGKEAAFINAKFFT--TASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYT 382
           +  + K A   N  FF      ++   S  V+ SY +  V   Q+    LT F +     
Sbjct: 503 LHNMKKIAIVSNFMFFCWNIVPLLVTCSTFVLFSYLTDQVLSPQIIFPSLTLFSM----L 558

Query: 383 GNAIFNLSGFFSEIMQGAGAASRI-----FELTDLKPRINPTRGSKFIPAKGGEIEFKNV 437
            +A+F +    S I++   +  R+      E  D    I   R +    A    +E  N 
Sbjct: 559 NDALFTVPTMISNIIEIGVSLKRLKGYLLAEELD-TSFIEHARAT----ASDPTVEISNA 613

Query: 438 SFNYPT-----------------RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480
            F + +                  P V +    NF  ++    CIVG  G GKST    +
Sbjct: 614 VFLWKSPKSAASSEDTDEEAEISSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAI 673

Query: 481 LHYYNPSQGQI-LIDGQDISALSTKSLRR--HIGIVQQEPILMSGTIRDNITYGLTYTPT 537
           L       GQ+  +     S +  K + R  ++    Q+P +M+ +++DNI +G  Y   
Sbjct: 674 L-------GQLPCVSSDSASGVKPKVVIRADNLAYCPQQPWIMNASLKDNILFGYKYD-- 724

Query: 538 KEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDE 597
           +   +   K C     +   PD   T +G  G  LSGGQK R+++ARA+  +  + +LD+
Sbjct: 725 EAMYKKTIKACQLLPDLEILPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDD 784

Query: 598 ATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
             SA+D    +  I+    +   L+K+K  T++   + ++ +  S+ + +L N G +VE 
Sbjct: 785 VLSAVDSHVCKSIIDDVLDRQKGLLKNK--TVILTTNAVNVLVHSDMIYLLKN-GKIVES 841

Query: 654 GKFKELFA---NPAXXXXXXXXXXXXGNNAAPE----------IQPQEISQTIEEDPSFS 700
             ++E+ +   N               +N + E          I  + +  + E+D    
Sbjct: 842 NSYEEVMSKDRNNGEKSSLREIIEEFASNESEETAEKKSESSTIDDKNVGSSSEDDGDLE 901

Query: 701 GEATPASSVTGFKA 714
           G   P   +  ++A
Sbjct: 902 GAPQPPEHLLNYEA 915

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 140/530 (26%), Positives = 237/530 (44%), Gaps = 61/530 (11%)

Query: 171  VRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKI 230
            ++  L  I   N   K+ A ++  +IH   +FFDT  +G +++R   D   V + +T  +
Sbjct: 1178 LKTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYL 1237

Query: 231  SDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN 290
            + G    F+      ++              +     L    +    R+  K+L  +T +
Sbjct: 1238 T-GAFYSFVECFSTIILISWITPQFFVVAILISIMYYLVGYFYMAGSRE-LKRLDSITKS 1295

Query: 291  -LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL 349
             + +   E   G+ TI++F  E   + +       +F + +     N  FF        L
Sbjct: 1296 PIYQHFSETLVGVTTIRAFGDEMRFLKE------NLFKIDEN----NKPFFYLWVANRWL 1345

Query: 350  SFLVVLSYGSWLVFQ---------QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQG 399
            SF + +  GS++VF          + +  G     + Y   +T  A++ L  F+SE+   
Sbjct: 1346 SFRIDM-IGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTEGALW-LVRFYSEVEMN 1403

Query: 400  AGAASRIFELT-------DLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFR 451
              +  RI E         D+K  I   R    +    G+IE  ++S  Y     +P + +
Sbjct: 1404 MNSVERIKEYMSVEQEPYDIKDEI--VRTPPTVWPDEGKIEVNDLSLRYAA--NLPRVIK 1459

Query: 452  NLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIG 511
            N++F +E  S V +VG +G GKSTI   L  + +P  G I ID  DI+ +    LRR I 
Sbjct: 1460 NVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAIT 1519

Query: 512  IVQQEPILMSGTIRDNITYGLTYTP-------------TKEEIR----SVAKQCFCH-NF 553
            I+ Q+P L +GT++ N+     Y               + EE+     +V+ Q   H N 
Sbjct: 1520 IIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNN 1579

Query: 554  ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYT 613
              RF D     I   G  LS GQ+Q I +AR+L++ P +L+LDEAT+++D ES+  +  T
Sbjct: 1580 ENRFLDL-SNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQAT 1638

Query: 614  F-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
              G+   S   TI++IAHRL ++   + ++V+ + G V+E      L  N
Sbjct: 1639 IRGEFGNS---TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLN 1684

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 117/241 (48%), Gaps = 9/241 (3%)

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
           +  +G ++ F N + ++ T  +    RNLN   + G    ++G +G GK+++   LL   
Sbjct: 752 VDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEM 811

Query: 485 NPSQGQILIDG-QDISALSTKS--LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEI 541
           +  QG+I++   +  S+L+  S      I    Q   L++ T+R+NI +  ++   +   
Sbjct: 812 HICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDENR--Y 869

Query: 542 RSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
             V + C              T IG  G  LSGGQKQRI++ARAL      L+LD+  SA
Sbjct: 870 HKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSA 929

Query: 602 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           +D  +   I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V +QG    L
Sbjct: 930 VDSHTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDPLNL 987

Query: 660 F 660
           F
Sbjct: 988 F 988

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/323 (29%), Positives = 162/323 (50%), Gaps = 36/323 (11%)

Query: 364 QQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR---INPT- 419
           + QLS G +   M Y+    +++  +      I     +  RI E  +L P    INP  
Sbjct: 660 KNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEK 719

Query: 420 RGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWL 479
           R  +  P++G  IEFKN S  Y      P+ +++N  I+    + IVG +G GKST++  
Sbjct: 720 RPDENWPSEG-RIEFKNYSTKYRENLD-PVLKDINVSIQPCEKIGIVGRTGAGKSTLSLA 777

Query: 480 LLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKE 539
           L     PS+G+I+ID  +IS L    LR ++ I+ Q+     GT+R N+     Y  +++
Sbjct: 778 LFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SED 835

Query: 540 EIRSVAKQCFCHNFITRF------------------PDTYDTAIGPHGTLLSGGQKQRIA 581
           E++   +     + + +                    D  D  I  +G+ LS GQ+Q + 
Sbjct: 836 ELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLC 895

Query: 582 IARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 641
           +ARAL+    +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +
Sbjct: 896 LARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKI 953

Query: 642 IVLGNDGSVVEQGKFKELFANPA 664
           IVL       ++G  KE F +P+
Sbjct: 954 IVL-------DKGNVKE-FDSPS 968

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 109/211 (51%), Gaps = 14/211 (6%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR--HIG 511
           +F+ ++G  +C+VG  G GKST    +L       GQ+        +L+ K + R   + 
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 140

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              QE  +M+ ++R+NI +G  +     ++    K C     +   PD  +T +G  G  
Sbjct: 141 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 198

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIA 629
           LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I +   G+    K+ TI+   
Sbjct: 199 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 258

Query: 630 HRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           + +S ++ S+ +  L N G +VEQG ++ + 
Sbjct: 259 NTVSILKHSQMIYALEN-GEIVEQGNYESVM 288

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 130/500 (26%), Positives = 225/500 (45%), Gaps = 43/500 (8%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSA 242
            L ++++  I+     FF+T  +G +++R  ND +    ++ RS +Q   + VK  F    
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSF---- 1088

Query: 243  GVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNG 301
               ++              MG   L   + + +  R+  ++L  +T +      +E   G
Sbjct: 1089 -TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRE-LRRLDSITKSPIYAHFQESLGG 1146

Query: 302  IKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWL 361
            + TI+ +  ++  +H     +    +    +   N         +G L     + +G+  
Sbjct: 1147 LATIRGYEQQKRFIHINQARVDNNMSAYYPSINSNRWLAYRLEFLGSL-----IIFGAAS 1201

Query: 362  VFQQQLSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR- 415
            +   +L  G LTA M+     Y      ++  +     E+     +  RI E  +LK   
Sbjct: 1202 LSILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEA 1261

Query: 416  ---INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGK 471
               I   R S+  P +G  I+F+N S  Y  RP +  + +N++  I+    V IVG +G 
Sbjct: 1262 PLIIEEKRPSENWPERGA-IKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGA 1318

Query: 472  GKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYG 531
            GKS++   L      ++G I++DG +IS +    LR  + I+ Q+  +  GTIR+NI   
Sbjct: 1319 GKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPT 1378

Query: 532  LTYTPTKEEIRSVAKQCFCHNFITRFPD---------TYDTAIGPHGTLLSGGQKQRIAI 582
              Y  T E+I +  +       I R  +            T +   G  LS GQ+Q + +
Sbjct: 1379 NIY--TDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCL 1436

Query: 583  ARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 642
            ARAL+    +LILDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++
Sbjct: 1437 ARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIV 1494

Query: 643  VLGNDGSVVEQGKFKELFAN 662
            VL + G V E    + L  N
Sbjct: 1495 VL-DKGEVAEFDTPQNLLKN 1513

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 105/409 (25%), Positives = 186/409 (45%), Gaps = 63/409 (15%)

Query: 282 KKLQEVTANL----TRVSEEQFNGIKTIQSFVAEQSEMHKFN-----GSIRKIFAVGKEA 332
           K+LQ+V        TRV  E  N IK+++ +  EQ    K         ++ +  +G   
Sbjct: 471 KQLQKVQMKYKDERTRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFN 530

Query: 333 AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
           A  N +F         + FLV  S  +  V+ +      LT  +++   T   +FNL  F
Sbjct: 531 AMTNFQF-------NLVPFLVSCSTFAVFVYIED---KPLTTDLVFPALT---LFNLLTF 577

Query: 393 --------FSEIMQGAGAASRIFEL-------TDLKPRINPTRGSKFIPAKGGEIEFKNV 437
                    +  ++ + + SR+F         TD   R+ P +    I    G+    N 
Sbjct: 578 PLAALPIVITAFIEASVSMSRLFSFMTNEELQTDAIQRLPPVKKQGDIAVNIGD----NA 633

Query: 438 SFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQ 496
           +F +  +P   +  +N+ F+ ++G   CIVG  G GKS                IL D  
Sbjct: 634 TFLWKRKPEYKVALKNIEFQAKKGELACIVGKVGSGKSAFI-----------QSILGDLF 682

Query: 497 DISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITR 556
            +   +T  +  ++  V Q P +M+GT++DNI +G  Y   +E      + C     ++ 
Sbjct: 683 RVKGFAT--IHGNVAYVSQLPWIMNGTVKDNILFGHKYN--QEFYEKTLRACALTIDLSI 738

Query: 557 FPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFG 615
            PD   T +G  G  LSGGQK R+++ARA+  +  V +LD+  +A+D   S+  I +  G
Sbjct: 739 LPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIG 798

Query: 616 Q--LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
              L+ +K+  + +  +++S +  ++N+ +L +DG +V+QG + E+  N
Sbjct: 799 PNGLLHTKTRVLAT--NKISVLSIADNITLL-DDGEIVQQGTYNEVTDN 844

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 152/313 (48%), Gaps = 27/313 (8%)

Query: 365  QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP----TR 420
            + LS G +   M Y     N +  +     ++     +  RI E  DL P   P     R
Sbjct: 1228 KALSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCR 1287

Query: 421  GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480
              K  PA+G  + FK+ S  Y      P+ + LN +I     + IVG +G GKST++  L
Sbjct: 1288 PEKNWPAQG-HVVFKDYSARYRENLD-PVLKKLNVEINPQEKIGIVGRTGAGKSTLSLAL 1345

Query: 481  LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540
                 P  G I+IDG DI+ +    LR H+ I+ Q+     G++R N+     Y  + +E
Sbjct: 1346 FRILEPCGGTIVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDE 1403

Query: 541  IRSVAKQCFCHNFITRFPDT---------YDTAIGPHGTLLSGGQKQRIAIARALIKKPT 591
            I    +       I +  +           +T I  +G+ LS GQ+Q + ++RAL+ +  
Sbjct: 1404 IWRALELSHLKPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSR 1463

Query: 592  VLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVV 651
            +L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL       
Sbjct: 1464 ILVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL------- 1514

Query: 652  EQGKFKELFANPA 664
            +QG+ KE F +P+
Sbjct: 1515 DQGEVKE-FDSPS 1526

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 136/295 (46%), Gaps = 42/295 (14%)

Query: 432 IEFKNVSF--NYPTRPTVP--------------IFRNLN-FKIEQGSNVCIVGPSGKGKS 474
           IE  N +F  N PT+ T                  +N++ F+  +G  VC+VG  G GKS
Sbjct: 618 IEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGAGKS 677

Query: 475 TIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR-RHIGIVQQEPILMSGTIRDNITYGL 532
           T    LL       GQ+  I      A      R   + +  Q+  +++ +++ N+ +G 
Sbjct: 678 TFLHALL-------GQLPCISSSHDQATPKMHFRCDSVALCSQQAWILNASVKYNVLFGH 730

Query: 533 TYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTV 592
            Y   +   ++  + C     +    D  +T +G  G  LSGGQK RI++ARA+  +  V
Sbjct: 731 KYD--EASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSDV 788

Query: 593 LILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648
            +LD+  SA+D E  +  I++   +   L+K+K  T++   + +S ++ S+++  L N G
Sbjct: 789 YLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYALEN-G 845

Query: 649 SVVEQGKFKELFANPAXXXXXXXXXXXXGNNAA-------PEIQPQEISQTIEED 696
            +VE+G F E+ +  A             +++A       PE +P    Q +E+D
Sbjct: 846 EIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEPIPEQKPPVDLQEVEDD 900

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 128/505 (25%), Positives = 217/505 (42%), Gaps = 48/505 (9%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    ++ I+H    + DT  +G +++R   D   +   +T+ +   + + F    GV +
Sbjct: 967  LNLRAVRRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCV 1025

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +    +L A  +    R+  K+L+ V  +    +  E   G+ TI
Sbjct: 1026 MCIVYLPWFAIAIPFLLVVFVLIADHYQSSGRE-IKRLEAVQRSFVYNNLNEVLGGMDTI 1084

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ +++  + K +  I K+     EA ++         I  D+  +      + L   +
Sbjct: 1085 KAYRSQERFLAKSDFLINKM----NEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTR 1140

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFELTDLKPRINP 418
               +   +  +L T      +  L G  + I++          +A R+       P    
Sbjct: 1141 AFPISAASVGVLLT-----YVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEAD 1195

Query: 419  TRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGK 473
             R  +  P +     G+I F+NV F Y  RP +PI  +N N  I+ G  + I G +G GK
Sbjct: 1196 YRKPEMTPPESWPSKGKIVFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGK 1253

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN------ 527
            STI   L      + GQI ID  DIS L    LR+ + I+ Q+P+L  GTIR N      
Sbjct: 1254 STIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDE 1313

Query: 528  ----------ITYGLTYTPTKEEIR-SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQ 576
                      +  G        E+R     +   H  + +F    D A+   G+  S G+
Sbjct: 1314 RTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGE 1371

Query: 577  KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 636
            +Q +A+ RAL+++  +LILDEATS++D E++G I     +  +    TI+ IAHRL TI 
Sbjct: 1372 RQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIV 1429

Query: 637  RSENVIVLGNDGSVVEQGKFKELFA 661
              + ++VL   G V E      LF+
Sbjct: 1430 NYDRILVL-EKGEVAEYDTPWALFS 1453

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 108/213 (50%), Gaps = 20/213 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F++LNF I++G  + I GP G GKS++   +        G+I ++G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  +   KE+   V   C     +   P    T IG  G
Sbjct: 652 --LMCGYPWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR++ KK  + + D+  SA+D    +  ++     ++ +K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILAT- 766

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            H+LS I R+  VIVLG DG  V+ G  +EL A
Sbjct: 767 -HQLSLIERASRVIVLGTDGK-VDIGTVEELKA 797

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 120/501 (23%), Positives = 225/501 (44%), Gaps = 54/501 (10%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            K+  +++K+ +H   +FFD+  +G +++R   D   V + +   +  G  A  +    + 
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLG-GTFACLVECFSII 1227

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
            ++              +         V+    R+  K+   +T + + +   E   GI T
Sbjct: 1228 VLITLITPQFLGVAIFIAVFYWFVGAVYISGSRE-LKRFDSITKSPIYQHFSETLAGITT 1286

Query: 305  IQSFVAE----QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360
            ++++  E    +  + K + + +  F +     +++ +      IIG    L    +  W
Sbjct: 1287 VRAYGDESRFMRENLEKIDENNKPFFYMWVSNRWLSFR----TQIIGAFVILGAGGFSIW 1342

Query: 361  LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP-T 419
             +   ++  G     + Y     +A   L  F+ +      +  RI E  ++     P  
Sbjct: 1343 NI--NKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQE--PYN 1398

Query: 420  RGSKFIPA---KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKST 475
             G+   PA   + G+IE  +VS  Y   P +P + +N++F ++  S V IVG +G GKST
Sbjct: 1399 EGTVEPPADWPENGKIEINDVSLRYA--PNLPRVIKNVSFTVDSKSKVGIVGRTGAGKST 1456

Query: 476  IAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
            I   L  +  P  G I ID  DI ++  + LRR I I+ Q+P L +GTIR N+     Y+
Sbjct: 1457 IITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLDPYTQYS 1516

Query: 536  PTKEEIRSVAKQCFCHNFITR-------FPDTYDTA----------------IGPHGTLL 572
                  + +     C N ++R        P + DT+                +   G+ +
Sbjct: 1517 D-----KEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEGGSNI 1571

Query: 573  SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 632
            S GQ+Q + +AR+L+ KP +++LDEAT+++D ES+  I  T     +  + TI++IAHRL
Sbjct: 1572 SQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRN--EFGNSTILTIAHRL 1629

Query: 633  STIRRSENVIVLGNDGSVVEQ 653
             ++   + ++V+  D   VE+
Sbjct: 1630 RSVIDYDKILVM--DAGEVEE 1648

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 99/397 (24%), Positives = 179/397 (45%), Gaps = 44/397 (11%)

Query: 275 KQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAE---QSEMHKFNGSIRKIFA---- 327
           K ++   K++Q++         E F  I+ I+ F  E   ++++HK       I      
Sbjct: 612 KNLKTTDKRIQKLN--------ETFQAIRIIKFFSWEKNFENDIHKIREEELYILLLRCL 663

Query: 328 VGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIF 387
           V   + FI   FF + +I+  LSF        ++  Q+Q    +LT+ + +T  +  A+ 
Sbjct: 664 VWSFSTFI---FFISPTIVTSLSF------AYYIFIQKQ----ELTSPVAFTALSLFALL 710

Query: 388 -----NLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYP 442
                 ++   S ++Q   +  R+    D +P          +P +  ++ FKN + ++ 
Sbjct: 711 KIPLDQMANMLSYVVQSKVSLDRVQTFLD-EPDTKKYEQLT-VPVEKNKLSFKNATMSWG 768

Query: 443 TRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDIS 499
                   RNL+   + G    ++GP+G GK+++   LL     ++GQI I   D +   
Sbjct: 769 NDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDL 828

Query: 500 ALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPD 559
            + +      I    Q   L++ T+R+NI +   Y   + +   VA        I    D
Sbjct: 829 IIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAAGLKRDFEILAAGD 888

Query: 560 TYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQL 617
              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +   I  N   G L
Sbjct: 889 L--TEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPL 946

Query: 618 MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           M+ ++  +VS  H ++   ++ +++V+  +G V +QG
Sbjct: 947 MEGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG 981

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  126 bits (316), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 125/489 (25%), Positives = 223/489 (45%), Gaps = 37/489 (7%)

Query: 194  HIIHQDA------QFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAG 243
            H I  DA       FF+T  +G +++R  ND +    ++ R+ +Q   + VK  F     
Sbjct: 1006 HDIMADAIFKAPMTFFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSF----- 1060

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGI 302
              ++              +G+  +   + + +  R+  ++L  VT +      +E   GI
Sbjct: 1061 TIIVICSSTWQFVFVIIPLGTLYIYYQQYYLRTSRE-LRRLDSVTRSPIYAHFQETLGGI 1119

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLV 362
             TI+ +  +   +H     +    +    +   N         IG +  L   +   + +
Sbjct: 1120 STIRGYQQQGRFLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRL 1179

Query: 363  FQQQLS---VGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR---- 415
             Q  L+   +G   ++ L    + N I  ++    E+     +  RI E  ++ P     
Sbjct: 1180 KQGALTPGMIGLSVSYALQITQSLNWIVRMT---VEVETNIVSVERIKEYANITPEAPAV 1236

Query: 416  INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKS 474
            I   R ++  P  G  I+F+N S  Y  RP + +  RN+N  I+    + IVG +G GKS
Sbjct: 1237 IESNRPAEDWPTHGA-IKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKS 1293

Query: 475  TIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTY 534
            ++   L      ++G+I+IDG    ++  + LR H+ I+ Q+  +  GT+R+NI     Y
Sbjct: 1294 SLTLALFRIIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY 1353

Query: 535  TPTKEEIRSVAKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
              T EEI    +     + I     D  ++ +   G  LS GQ+Q + +ARAL+    +L
Sbjct: 1354 --TDEEIWHALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRIL 1411

Query: 594  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
            +LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ ++VL + G + E 
Sbjct: 1412 VLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEF 1468

Query: 654  GKFKELFAN 662
               + L  N
Sbjct: 1469 DSPEALLKN 1477

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 98/407 (24%), Positives = 182/407 (44%), Gaps = 54/407 (13%)

Query: 282 KKLQEVTA----NLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINA 337
           KKLQ++        TR   E  N IK+++ +  E     K +        V  E    N 
Sbjct: 454 KKLQKIQMKNKDERTRTISEILNNIKSLKLYAWEVPFREKLD-------KVRNEKELQNL 506

Query: 338 KFFTTASIIGDLSFLVV---LSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF-- 392
           K     + I    F +V   +S  ++ VF        L+  +++   T   +FNL  F  
Sbjct: 507 KRMGITTAIASFQFNIVPFLVSCSTFAVFVWTQKDRPLSTDLVFPALT---LFNLLSFPL 563

Query: 393 ------FSEIMQGAGAASRI--FELTDLKPRINPTRGSKFIPAKGGEIEFK---NVSFNY 441
                  +  ++ + + +R+  F   +   R +  R  K    K GE+      + +F +
Sbjct: 564 AIIPTALTSFIEASVSVNRLHSFLTNEELQRDSVQRKPKV--TKTGEVAINVGADATFLW 621

Query: 442 PTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISA 500
             +P   +  +N+NF+ ++G   CIVG  G GKS +           QG   I G     
Sbjct: 622 QRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALI----------QG---ILGDLFRV 668

Query: 501 LSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT 560
               S+   I  V Q P +M+GT+++NI +G  Y     +  +  + C     ++  P  
Sbjct: 669 KGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDADFYD--TTLRACALAVDLSILPKG 726

Query: 561 YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ--L 617
            +T +G  G  LSGGQK RI++ARA+  +    +LD+  +A+D   ++  I +  G   L
Sbjct: 727 DETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGL 786

Query: 618 MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
           + SK   + +  +++S +  ++++ +L N G +++QG ++E+ ++ +
Sbjct: 787 LSSKVKVLAT--NKISVLSIADHISLLEN-GEIIQQGSYEEVTSDKS 830

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 123/512 (24%), Positives = 234/512 (45%), Gaps = 47/512 (9%)

Query: 172  RVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKIS 231
            + IL  +   N   K+   +++ ++H   +FFD+  +G +++R   D   V + +T    
Sbjct: 1163 KTILSFVAGLNASKKIFNLLLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFE 1222

Query: 232  DGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN- 290
                ++    + V ++              + + L      F        K+L  ++ + 
Sbjct: 1223 GAFYSLVTCLSTVVLITFITPQFLIVAV--IVAVLYYFIGYFYLAGSRELKRLDSISRSP 1280

Query: 291  LTRVSEEQFNGIKTIQSFVAE----QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASII 346
            + +   E   G+ TI++F  E    Q  +HK + + R  F +     ++  +      +I
Sbjct: 1281 IYQHFSETLVGVTTIRAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMRI----DLI 1336

Query: 347  GDLSFLVVLSYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAAS 404
            G L   VV   G +++     +  G     + Y   +T  A++ L   +S +     +  
Sbjct: 1337 GSL---VVFGAGVFILLNIDHIDAGMAGISLTYAITFTEGALW-LVRLYSNVEMNMNSVE 1392

Query: 405  RIFE--LTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGS 461
            R+ E  + + +P   P         + G +E  +VS  Y   P +P + +N++F +E  S
Sbjct: 1393 RLKEYMVVEQEPYNQPIMTPPSDWPQHGRVEMSDVSLRYA--PGLPRVIKNVSFTVEPKS 1450

Query: 462  NVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMS 521
             V +VG +G GKSTI   L  + +P  G I ID  DIS +  + LRR I I+ Q+P L +
Sbjct: 1451 KVGVVGRTGAGKSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFT 1510

Query: 522  GTIRDNITYGLTYTP-------------TKEEI--RSVAKQCFCHNFITRFPDTYDTAIG 566
            GTI+ N+     Y+              ++EE+   ++         + +F D  ++ I 
Sbjct: 1511 GTIKSNLDPYDEYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEIN 1569

Query: 567  PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
              G  LS GQ+Q + +AR+L++ P +++LDEAT+++D +S+  I  T  +  +    TI+
Sbjct: 1570 EGGGNLSQGQRQLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TIL 1627

Query: 627  SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
            +IAHRL ++   + ++V+       +QG+ KE
Sbjct: 1628 TIAHRLRSVIDYDKILVM-------DQGEVKE 1652

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 125/271 (46%), Gaps = 11/271 (4%)

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP 448
           LS   S ++Q   +  RI E  + +P  +        P  G ++ F+N + ++ +     
Sbjct: 705 LSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPG-GQKLGFENATISWDSEKQDF 762

Query: 449 IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL---STKS 505
             RNLN   + G    ++GP+G GK++I   LL       G I++   D  AL       
Sbjct: 763 KLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADG 822

Query: 506 LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAI 565
           +   I    Q   L++ T+R+NI +   Y+  +     V + C              T I
Sbjct: 823 MTNSIAYCSQAAWLLNDTVRNNILFNSPYSEAR--YNDVIEACGLKRDFEILSAGDMTEI 880

Query: 566 GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSM 623
           G  G  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N   G LM+ +  
Sbjct: 881 GERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR-- 938

Query: 624 TIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           T + I+H ++   R+  ++VL  +G V EQG
Sbjct: 939 TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 124/486 (25%), Positives = 221/486 (45%), Gaps = 43/486 (8%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSA 242
            L  +++  ++     FF+T  +G +++R  ND +    +++R+ +Q  ++  +  F    
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSF---- 1058

Query: 243  GVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EE 297
                                  PL +    + +     S++L+ + + +T+       +E
Sbjct: 1059 -----TIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDS-VTKSPVYAHFQE 1112

Query: 298  QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSY 357
              NG+ +I+ +      +H     I    +    +  +N         IG     ++   
Sbjct: 1113 TLNGVSSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSC---IIFFA 1169

Query: 358  GSWLVFQQQLSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
             +  VF+  L+ G LT+ M+     Y      ++  +     E+     +  RI E  +L
Sbjct: 1170 ATLSVFR--LASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAEL 1227

Query: 413  KPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVG 467
            +P   P   +  +P+    K GEI+F+N S  Y  RP +  I R +N  I+    V IVG
Sbjct: 1228 EPE-APQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVG 1284

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKS++A  L      ++G I IDG  I  +    LR+ + I+ Q+  +  GT+RDN
Sbjct: 1285 RTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDN 1344

Query: 528  ITYGLTYTPTKEEIRSVAKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
            I     Y  T E+I    +     + +     D  DT +   G  LS GQ+Q + +ARAL
Sbjct: 1345 IDPTKQY--TDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARAL 1402

Query: 587  IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGN 646
            +    +L+LDEAT+A+DVE++  I  T       +  TI++IAHR++TI  S+ ++VL +
Sbjct: 1403 LIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-D 1459

Query: 647  DGSVVE 652
             G+V E
Sbjct: 1460 KGTVAE 1465

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 123/251 (49%), Gaps = 22/251 (8%)

Query: 436 NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
           N +F +  +P   +  +N+NF+ ++    CI+G  G GKS +   +L       G  ++ 
Sbjct: 613 NATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVR 672

Query: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554
           G             ++  V Q   +M+GT+RDNI +G  Y    +  +   K C     +
Sbjct: 673 G-------------NVAYVSQVAWIMNGTVRDNILFGHKYDA--KFYQQTIKACALTVDL 717

Query: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYT 613
           +  PD  +T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  +   
Sbjct: 718 SILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNV 777

Query: 614 FGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXX 671
           FG   L+KSK+  + +  ++++ +  ++++++L N G +V+QG F E+ ++         
Sbjct: 778 FGPNGLLKSKARVLTT--NKITALEIADHIVLLEN-GEIVQQGTFSEVISDEDSAISKLV 834

Query: 672 XXXXXGNNAAP 682
                  N AP
Sbjct: 835 LHHGKKQNGAP 845

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 132/518 (25%), Positives = 237/518 (45%), Gaps = 53/518 (10%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N +A L A+      V+K +++   +FFD+  +G +++R   D   V + +T  + +G  
Sbjct: 1123 NFIAGLNASRKIFNLVLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFV-EGAF 1181

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRV 294
               +      ++              +G    L    +    R+  K+ + V+ + + + 
Sbjct: 1182 VSLVQCLSTVILIAYITPGFLVVAIFIGFLYYLVGYFYMAGSRE-LKRFESVSRSPIHQH 1240

Query: 295  SEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVV 354
              E   GI TI++F  E+  M +   +++KI    K   ++       A  I  +   VV
Sbjct: 1241 FSETLVGITTIRAFGDERRFMLE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGACVV 1297

Query: 355  LSYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
             + G +++   ++L  G     + Y   +T  A++ L   +S +     +  R+ E   +
Sbjct: 1298 FAAGVFILLNIKKLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMVI 1356

Query: 413  KPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVG 467
            +    P+    F P       G+IE  ++S  Y T   +P + +N++F ++    V IVG
Sbjct: 1357 EQE--PSNDGAFNPPIEWPDQGKIEVNDLSLRYAT--NLPRVIKNVSFTVDPKCKVGIVG 1412

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKSTI   L  + +P  G I ID  DI+++  K LR+ I I+ Q+P L SGT++ N
Sbjct: 1413 RTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSN 1472

Query: 528  ITYGLTYTPTKEEIRSVAKQCFCHNFIT-----RFPDTYDTA----------------IG 566
            +     Y  T E+I    K+    N +T       PD+ D A                I 
Sbjct: 1473 LDPYDEY--TDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEIT 1527

Query: 567  PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
              G  LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  +    TI+
Sbjct: 1528 EGGANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTIL 1585

Query: 627  SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
            +IAHRL +I   + ++V+ + G V E      L  N +
Sbjct: 1586 TIAHRLRSIIDYDKILVM-DAGEVREYDHPYSLLLNKS 1622

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 112/468 (23%), Positives = 207/468 (44%), Gaps = 40/468 (8%)

Query: 205 TYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGS 264
           T  +G +I+ +  DAF VS  I   +   V+A  +    + ++              +  
Sbjct: 472 TANLGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTLLYKLLGWAAVIGAILIVC 530

Query: 265 PLLLS---AKVFGKQIRDN----SKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHK 317
            L L+   A + GK  +DN     K++Q++         E F  I+ I+ F  E++    
Sbjct: 531 MLPLNFKLANLIGKLQKDNLGVTDKRIQKLN--------ETFQSIRIIKFFSWEENFERD 582

Query: 318 FNG----SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLT 373
                   ++ +       A ++  +F T SI+  +SF   + Y    V    ++   L+
Sbjct: 583 IKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFAFYI-YVQGEVLTTPIAFTALS 641

Query: 374 AFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE 433
            F L      N +  LS   S ++Q   +  R+ E  D +     T     +     +I 
Sbjct: 642 LFTLLR----NPLDQLSDMLSFVIQSKVSLDRVQEFLDEEE----TEKYNQLTISRNKIA 693

Query: 434 FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI 493
           F+N +F +  +      +NLN + + G    ++G +G GK+++   LL   +  +G++ +
Sbjct: 694 FENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYV 753

Query: 494 ---DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 550
              D ++   + +  +   I    Q   L++ T+R+NI +   Y  T+   ++V + C  
Sbjct: 754 PSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YKAVVEACGL 811

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI 610
                       T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I
Sbjct: 812 KRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWI 871

Query: 611 --NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVVEQGK 655
             N   G LM+ ++  +VS  H ++ T++ +E V+VL N G + +QG+
Sbjct: 872 YENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVLDN-GRIKDQGE 916

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 128/518 (24%), Positives = 243/518 (46%), Gaps = 58/518 (11%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N VA +RA+      ++K++++   +FFD+  +G +++R   D      SI Q+++  ++
Sbjct: 1121 NFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDI----ESIDQELTPYME 1176

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS 295
              F GS    +               + + ++L            +++L+ + +      
Sbjct: 1177 GAF-GSLIQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPI 1235

Query: 296  EEQFN----GIKTIQSFVAEQ----SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIG 347
             + F+    GI TI++F  E+      M K + + R  F +     +++ +      +IG
Sbjct: 1236 HQHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRI----ELIG 1291

Query: 348  DLSFLVVLSYGSWLVFQQQLSVGDLTAFML--YTEYTGNAIFNLSGFFSEIMQGAGAASR 405
             L   +VL+ GS+++   +     L    L    ++T  A++ +   +S +     +  R
Sbjct: 1292 AL---IVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVER 1347

Query: 406  IFELTDLKPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQG 460
            + E T ++    P+     +P     + G+IE K++S  Y     +P + +N+ F ++  
Sbjct: 1348 LKEYTTIEQE--PSNVGALVPPCEWPQNGKIEVKDLSLRYAA--GLPKVIKNVTFTVDSK 1403

Query: 461  SNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILM 520
              V IVG +G GKSTI   L  + +P  G I ID  DI+ +  K LR+ I I+ Q+P L 
Sbjct: 1404 CKVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLF 1463

Query: 521  SGTIRDNITYGLTYTP-------------TKEEIR--SVAKQCFCHNF-ITRFPDTYDTA 564
            +GT++ N+     Y+              + EE+   S +     H+  + +F D  +  
Sbjct: 1464 TGTLKTNLDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENE 1522

Query: 565  IGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT 624
            +   G+ LS GQ+Q I +AR+L++ P V++LDEAT+++D  S+  I  T  +   +   T
Sbjct: 1523 VSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--T 1580

Query: 625  IVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            I++IAHRL +I   + ++V+ + G V E      L  N
Sbjct: 1581 ILTIAHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLN 1617

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 108/477 (22%), Positives = 201/477 (42%), Gaps = 24/477 (5%)

Query: 193 KHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXX 252
           K  +  D +   T  +G +I+ +  DAF VS  I   +   ++A+ +    + ++     
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRLIG 525

Query: 253 XXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQ 312
                    +   L L+ K+    +    KK   +T    +   E F  I+ I+ F  E+
Sbjct: 526 WSALVGSAMIICFLPLNFKL-ASLLGTLQKKSLAITDKRIQKLNEAFQAIRIIKFFSWEE 584

Query: 313 S-EMHKFNGSIRKIFAVGKEA---AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLS 368
           + E    N    ++  + K +   A  +  +F T SI+   SF V + Y         ++
Sbjct: 585 NFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSASFAVYI-YVQGQTLTTPVA 643

Query: 369 VGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAK 428
              L+ F L      N +  LS   S ++Q   +  R+ E  + +     T+  + +   
Sbjct: 644 FTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLNEEE----TKKYEQLTVS 695

Query: 429 GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
             ++  +N +F +         +NL    + G    IVGP+G GK+++   LL       
Sbjct: 696 RNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLN 755

Query: 489 GQILI---DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           G++ +   + ++   +    +   I    Q   L++ T+R+NI +   Y   +    +V 
Sbjct: 756 GKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNENR--YNAVI 813

Query: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
             C              T IG  G  LSGGQKQR+++AR+L      L+LD+  SA+D  
Sbjct: 814 SACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSH 873

Query: 606 SEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           +   I  N   G LM+ ++  +VS  H ++   ++ + +++  +G V EQG+  EL 
Sbjct: 874 TALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKEQGEPVELL 928

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  125 bits (314), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 141/276 (51%), Gaps = 20/276 (7%)

Query: 402  AASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKI 457
            +  RI E   L P     I+  R  +  P +G  IEFKN +  Y    + P+ +N++  I
Sbjct: 1253 SVERILEYCHLPPEAEDIIDSNRVERDWPQRGS-IEFKNYTTTYRANLS-PVLKNISVTI 1310

Query: 458  EQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEP 517
                 V IVG +G GKST++  L      ++G I IDG DIS +    LR ++ I+ Q+ 
Sbjct: 1311 NPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAIIPQDA 1370

Query: 518  ILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT---------YDTAIGPH 568
                GT+R N+     +T    E+ +V +       + R  +           D  I  +
Sbjct: 1371 QAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAKINEN 1428

Query: 569  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 628
            G+ LS GQ+Q + +ARAL+ +  VL+LDEAT+A+DVE++  I  T     K +  TI++I
Sbjct: 1429 GSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQETIRTQFKDR--TILTI 1486

Query: 629  AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
            AHRL TI  ++ ++VL + G V E    K L ++ +
Sbjct: 1487 AHRLDTIMDNDKILVL-DAGGVKEFDSPKNLLSDES 1521

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 103/213 (48%), Gaps = 20/213 (9%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR-RHIG 511
           +F     S  C++G  G GK+T+   +L       GQ+  I G   S     S+R   I 
Sbjct: 646 HFTASPKSLTCVIGKVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRGESIA 698

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              QE  +M+ TI++NI +G  +  T   +   A +      I   PD   T +G  G  
Sbjct: 699 YCPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGIS 756

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIV 626
           LSGGQK R+++ARA+  +  + +LD+  SA+D        E  ++   G L   ++ T++
Sbjct: 757 LSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLL---RNKTVI 813

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
              + +S ++ S+ +  L N G +VE+G + ++
Sbjct: 814 LSTNTVSVLKHSQLIYALEN-GIIVERGNYNDI 845

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 132/509 (25%), Positives = 231/509 (45%), Gaps = 50/509 (9%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKH-IIHQDAQFFDTYKVGDLISRVGNDAF----IV 222
            A  ++ I+L +      +K   N++ + ++     FF+T  +G +++R  ND +    ++
Sbjct: 1005 ATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALL 1064

Query: 223  SRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSK 282
             R+ +Q   + VK  F  +                       PL +    + +     S+
Sbjct: 1065 GRTFSQFFVNAVKVTFTITVICATTWQFIFIII---------PLSVFYIYYQQYYLRTSR 1115

Query: 283  KLQEVTANLTRVS-----EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINA 337
            +L+ + + +TR       +E   G+ T++ +  ++   H     I    +    +   N 
Sbjct: 1116 ELRRLDS-ITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANR 1174

Query: 338  KFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA--------FMLYTEYTGNAIFNL 389
                   +IG +   ++L   +  VF+  L  G LTA        + L    T N I  +
Sbjct: 1175 WLAYRLELIGSI---IILGAATLSVFR--LKQGTLTAGMVGLSLSYALQITQTLNWIVRM 1229

Query: 390  SGFFSEIMQGAGAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRP 445
            +    E+     +  RI E  DLK      +   R  K  P++G +I+F N S  Y  RP
Sbjct: 1230 T---VEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQG-DIKFNNYSTRY--RP 1283

Query: 446  TVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
             +  + +++N  I+    V IVG +G GKS++   L      S+G I+ID   I+ +   
Sbjct: 1284 ELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLY 1343

Query: 505  SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITRFPDTYDT 563
             LR  + I+ Q+  +  GT+R+NI     Y  T E I R++       + ++   D  D 
Sbjct: 1344 DLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALELSHLKEHVLSMSNDGLDA 1401

Query: 564  AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 623
             +   G  LS GQ+Q + +ARA++    +L+LDEAT+A+DVE++  +  T     K +  
Sbjct: 1402 QLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR-- 1459

Query: 624  TIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            TI++IAHRL+TI  S+ +IVL N G V E
Sbjct: 1460 TILTIAHRLNTIMDSDRIIVLDN-GKVAE 1487

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 167/387 (43%), Gaps = 49/387 (12%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           TRV  E  N IK+++ +  E+    K      N  ++ +  +G   A  + +F     ++
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 543

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF--------FSEIMQ 398
              +F V        V+ +  +   LT  +++   T   +FNL  F         +  ++
Sbjct: 544 SCCTFAV-------FVYTEDRA---LTTDLVFPALT---LFNLLSFPLMIIPMVLNSFIE 590

Query: 399 GAGAASRIFELTDLKPRINPTRGSKFIPAKG-GEIEFK---NVSFNYPTRPTVPI-FRNL 453
            + +  R+F        + P    +    K  G++      + +F +  +P   +  +N+
Sbjct: 591 ASVSIGRLFTFFT-NEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNI 649

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           NF+ ++G+  CIVG  G GK+ +   +L      +G   + G              +  V
Sbjct: 650 NFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGS-------------VAYV 696

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLS 573
            Q P +M+GT+++NI +G  Y    E      K C     +    D   T +G  G  LS
Sbjct: 697 SQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTIDLAILMDGDKTLVGEKGISLS 754

Query: 574 GGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRL 632
           GGQK R+++ARA+  +    +LD+  +A+D   +   I +  G      + T V   +++
Sbjct: 755 GGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKV 814

Query: 633 STIRRSENVIVLGNDGSVVEQGKFKEL 659
           S +  ++++ +L N G + +QG + E+
Sbjct: 815 SALSIADSIALLDN-GEITQQGTYDEI 840

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 127/519 (24%), Positives = 236/519 (45%), Gaps = 56/519 (10%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N VA + A+      ++  ++H   +FFD    G +++R   D   + + +T  I     
Sbjct: 1126 NFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFY 1185

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRV 294
            ++    + V ++                S L      F        K+ + ++ + + + 
Sbjct: 1186 SLIECLSTVILITFITPQFLSVAIVV--SILYYFVGYFYMAGSRELKRFESISRSPIYQH 1243

Query: 295  SEEQFNGIKTIQSFVAE----QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLS 350
              E   G+ TI++F  E    Q  +HK + + +  F +     ++  +      +IG L 
Sbjct: 1244 FSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRI----DMIGSL- 1298

Query: 351  FLVVLSYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFE 408
              V+   G +++F    L  G     + Y   +T  A++ L   +SE+     +  R+ E
Sbjct: 1299 --VIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALW-LVRLYSEVEMNMNSVERVKE 1355

Query: 409  LTDLKPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNV 463
              +++    P    K IP     + G+IE  ++S  Y   P +P + +N++F ++  S +
Sbjct: 1356 YMEIEQE--PYNEHKEIPPPQWPQDGKIEVNDLSLRYA--PNLPRVIKNVSFSVDAQSKI 1411

Query: 464  CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
             IVG +G GKSTI   L  +  P  G I ID  DIS +  + LRR I I+ Q+P L SGT
Sbjct: 1412 GIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGT 1471

Query: 524  IRDNITYGLTYTP-------------TKEEI-----RSVAKQCFCHNF--ITRFPDTYDT 563
            I+ N+     ++              ++E++     R  + +    N   + +F D   +
Sbjct: 1472 IKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDL-SS 1530

Query: 564  AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 623
             I   G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  
Sbjct: 1531 EISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGS 1588

Query: 624  TIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            TI++IAHRL ++   + ++V+ + G V E      L  N
Sbjct: 1589 TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLN 1626

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 211/482 (43%), Gaps = 50/482 (10%)

Query: 196 IHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXX 255
           I+ D +   +  +G +I+ +  DAF VS  I   +   ++A  +    + ++        
Sbjct: 463 INGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLGFAA 521

Query: 256 XXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEM 315
                 + + L L+ K+  K I D  KK   VT N  +   E F  I+ I+ F  E++  
Sbjct: 522 IVGVLIIVAMLPLNYKL-AKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFE 580

Query: 316 HKFNG---------SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQ 366
              N           +R I  V   ++F+   +F T +I+   SF       ++ ++ Q 
Sbjct: 581 KDINTIRENELSLLLMRSI--VWSISSFL---WFVTPTIVTAASF-------AYYIYVQG 628

Query: 367 LSVGDLTAFMLYTEYT--GNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF 424
             +    AF   + +T   + +  LS   S ++Q   +  R+ +       +N     K+
Sbjct: 629 EVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDF------LNENDTKKY 682

Query: 425 ----IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480
               I   G    F+N + ++         ++LN + + G    ++GP+G GK+++   L
Sbjct: 683 DQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMAL 742

Query: 481 LHYYNPSQGQILIDG----QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
           L       G++++      Q++  +        I    Q   L++ T+++NI +   +  
Sbjct: 743 LGEMYLLNGKVVVPALEPRQEL-IVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNE 801

Query: 537 TKEEIRSVAKQC-FCHNF-ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI 594
            +   ++V + C    +F I +  D   T IG  G  LSGGQKQR+++ARAL      ++
Sbjct: 802 AR--YKAVVEACGLKRDFEILKAGDL--TEIGEKGITLSGGQKQRVSLARALYSNARHVL 857

Query: 595 LDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
           LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V +
Sbjct: 858 LDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKD 915

Query: 653 QG 654
           QG
Sbjct: 916 QG 917

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 129/514 (25%), Positives = 234/514 (45%), Gaps = 40/514 (7%)

Query: 168  ANYVRVILLRILSENLVAKLRANVIKH-IIHQDAQFFDTYKVGDLISRVGNDAF----IV 222
            A  ++ I+L +      +K   N++ + ++     FF+T  +G +++R  ND +    ++
Sbjct: 1006 ATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALL 1065

Query: 223  SRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSK 282
             R+ +Q   + VK  F  +     +              +G   +   + + +  R+  +
Sbjct: 1066 GRTFSQFFVNAVKVTFTIT-----VICVTTWQFIFIIVPLGVFYIYYQQYYLRTSRE-LR 1119

Query: 283  KLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFT 341
            +L  +T + +    +E   G+ T++ +  ++   H     I    +    +   N     
Sbjct: 1120 RLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSVNANRWLAY 1179

Query: 342  TASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA--------FMLYTEYTGNAIFNLSGFF 393
               +IG +   ++L   +  VF+  L  G LTA        + L    T N I  ++   
Sbjct: 1180 RLELIGSV---IILGAATLSVFR--LKQGTLTAGMVGLSLSYALQITQTLNWIVRMT--- 1231

Query: 394  SEIMQGAGAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP- 448
             E+     +  RI E  D+K      I   R  K  P +G +I+F   S  Y  RP +  
Sbjct: 1232 VEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPGQG-DIKFNQYSTRY--RPELDL 1288

Query: 449  IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRR 508
            + + ++  I+    + IVG +G GKS++   L      S G I+IDG  I+ +    LR 
Sbjct: 1289 VLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRH 1348

Query: 509  HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPH 568
             + I+ Q+  +  GT+R+NI     YT  +   R++       + ++   D  D+ +   
Sbjct: 1349 KLSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELSHLKEHILSMSNDGLDSQLTEG 1407

Query: 569  GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 628
            G+ LS GQ+Q + +ARA++ +  +L+LDEAT+A+DVE++  I  T     K +  TI++I
Sbjct: 1408 GSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--TILTI 1465

Query: 629  AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            AHRL+TI  S+ +IVL N G V E     +L  N
Sbjct: 1466 AHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTN 1498

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/392 (21%), Positives = 170/392 (43%), Gaps = 59/392 (15%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           TRV  E  N IK+++ +  E+    K      N  +  +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF--------FSEIMQ 398
              +F V        V+ +  +   LT  +++   T   +FNL  F         +  ++
Sbjct: 545 SCCTFAV-------FVYTEDRA---LTTDLVFPALT---LFNLLSFPLMIIPMVLNSFIE 591

Query: 399 GAGAASRIFEL---TDLKP----RINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-F 450
            + +  R+F      +L+P    R+        I    G+    + +F +  +P   +  
Sbjct: 592 ASVSIGRLFSFFTNEELQPDSVQRLPKVENVGDIAINIGD----DATFLWQRKPEYKVAL 647

Query: 451 RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
           +N+NF+ ++G   C+VG  G GK+ +    L             G         S+   +
Sbjct: 648 KNINFQAKKGELTCVVGKVGSGKTALLSSTL-------------GDLFRVKGFASVHGSV 694

Query: 511 GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
             V Q P +M+GT+++NI +G  Y    E      K C     +    D   T +G  G 
Sbjct: 695 AYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDLAILMDGDQTLVGEKGI 752

Query: 571 LLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVS 627
            LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +  G   L+ +K+  + +
Sbjct: 753 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLAT 812

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             +++S +  ++++ +L N G +++QG + ++
Sbjct: 813 --NKVSALSVADSIALLDN-GEIIQQGTYDDI 841

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 141/527 (26%), Positives = 241/527 (45%), Gaps = 85/527 (16%)

Query: 182  NLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK---AVF 238
            N   KL  + ++ I+H    F DT  +G +++R   D    + S+  ++++ V+   A F
Sbjct: 947  NASKKLNLSAVRRILHTPMAFLDTTPLGRILNRFTKD----TDSLDNELTENVRLMLAQF 1002

Query: 239  IGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVF---GKQIRDNSKKLQEVTANLTRVS 295
                GV +M              +    +L +  +   G++I    K+L+ +  +    +
Sbjct: 1003 ANIIGVCVMCIIYLPWFAIAIPFILLIFVLVSNHYQSAGREI----KRLEAIQRSFVYNN 1058

Query: 296  -EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVV 354
              E   G+ TI+ + +E+  M K +  I K+     EA ++        +++ D+  +  
Sbjct: 1059 LNEVLGGMDTIRFYNSEERFMAKSDYLIDKM----NEAGYLVVCVQRWVAVLLDMIAVCF 1114

Query: 355  LSYGSWLVFQQQL-----SVGDLTAFMLY--------------TEYTGNAIFNLSGFFSE 395
                + L   +Q      SVG L  ++L               TE   N++  L  + +E
Sbjct: 1115 ALIIALLCVTRQFHISASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATE 1174

Query: 396  IMQGAGAASRIFELTDLKPRINPTRGSKFIPA--KGGEIEFKNVSFNYPTRPTVP-IFRN 452
            +     AA R       KP  +P       P+  + G+I+F+ VSF Y  RP +P + +N
Sbjct: 1175 L--PTEAAYR-------KPESSPD------PSWPQEGKIDFEEVSFAY--RPGLPAVLKN 1217

Query: 453  LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGI 512
            L+  I  G  + I G +G GKSTI   L        G+I+IDG +IS +    LRR + I
Sbjct: 1218 LSMSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSI 1277

Query: 513  VQQEPILMSGTIRDNIT-YGLTY------------TPTKEEIRSVAKQCFCHNFITRFPD 559
            + Q+P+L  GTIR N+  +G               +  KE +  V  Q    N   +   
Sbjct: 1278 IPQDPVLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELH 1337

Query: 560  TY--DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617
             +  D  +   G+  S G++Q +A+ARAL++   VLILDEATS++D E++  I     ++
Sbjct: 1338 KFHLDQEVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRI 1394

Query: 618  MKSKS-MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
            +++ S  TI+ IAHRL TI   + ++VL       E+G+  E F +P
Sbjct: 1395 IEAFSECTILCIAHRLKTILNYDRILVL-------EKGEIAE-FDSP 1433

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 104/211 (49%), Gaps = 20/211 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F+++N +I +G  + I GP G GK+++   +      ++G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  +  +K  +  V K C     +   P    T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-NYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR + K   + + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            H+LS +  +  VIVLGNDGS V+ G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 122/504 (24%), Positives = 235/504 (46%), Gaps = 47/504 (9%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVF--IGSAG 243
            K+  +++K ++H   +FFD+  +G +++R   D      +I Q+++  V+  F  + S  
Sbjct: 1140 KIFIDLLKKVMHSKLRFFDSTPIGRIMNRFSKDI----EAIDQELAPVVQGAFYSLVSCV 1195

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGI 302
              ++              + + L      F        K+   +T + + +   E   G+
Sbjct: 1196 TTILLITFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETLVGV 1255

Query: 303  KTIQSFVAE----QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358
             TI++F  E    Q  + K + + R  F +     +++ +       I  +  LVV   G
Sbjct: 1256 TTIRAFGDEGRFMQENLSKIDENNRPFFYLWVANRWLSFR-------IDMVGALVVFGSG 1308

Query: 359  SWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRI 416
            S++++  + +  G     + Y   +T  A++ L   +S +     +  R+ E   +K   
Sbjct: 1309 SFIIWNIKNIDAGMAGISLTYAISFTEGALW-LVRLYSNVEMNMNSVERLKEY--MKIEQ 1365

Query: 417  NPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGK 471
             P   +   P     + G+IE  ++S  Y     +P + +N+ F +   + + IVG +G 
Sbjct: 1366 EPYEDATCTPPPEWPQEGKIEVCDLSLRYA--EGLPRVIKNVTFTVAPKAKIGIVGRTGA 1423

Query: 472  GKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT-Y 530
            GKSTI   L  + +P  G I ID  DI++++   LRR I I+ Q+P L +GTI+ N+  Y
Sbjct: 1424 GKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPY 1483

Query: 531  GL-----TYTPTK------EEIRS-VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQ 578
            G       +T  +      E++ S +  +      + +F +  +  I   G+ LS GQ+Q
Sbjct: 1484 GEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLN-LNNEISEGGSNLSQGQRQ 1542

Query: 579  RIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 638
             + +AR+L++ P +++LDEAT+++D  S+  I  T  +  +  S TI++IAHRL ++   
Sbjct: 1543 LVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHRLRSVIDY 1600

Query: 639  ENVIVLGNDGSVVEQGKFKELFAN 662
            + ++V+ + G V E      L  N
Sbjct: 1601 DKILVM-DAGEVKEYDHPYSLLLN 1623

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 185/400 (46%), Gaps = 42/400 (10%)

Query: 283 KLQEVTANLT--RVSE--EQFNGIKTIQSFVAEQSEMHKFNGSIRKI------FAVGKEA 332
           K+Q+ T  +T  R+ +  E    I+ I+ F  E +    F  SI  +        + +  
Sbjct: 559 KIQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDN----FEKSINDVREQELQLLLKRSM 614

Query: 333 AFINAKF--FTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYT--GNAIFN 388
           A++ + F  F T S++   +F       ++ ++ Q+  +    AF   + +T   N +  
Sbjct: 615 AWVCSSFVWFVTPSLVTAAAF-------AFYIYVQKEVLTTPIAFTALSLFTLLRNPLDQ 667

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA-KGGEIEFKNVSFNYPTRPTV 447
           LS   S ++Q   +  RI    D     +  +  +   A +G ++EFKN + ++ +    
Sbjct: 668 LSDMLSFVIQSKVSLDRI---RDFLLETDTAKYDQLTVAPQGDQLEFKNTTVSWDSSAQD 724

Query: 448 PIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTK 504
              ++LN   + G    ++GP+G GK+++   LL      +G+I++   D ++   +   
Sbjct: 725 FKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDEN 784

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC-FCHNF-ITRFPDTYD 562
                I    Q   L++ T+R+NI +   Y   +    SV + C    +F I +  D   
Sbjct: 785 GTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEAR--YTSVIEACGLKRDFEILKAGDM-- 840

Query: 563 TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKS 620
           T IG  G  LSGGQKQR+++ARA+      ++LD+  SA+D  +   I  N   G LM  
Sbjct: 841 TEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCITGPLMDG 900

Query: 621 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
           ++  +VS  H ++   ++ +++V+  DG V +QG   EL 
Sbjct: 901 RTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMELL 938

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 136/497 (27%), Positives = 236/497 (47%), Gaps = 46/497 (9%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            KL  ++ K +I     FF+T  VG +I+R  +D   V  ++    S   K++   +  V 
Sbjct: 1053 KLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSIL--TYLVT 1110

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
            ++                  + +  + F   +    K+L  ++ + +  +  E  NG   
Sbjct: 1111 VILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSI 1170

Query: 305  IQS------FVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTT-ASIIGDLSFLVVLSY 357
            I +      F+    E  ++N  +  +F       +++ +  T  A+I+   + L + + 
Sbjct: 1171 IDAYDHFERFIYLNYEKIQYN--VDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATM 1228

Query: 358  GSWLVFQQQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR- 415
             +    ++QLS G +   M Y+ E TG+  + +    + I     +  RI E  +L P  
Sbjct: 1229 NT----KRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEA 1283

Query: 416  --INP-TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKG 472
              INP  R  +  P+KGG IEFKN S  Y      P+  N+N KIE    V IVG +G G
Sbjct: 1284 QSINPEKRPDENWPSKGG-IEFKNYSTKYRENLD-PVLNNINVKIEPCEKVGIVGRTGAG 1341

Query: 473  KSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL 532
            KST++  L     P++G+I+IDG DIS +    LR H+ I+ Q+     GT++ N+    
Sbjct: 1342 KSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFN 1401

Query: 533  TYTPTKEEIRSVAKQCFCHNFITRF-----------------PDTYDTAIGPHGTLLSGG 575
             Y  +++E++   +Q      + +                   D  D  I  +G+ LS G
Sbjct: 1402 RY--SEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVG 1459

Query: 576  QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 635
            Q+Q + +ARAL+ +  +L+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+
Sbjct: 1460 QRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTV 1517

Query: 636  RRSENVIVLGNDGSVVE 652
              S+ +IVL + GSV E
Sbjct: 1518 LDSDKIIVL-DQGSVRE 1533

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 179/406 (44%), Gaps = 67/406 (16%)

Query: 297 EQFNGIKTIQSFVAEQSEMHKFN--------GSIRKIFAVGKEAAFI--NAKFFTTASII 346
           E  N IK+I+ +  E+  M + N         + RKI  V     F         T S  
Sbjct: 477 ELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTF 536

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
           G  S          +VF        L+ F +      +AI+++    + I++ + +  R+
Sbjct: 537 GLFSLFSDSPLSPAIVFPS------LSLFNI----LNSAIYSVPSMINTIIETSVSMERL 586

Query: 407 --FELTD-----LKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP----------- 448
             F L+D        RI+P+   + +PA    IE  N++F + ++  +            
Sbjct: 587 KSFLLSDEIDDSFIERIDPSADERALPA----IEMNNITFLWKSKEVLTSSQSGDNLRTD 642

Query: 449 ----------IFRNLN-FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497
                       +N++ F+ ++G  VC+VG  G GKST    +L       GQ+      
Sbjct: 643 EESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGS 695

Query: 498 ISALSTKSLRRH--IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 555
             ++  K + R   +    QE  +M+ ++R+NI +G  +     ++    K C     + 
Sbjct: 696 RDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLK 753

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTF 614
             PD  +T +G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I Y  
Sbjct: 754 ILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVL 813

Query: 615 -GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            G+    K+ TI+   + +S ++ S+ +  L N G +VEQG ++++
Sbjct: 814 IGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDV 858

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 95/319 (29%), Positives = 156/319 (48%), Gaps = 34/319 (10%)

Query: 364  QQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----INPT 419
            ++Q++ G +   M Y     N++  +    + I     +  RI+E   L       I  +
Sbjct: 1239 KKQMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESS 1298

Query: 420  RGSKFIPAKGGEIEFKNVSFNYPTRPTV-PIFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
            R  K  P+ G EI FK+ S  Y  RP + P+ + +N  I+    + +VG +G GKS+++ 
Sbjct: 1299 RPEKSWPSMG-EIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSL 1355

Query: 479  LLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538
             L      + G I IDG DIS +    LR H+ I+ Q+     GT+R N+     Y+   
Sbjct: 1356 ALFRLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSV-- 1413

Query: 539  EEIRSVAKQCFCHNFITRF-----PD---------TYDTAIGPHGTLLSGGQKQRIAIAR 584
            +EI    +       I +      PD           D  I  +G  +S GQ+Q + ++R
Sbjct: 1414 QEIWKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSR 1473

Query: 585  ALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
            AL+ K  VL+LDEAT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL
Sbjct: 1474 ALLSKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL 1531

Query: 645  GNDGSVVEQGKFKELFANP 663
                   ++G+ KE F +P
Sbjct: 1532 -------DKGEVKE-FESP 1542

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 109/211 (51%), Gaps = 18/211 (8%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSL--RRHIG 511
           +F+ ++G+  C+VG  G GKST+   +L       GQ+         +S + L   R + 
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEFISPEILVRARSVA 713

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              Q P +M+ +I+DNI +G  Y  T   +    K C     +    +  +T +G  G  
Sbjct: 714 YCPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGIS 771

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVS 627
           LSGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TI+ 
Sbjct: 772 LSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIIL 829

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
             + +S ++ S N+I     G +VE+G +++
Sbjct: 830 TTNAVSVLKHS-NMIYALQGGRIVEEGTYEQ 859

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 214/469 (45%), Gaps = 39/469 (8%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXX 257
            FF+T  +G +++R  ND +    ++ R+ +Q + + VK VF                   
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVF---------TMIVICWTTW 1095

Query: 258  XXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EEQFNGIKTIQSFVAEQ 312
                +  PL +    + +     S++L+ + + +TR       +E   G+ TI+ +  ++
Sbjct: 1096 QFIFIIGPLGVLYIYYQQYYLRTSRELRRLDS-ITRSPIYSHFQETLGGMSTIRGYNQQR 1154

Query: 313  SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL 372
               H  +  I    +    +   N         IG +  L   +   + + Q  L+ G +
Sbjct: 1155 RFDHINHCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTAGMV 1214

Query: 373  ---TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----INPTRGSKFI 425
                ++ L    T N I  ++    E+     +  RI E ++LK      I   R +   
Sbjct: 1215 GLSLSYALQITQTLNWIVRMT---VEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHW 1271

Query: 426  PAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
            P   G+I F + S  Y  RP +  + R++N  I+    + IVG +G GKS++   L    
Sbjct: 1272 P-DSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIV 1328

Query: 485  NPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSV 544
              S G I+IDG  I  +    LR ++ I+ Q+  +  GTIR+N+    TY  T +EI  V
Sbjct: 1329 EASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWRV 1386

Query: 545  AKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 603
             +    +  +    P      +   G+ LS GQ+Q + +ARAL+    +LILDEAT+A+D
Sbjct: 1387 LELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVD 1446

Query: 604  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            VE++  I  T     + +  TI++IAHR++TI  S+ ++VL + G V E
Sbjct: 1447 VETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTE 1492

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/385 (21%), Positives = 163/385 (42%), Gaps = 39/385 (10%)

Query: 292 TRVSEEQFNGIKTIQSFVAEQSEMHKF-----NGSIRKIFAVGKEAAFINAKFFTTASII 346
           T V  E  N IK+++ +  E+    K      +  ++ +  +G   A  + +F     ++
Sbjct: 483 TSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLV 542

Query: 347 GDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI 406
              +F  V  Y         L    LT F L +      +F +    +  ++ + + +R+
Sbjct: 543 SCCTF-AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRL 597

Query: 407 FEL-------TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIE 458
           F          D   R+        +  K G+    + +F +  +P   +  +N+NF+ +
Sbjct: 598 FNFLTNEELQKDSVQRLPKVTNVGDVAVKVGD----DATFLWRRKPEYKVALKNINFEAK 653

Query: 459 QGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPI 518
           +G   C+VG  G GKS +   L              G         ++   +  V Q   
Sbjct: 654 KGQLTCVVGRVGSGKSALIQSL-------------SGDLFRVKGFATVHGSVAYVSQVAW 700

Query: 519 LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQ 578
           +M+GT+++NI +G  Y P  E      K C     +    D  +T +G  G  LSGGQK 
Sbjct: 701 IMNGTVKENILFGHRYDP--EFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKA 758

Query: 579 RIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 637
           R+++ARA+  +    +LD+  +A+D    +  + +  G     ++ T +   +++S +  
Sbjct: 759 RLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSI 818

Query: 638 SENVIVLGNDGSVVEQGKFKELFAN 662
           ++ + +L N G +VEQG + E+ A+
Sbjct: 819 ADRIALLEN-GEIVEQGSYDEVTAD 842

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 157/307 (51%), Gaps = 34/307 (11%)

Query: 381  YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA----KGGEIEFKN 436
            +T  A++ L   +SE+     +  R+ E  +++    P    K +P     + G+IE  +
Sbjct: 1329 FTEGALW-LVRLYSEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVND 1385

Query: 437  VSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
            +S  Y   P +P + +N++F ++  S V IVG +G GKSTI   L  +  P  G I ID 
Sbjct: 1386 LSLRYA--PNLPRVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDN 1443

Query: 496  QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK------------EE--- 540
             DIS +  + LRR I I+ Q+P L SGTI+ N+     ++  K            EE   
Sbjct: 1444 IDISNVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQ 1503

Query: 541  ---IRSVAKQCFCHNF--ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595
               +R VA      +   + +F D  ++ +   G+ LS GQ+Q + +AR+L++ P +++L
Sbjct: 1504 QGTVREVATDTSSADSENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILL 1562

Query: 596  DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
            DEAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+ + G V E   
Sbjct: 1563 DEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-DAGEVKEYDH 1619

Query: 656  FKELFAN 662
               L  N
Sbjct: 1620 PYSLLLN 1626

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 96/393 (24%), Positives = 177/393 (45%), Gaps = 24/393 (6%)

Query: 273 FGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEA 332
             K I D  KK   VT N  +   E F  I+ I+ F  E++    F   I+ I       
Sbjct: 538 LAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN----FENDIKAIRESELAL 593

Query: 333 AFINAKFFTTASIIGDLSFLVVL--SYGSWLVFQQQLSVGDL--TAFMLYTEYTGNAIFN 388
             + +  ++ +S +  ++  +V   S+  ++  Q ++    +  TA  L+T    + +  
Sbjct: 594 LLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVAFTALSLFT-LLRDPLDR 652

Query: 389 LSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP 448
           LS   S ++Q   +  R+ +   L  +         I   G    F+N + ++       
Sbjct: 653 LSDMLSFVVQSKVSLDRVQDF--LNEKDTEKYDQLTIDPNGKRFAFENSTISWDKDNQDF 710

Query: 449 IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTKS 505
             ++LN + + G    ++GP+G GK+++   LL       G++++   D +    +    
Sbjct: 711 KLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALDPRQELVVEANG 770

Query: 506 LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC-FCHNF-ITRFPDTYDT 563
               I    Q   L++ T+++NI +   +  T+   ++V + C    +F I +  D   T
Sbjct: 771 TTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKAVVEACGLKRDFEILKAGDL--T 826

Query: 564 AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSK 621
            IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   G LM+ +
Sbjct: 827 EIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDR 886

Query: 622 SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           +  +VS  H ++   R+  ++VL  DG V +QG
Sbjct: 887 TCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/289 (30%), Positives = 146/289 (50%), Gaps = 30/289 (10%)

Query: 381  YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK--PRINPTRGSKFIPA---KGGEIEFK 435
            +T  A++ L  F+SE+     +  R+ E   ++  P          +PA   + G IE  
Sbjct: 1322 FTEGALW-LVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPADWPEEGRIEVS 1380

Query: 436  NVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494
            ++S  Y     +P + +N+ F ++  + V +VG +G GKSTI   L  +     G I ID
Sbjct: 1381 DLSLRYAAH--LPKVIKNVTFNVDPRAKVGVVGRTGAGKSTIITALFRFLEAETGYIKID 1438

Query: 495  GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP-------------TKEEI 541
            G DI++++   LRR I I+ Q+P L SGTI+ N+     Y               T+EE+
Sbjct: 1439 GLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRVNLVTEEEL 1498

Query: 542  RSVAKQ-----CFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILD 596
             S  +            I RF D  ++ I   GT  S GQ+Q I +AR+L++ P +L+LD
Sbjct: 1499 SSRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQGQRQLICLARSLLRSPKILLLD 1557

Query: 597  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 645
            EAT+++D +S+  +  T     +    TI++IAHRL ++   + ++V+G
Sbjct: 1558 EATASIDYDSDAKVQETIRT--EFSESTILTIAHRLRSVIDYDKILVMG 1604

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 162/371 (43%), Gaps = 28/371 (7%)

Query: 297 EQFNGIKTIQSFVAEQ---SEMHKF-NGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFL 352
           E F  I+ I+ F  E    S++ K   G +  +       A     ++ T SI+   SF 
Sbjct: 569 ETFQAIRIIKFFSWEDNFSSDIDKIREGELNLLLWRAISWAISGFVWYLTPSIVTTASFT 628

Query: 353 VVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
             + Y    V    ++   L+ F L  +     +  LS   S ++Q   +  R+ +    
Sbjct: 629 FYI-YVQGEVLTTPVAFTALSLFSLLRD----PLDRLSDMLSFVIQSKVSLDRVQDF--- 680

Query: 413 KPRINPTRGSKF----IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
              +N     K+    +     +I FKN +  +         RNLN   + G    I+GP
Sbjct: 681 ---LNEEDTDKYNQLTVATNKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGP 737

Query: 469 SGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           +G GK+++   LL   N  +GQI++   + +    + +      I    Q   L++ T+R
Sbjct: 738 TGSGKTSLLMALLGEMNLLEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVR 797

Query: 526 DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARA 585
           +NI +   Y  T+    +V + C              T IG  G  LSGGQKQRI++ARA
Sbjct: 798 NNILFNSPYNETR--YHNVVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARA 855

Query: 586 LIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 643
           L      ++LD+  SA+D  +   +  N   G LM+ ++  +VS  H ++   R+ +++V
Sbjct: 856 LYSNSRHVLLDDCLSAVDAHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVV 913

Query: 644 LGNDGSVVEQG 654
           +  DG V +QG
Sbjct: 914 MLEDGQVKDQG 924

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 238/515 (46%), Gaps = 64/515 (12%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            K+  +++  ++H   +FFD   VG +++R   D   + + +   +   V  + I  + + 
Sbjct: 1073 KIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCL-IQCSSIL 1131

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
            ++              +        K + K  RD  K++  +T + + +   E   G+ T
Sbjct: 1132 LLIVVITPRFFSVAVIVFILYYFVGKWYLKASRD-LKRIDSITKSPIFQHFSETLVGVCT 1190

Query: 305  IQSFVAEQ----SEMHKFNGSIRKIFAVGKEAAFINAKFFT-TASIIGDLSFLVVLSYGS 359
            I++F  E+      M K + + +  F +      +  K+F     +IG     +VL  GS
Sbjct: 1191 IRAFGDEKRFILENMEKIDQNNKAFFYLS-----VAVKWFAFRVDMIGAF---IVLGSGS 1242

Query: 360  WLVFQ-----QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKP 414
            +++F        L+   LT  +L+T+   +A++ L   +S       +  R+ E + +  
Sbjct: 1243 FILFNIDNIDSGLAGISLTYAILFTD---SALW-LVQLYSRFEMNMNSVERLKEYSSIVQ 1298

Query: 415  RINPTRGSKFIPA-------KGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVG 467
                      I A       K G+IE +N+S  Y +   + + +N+ FK++  S V IVG
Sbjct: 1299 EKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLPL-VLKNVCFKVDPQSKVGIVG 1357

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKSTI   L     P  G I ID QDIS +   +LRR I I+ Q+P+L +GTI+ N
Sbjct: 1358 RTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSN 1417

Query: 528  ITYGLTYTPTKE-EIRSVAKQCFCHNFIT--RFPDTYD---------------TAIGPHG 569
            I       P  E + R + K     N I+   F   ++               + I   G
Sbjct: 1418 I------DPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIVEGG 1471

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK--SMTIVS 627
              LS G++Q + IAR+L+++  +++LDEATS++D +S+  I      +++SK    TI++
Sbjct: 1472 LNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILT 1527

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            IAHRL ++   + ++V+ + G + E G   EL  N
Sbjct: 1528 IAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKN 1561

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 134/309 (43%), Gaps = 18/309 (5%)

Query: 362 VFQQQLSVGDLTAFMLYTEYT--GNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPT 419
           +F Q+  +    AF + + +T     +  LS   S I Q   +  RI    +L       
Sbjct: 594 IFVQKQELNAPLAFTILSLFTLLKTPLDQLSNMLSFINQSKVSLRRIISFLNLDD--TEK 651

Query: 420 RGSKFIPAKGGEIEFKNVSFNYPTRPT-VPIFR--NLNFKIEQGSNVCIVGPSGKGKSTI 476
                I     +IEFK  +  +      +  F+  +LN     G    ++G +G GKS +
Sbjct: 652 YNQLTISPDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSAL 711

Query: 477 AWLLLHYYNPSQGQILIDG----QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGL 532
              LL   +   G I+I G     D+       L        Q   L+S TI++NI +  
Sbjct: 712 LMSLLGELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNG 770

Query: 533 TYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTV 592
           +Y   K   + V   C  +  +   P    T IG  G  LSGGQKQRI++ARA+      
Sbjct: 771 SYD--KSRYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKH 828

Query: 593 LILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
           ++LD+  SA+D  +   I  N   GQLMK+++  +V+  H +    R+ +  ++  DG V
Sbjct: 829 VLLDDCLSAVDSHTAVWIYENCITGQLMKNRTCILVT--HNVPLAIRNAHFAIILEDGKV 886

Query: 651 VEQGKFKEL 659
             QG  KEL
Sbjct: 887 KNQGTIKEL 895

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 129/512 (25%), Positives = 233/512 (45%), Gaps = 60/512 (11%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            K+  N++  ++H + +FFD   VG +++R   D   V + +   +   +  + I    + 
Sbjct: 1074 KIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCL-IQCLSII 1132

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKT 304
             +              +        K +    R+  K++  +T + + +   E   G+ T
Sbjct: 1133 FLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRE-LKRIDSITKSPIFQYFSETLAGVCT 1191

Query: 305  IQSFVAEQ----SEMHKFNGSIRKIFAVGKEAAFINAKFFT-TASIIGDLSFLVVLSYGS 359
            I++F  E+      M K + + R  F +      +  K+F     IIG     +VL  GS
Sbjct: 1192 IRAFGDEKRFILENMDKIDQNNRAFFYLS-----VAVKWFAFRVDIIGAF---IVLGSGS 1243

Query: 360  WLVFQQQLSVGDLTAFMLYTEYTGNAIFN-----LSGFFSEIMQGAGAASRIFELTDLKP 414
            +++    L++GD+ + +     T + +F      L   +S       +  R+ E + ++ 
Sbjct: 1244 FIL----LNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQ 1299

Query: 415  ------RINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468
                   I   + S  +  + G+IE  N+S  Y +    P+ +N++F ++  + + IVG 
Sbjct: 1300 ENYNENHIQALQNS--LWPEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVGR 1356

Query: 469  SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN- 527
            +G GKSTI   L     P  G I IDG DIS +   +LRR I I+ Q+PIL +GTI+ N 
Sbjct: 1357 TGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNL 1416

Query: 528  -------------ITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSG 574
                         +   +    ++E   ++ ++        RF +   T I   G  LS 
Sbjct: 1417 DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNL-RTEIVEGGLNLSQ 1475

Query: 575  GQKQRIAIARALIKKPTVLILDEATSALDVESE----GAINYTFGQLMKSKSMTIVSIAH 630
            G+KQ + IAR+L+++P +++LDEATS++D +S+    G I   F +       TI++IAH
Sbjct: 1476 GEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------STILTIAH 1529

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            RL ++   + V+V+ + G V E     EL  N
Sbjct: 1530 RLRSVIDYDKVLVM-DAGEVKEYDHPYELLKN 1560

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 118/455 (25%), Positives = 188/455 (41%), Gaps = 54/455 (11%)

Query: 283 KLQEVTANLT--RVSE--EQFNGIKTIQSFVAEQSEMHKFNGSIRK----IFAVGKEAAF 334
           + QE+    T  R+S   E    I+ ++ F  E +  +    S +K    +F      A 
Sbjct: 512 RCQELALRCTDERISRLNECLQNIRIVKYFAWENNISNDIKSSRQKELKFLFRKSLLWAV 571

Query: 335 INAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYT--GNAIFNLSGF 392
            +  +F T +++  ++F V        +F QQ  +    AF   + +T     +  LS  
Sbjct: 572 SSFLWFVTPTLVTSVTFAVY-------IFVQQQELNAPLAFTTLSLFTLLKTPLDQLSNM 624

Query: 393 FSEIMQGAGAASRIFELTDLKPRINPTRGSKF----IPAKGGEIEFKNVSFNYPTRPT-V 447
            S + Q   +  RI E       +N    +K+    +     +I+FK  +  +      +
Sbjct: 625 LSFMNQSKVSLERIVEF------LNEEDTAKYNQLTVSPDKNKIKFKKATLVWNENDNDI 678

Query: 448 PIFR----NLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD-----I 498
             FR    N+NF+I  G    I+G +G GKS +   LL       G I++ G +     I
Sbjct: 679 NKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMI 736

Query: 499 SALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFP 558
             L+   L        Q   L++GT+R+NI +   Y   +   ++V   C     +   P
Sbjct: 737 PDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDENR--YKNVIDACGLKRDLEILP 792

Query: 559 DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF---G 615
               T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I Y     G
Sbjct: 793 AGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITG 851

Query: 616 QLMKSKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXXXXX 674
            LMK++  T + + H +S  IR++   ++L N G V  QG   EL  N            
Sbjct: 852 LLMKNR--TCILVTHNISLAIRKAYFAVILEN-GKVKSQGTITEL-KNKGVFKEDFGQLS 907

Query: 675 XXGNNAAPEIQPQEISQTIEEDPSFSGEATPASSV 709
              NN    I   E  Q I   P  +G  T  + V
Sbjct: 908 YDDNNTEKNINRSEYFQEIA--PRITGSTTEDTEV 940

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 150/291 (51%), Gaps = 27/291 (9%)

Query: 381  YTGNAIFNLSGFFSEIMQGAGAASRIFELTDL--KPRINPTRGSKFIPAKGGEIEFKNVS 438
            +T  A++ L  F+S +     +  R+ E  D+  +P    T  +       G+IE K++S
Sbjct: 1334 FTEGALW-LVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTITTSTNWPTEGKIEVKDLS 1392

Query: 439  FNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497
              Y     +P + + ++F IE  + V IVG +G GKSTI   L  +  P  G I IDG D
Sbjct: 1393 LRYA--ENLPRVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLEPETGSIKIDGID 1450

Query: 498  ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN----- 552
            I+++  ++LRR I I+ Q+P L +GTIR N+     Y P +E  R + +     +     
Sbjct: 1451 ITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKY-PDEEIFRVLHRVNLIDDDEMTA 1509

Query: 553  -----------FITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
                        + +F +  +  I   G  LS GQKQ + +ARAL++ P V++LDEAT++
Sbjct: 1510 QSSDNNSLSSDNVNKFLNL-ENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATAS 1568

Query: 602  LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            +D  S+  I  T   +      T+++IAHRL ++   + ++V+ + G V+E
Sbjct: 1569 IDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-DAGEVIE 1616

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 152/333 (45%), Gaps = 29/333 (8%)

Query: 332 AAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVG--DLTAFMLYTEYTGNAIFNL 389
           +AFI   +F T +I+   SF V      ++  Q+Q+       TA  L+ +     +  L
Sbjct: 623 SAFI---WFLTPTIVTGASFTV------YIYVQKQVLTAPVAFTALALF-QLLKQPLDQL 672

Query: 390 SGFFSEIMQGAGAASRIFELTDLKP--RINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTV 447
           S   S ++Q   +  R+    D +   + N  +    +   G ++ F+N +  +      
Sbjct: 673 SNMLSYVIQSKVSLDRVQNFLDEEDTQKYNQLK----VAPDGNKLAFENATIAWSNNNQD 728

Query: 448 PIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTK 504
              ++L+   + G    ++GP+G GK+++   LL       G+I++   D +    + + 
Sbjct: 729 FKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSD 788

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE-IRSVAKQCFCHNFITRFPDTYDT 563
            +   I    Q   L++ T+R+NI   L Y+P  E+  + V   C        F     T
Sbjct: 789 GMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFELFDAGDQT 845

Query: 564 AIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSK 621
            IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   G LM+ +
Sbjct: 846 EIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR 905

Query: 622 SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           +  +VS  H ++   ++  ++V+  +G +  +G
Sbjct: 906 TCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 93/303 (30%), Positives = 155/303 (51%), Gaps = 36/303 (11%)

Query: 381  YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF-IPA---KGGEIEFKN 436
            +T +A++ L   +S +     +  R+ E  +++    P + S   +P+   + G+IE  +
Sbjct: 1332 FTESALW-LVRHYSNLEMNMNSVERLMEYMEVEQE--PYKSSSLDVPSSWPEEGKIEVND 1388

Query: 437  VSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
            VS  Y   P +P + +N  F ++    V IVG +G GKSTI   L  + +P  G I ID 
Sbjct: 1389 VSLRYA--PNLPRVIKNATFTVDPKMKVGIVGRTGAGKSTIITALFRFLDPETGSIKIDN 1446

Query: 496  QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP-------------TKEEIR 542
             DIS +  K LRR I I+ Q+P L SGTI+ N+     Y+              T++E+ 
Sbjct: 1447 VDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPYDEYSEKQIFEALKRVNLVTEKELA 1506

Query: 543  S--VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600
            S    +Q        +F +  +  I   G+ LS GQ+Q + +AR+L++ P V++LDEAT+
Sbjct: 1507 SGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQGQRQLVCLARSLLRCPKVILLDEATA 1565

Query: 601  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
            ++D  S+  I  T     +    TI++IAHRL T+   + ++V+       + G+ KE F
Sbjct: 1566 SIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVIDYDKILVM-------DAGEVKE-F 1615

Query: 661  ANP 663
             +P
Sbjct: 1616 DHP 1618

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 111/231 (48%), Gaps = 9/231 (3%)

Query: 430 GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
            +I FKN +  +         RN++   + G    I+GP+G GK+++   LL   +   G
Sbjct: 701 NKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDG 760

Query: 490 QILI---DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK 546
           +I++   D ++   L    L   I    Q   L++ T+R+NI +   Y   +E   +V +
Sbjct: 761 EIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFNSPYC--EERYNAVVE 818

Query: 547 QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
                           T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +
Sbjct: 819 ASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSHT 878

Query: 607 EGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
              I  N   G LM++++  +VS  H ++   R+ + +V   +G +VE G+
Sbjct: 879 ATWIYDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLENGKIVEHGE 927

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 125/509 (24%), Positives = 230/509 (45%), Gaps = 65/509 (12%)

Query: 190  NVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXX 249
            +++  ++H   +FFD+  +G +++R   D      SI Q+I   +++VF  +  V     
Sbjct: 1128 SLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEV-FATL 1182

Query: 250  XXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTA----NLTRVSEEQFNGIKTI 305
                        +   ++L   + G      S++L+ + +     + +   E   G+ TI
Sbjct: 1183 LLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTI 1242

Query: 306  QSFVAEQSEMHKFNGSIRK-------IFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358
            ++F  EQ  + +    I +       ++ V +  +F          +IG L   V+ S G
Sbjct: 1243 RAFGDEQRFIKENLSMIDQNSMPFFYLWVVNRWLSF-------RIDLIGAL---VIFSSG 1292

Query: 359  SWLVFQ-QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK--PR 415
             +++     +  G     + Y      A   L   +SE+     +  R+ E  +++  P 
Sbjct: 1293 VFILLNINNIDAGLAGISLTYAISFTEAALWLVRQYSELEMNMNSVERVLEYMNIEQEPL 1352

Query: 416  INPTRGSKFIPAK---GGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGK 471
            I     +   P +    G++E  N+S  Y   P +P + +++ F IE    V IVG +G 
Sbjct: 1353 IADPANAVTPPPQWPDSGKVEVNNLSLKYA--PHLPYVIKDVTFTIEPLEKVGIVGRTGA 1410

Query: 472  GKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYG 531
            GKSTI   L  +     G I +DG +I+ +  K LRR I I+ Q+P L +G+IR N+   
Sbjct: 1411 GKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPY 1470

Query: 532  LTYTPTKEEIRSVAK-----------------QCFCHNFITRFPDTYDTAIGPHGTLLSG 574
              Y  + EEI +  K                 Q      + +F +  ++ I   G+  S 
Sbjct: 1471 DEY--SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIAEGGSNFSQ 1527

Query: 575  GQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 634
            GQ+Q + +AR+L++ P V++LDEAT+++D  S+  I  T  Q  +  + T+++IAHRL +
Sbjct: 1528 GQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHRLRS 1585

Query: 635  IRRSENVIVLGNDGSVVEQGKFKELFANP 663
            I   + ++V+       + G+ KE F +P
Sbjct: 1586 IVDYDKILVM-------DAGEVKE-FDHP 1606

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 116/247 (46%), Gaps = 19/247 (7%)

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
           +   G  + F+NV+  + +     + RNL+ +   G    IVG +G GK++I   LL   
Sbjct: 699 VDKNGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEM 758

Query: 485 NPSQGQILIDGQDISALSTKS--------LRRHIGIVQQEPILMSGTIRDNITYGLTYTP 536
             S+G+I++      +LS +         +   I    Q   L++ T+R+NI +   +  
Sbjct: 759 QLSEGKIIV-----PSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQ 813

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILD 596
            + +  +V + C              T IG  G  LSGGQKQR+++ARAL      L+LD
Sbjct: 814 ARYD--AVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLD 871

Query: 597 EATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           +  SA+D  +   I      G LM+ +  T + + H ++   ++ + +V+  DG V E+G
Sbjct: 872 DCLSAVDSHTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKG 929

Query: 655 KFKELFA 661
              EL A
Sbjct: 930 TPIELLA 936

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  113 bits (283), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 140/280 (50%), Gaps = 39/280 (13%)

Query: 402 AASRIFELTDLKPRINPTRGSKFI--PA---KGGEIEFKNVSFNYPTRPTVPIFRNLNFK 456
           +  RI E TD+     P+  + +I  PA   + G++E KN+S  Y    +  +  N++FK
Sbjct: 3   SVERIKEYTDI-----PSESNGYISPPANWPQTGDVELKNLSLRYSPHSSKAL-DNVSFK 56

Query: 457 IEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQE 516
           ++ G+ V IVG +G GKS+I   +    +   G I ID +DI  +  + LR  I  + Q+
Sbjct: 57  VKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQD 116

Query: 517 PILMSGTIRDNITYGLTYTPTK--------EEIRSVAKQCF----------CHNFITRFP 558
           P L  GT+R N+     Y+  +          I    + C            H    RF 
Sbjct: 117 PTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFI 176

Query: 559 DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLM 618
           D  +T +   G+ LS GQ+Q + +AR+++    ++++DEAT+++D  S+  I  T  + M
Sbjct: 177 D-LNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM 235

Query: 619 KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
             K+ TI++IAHRL ++   + ++V+       E G+ KE
Sbjct: 236 --KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE 266

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 133/238 (55%), Gaps = 20/238 (8%)

Query: 429  GGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS 487
             G+IE K++S  Y   P +P + +N++F +E  + + IVG +G GKSTI   +  + NP 
Sbjct: 1383 NGKIEVKDLSLRYA--PNLPKVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPE 1440

Query: 488  QGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP----------- 536
             G I ID  +I++++   LRR I I+ Q+P L +GTI+ N+     +T            
Sbjct: 1441 SGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVN 1500

Query: 537  --TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI 594
              T+EE+++   Q        +F +  +  I   G+ LS GQ+Q + +AR+L++ P +++
Sbjct: 1501 LVTEEELQNNGTQTGTSENANKFLNL-ENEITEGGSNLSHGQRQLVCLARSLLRNPKIIL 1559

Query: 595  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++   + +IV+ + G V E
Sbjct: 1560 LDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-DAGEVKE 1614

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 151/329 (45%), Gaps = 20/329 (6%)

Query: 333 AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
           AF +  +F T SI+   SF   + Y    V    ++   L+ F L        +  LS  
Sbjct: 619 AFSSFVWFVTPSIVTSASFAFYI-YVQGEVLTTPVAFTALSLFTL----LKTPLDQLSNM 673

Query: 393 FSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRN 452
            S ++Q   +  RI +   L  +         I   G  I FKNV+  +         R+
Sbjct: 674 ISFVIQSKVSLDRIQDF--LGEQDTDKYNQLTIDKLGNRIAFKNVTVTWDNGEEDFKLRD 731

Query: 453 LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG----QDISALSTKSLRR 508
           LN + + G+   ++GP+G GK+++   LL      +G+I++      QD+  +    L  
Sbjct: 732 LNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALNPRQDL-VIDKFGLTN 790

Query: 509 HIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPH 568
            I    Q   L++ T+R+NI +   Y   +E   +V   C     +     +  T IG  
Sbjct: 791 SIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDACGLRRDLKILKASDMTEIGEK 848

Query: 569 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIV 626
           G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   G LM  ++  +V
Sbjct: 849 GITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGRTCILV 908

Query: 627 SIAHRLS-TIRRSENVIVLGNDGSVVEQG 654
           S  H ++ T++ +E V++L N G V +QG
Sbjct: 909 S--HNIALTLKNAELVVILEN-GRVKDQG 934

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 139/258 (53%), Gaps = 16/258 (6%)

Query: 402  AASRIFELTDLKPRINPTRGSKFIPAK---GGEIEFKNVSFNYPTRPTVP-IFRNLNFKI 457
            +  RI E T++      T+    I  +   G EI F +V   Y   P +P + +N++F +
Sbjct: 1207 SVERIKEYTEID--CEDTKAGALINTQWSGGAEISFDHVYVRYA--PHLPDVLKNVSFTL 1262

Query: 458  EQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEP 517
               S V IVG +G GKST+   L      + G I I G DI++L+ ++LRR + ++ Q+P
Sbjct: 1263 LPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDP 1322

Query: 518  ILMSGTIRDNITYGLTYTPTKEEIRSVAKQ--CFCHNFITRFPDTYDTAIGPHGTLLSGG 575
             L SGTI+ NI     Y  + +E+   A++   F      R  ++  + +   G  +S G
Sbjct: 1323 SLFSGTIKSNIDPFGRY--SDQELTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMSQG 1380

Query: 576  QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 635
            Q+Q + +ARAL++K  +LILDEAT+++D E++  I         S    ++++AHR+STI
Sbjct: 1381 QRQLLCLARALLQKSKILILDEATASIDHETDATIQQVVRDF--SSGGIVITVAHRMSTI 1438

Query: 636  RRSENVIVLGNDGSVVEQ 653
               + VIVL  D  +V++
Sbjct: 1439 IDYDQVIVL--DSGIVKE 1454

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 85/340 (25%), Positives = 154/340 (45%), Gaps = 28/340 (8%)

Query: 331 EAAFINAKFFTTASI----IGDLSFLVVLSYGSWLVFQQQ-LSVGD-LTAFMLYTEYTGN 384
           E +F+  K F  A++        + +   ++G+ +  Q+Q ++V    TA  L+     N
Sbjct: 533 ECSFLTKKLFCWATLHLVWFLTPTLVTAATFGASIYLQKQKITVASAYTALTLFA-LLRN 591

Query: 385 AIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTR 444
            +  L+     I+Q   +  RI +  +   R N T+  + +     E+ F+N S  +   
Sbjct: 592 PLTQLATMLGTIIQTTVSIQRIEKFLN---RSN-TKKHEILKDSFTEMGFRNASLTWNRF 647

Query: 445 PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
            T  + +NL    E      I+GPSG GKS++   LL   +  +G I +    +      
Sbjct: 648 DTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSIRVPRGYM-----H 702

Query: 505 SLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTA 564
             R       Q P + + T+++NI +   +   + +   V   C     I    +  +T 
Sbjct: 703 DDRCSFAFCSQTPWITNATVKENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETV 760

Query: 565 IGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF-----GQLMK 619
           +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D    G   + F     G LMK
Sbjct: 761 VGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMK 817

Query: 620 SKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            K  T +   H ++ +++  ++I+L ++G V + GK ++ 
Sbjct: 818 GK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF 855

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 125/234 (53%), Gaps = 28/234 (11%)

Query: 430  GEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQG 489
            G+IE  N+S  Y +    P+ +N++F IE  S V IVG +G GKSTI   L     P  G
Sbjct: 1327 GQIEVDNLSLRYASNLP-PVIKNVSFTIEPQSKVGIVGRTGAGKSTIITALFRLLEPETG 1385

Query: 490  QILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 549
             I IDG DIS +   +LRR I I+ Q+PIL +GTI+ N+     Y   K  I  V  Q  
Sbjct: 1386 HIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDEYDNKK--IFKVLSQV- 1442

Query: 550  CHNFIT--------RFPDTYDTA----------IGPHGTLLSGGQKQRIAIARALIKKPT 591
              N I+           D  +TA          I   G  +S G++Q + IAR+L+++P 
Sbjct: 1443 --NLISTGEMEAAQNMGDDSNTARNKFVNLQTEITEGGQNISQGERQLLFIARSLLREPK 1500

Query: 592  VLILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
            +++LDEATS++D ES+  I      +  KS   TI++IAHRL ++   + V+V+
Sbjct: 1501 IILLDEATSSIDYESDHLIQGIIRNEFNKS---TILTIAHRLRSVIDYDRVLVM 1551

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 109/240 (45%), Gaps = 16/240 (6%)

Query: 430 GEIEFKNVSFNYPTR---PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNP 486
            +IEFKN +  +       T+     LN   + G    I+G +G GKS +   LL   + 
Sbjct: 664 NKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHL 723

Query: 487 SQGQILIDG----QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIR 542
             G I + G     D+       L        Q   L++ T+++NI +   Y   +   +
Sbjct: 724 ISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--YK 780

Query: 543 SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 602
            V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+
Sbjct: 781 EVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAV 840

Query: 603 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVVEQGKFKEL 659
           D  +   I  N   G +M+++  T + + H +S TIR +   ++L N G V  QG  K+L
Sbjct: 841 DSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILEN-GKVKNQGTIKQL 897

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 129/474 (27%), Positives = 226/474 (47%), Gaps = 49/474 (10%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXX 257
            FF+T  +G +++R  ND +    I+ R+ +Q   + VK +F     +G++          
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFT----IGVIAYTTWQFVFV 1117

Query: 258  XXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFNGIKTIQSFVAEQSEMH 316
                +G   +   + + +  R+  ++L+ VT + +    +E   G+ TI+ +  ++   H
Sbjct: 1118 IVP-LGIFYIYYQQYYLRTSRE-LRRLESVTRSPIFSHFQETLGGLATIRGYGQQKRFEH 1175

Query: 317  KFNGSIRKIFAVGKEAAF---INAKFFTTASI--IGDLSFLVVLSYGSWLVFQQQLSVGD 371
                 I +       +AF   INA  +    +  IG +   ++L   +  +F+  L  G 
Sbjct: 1176 -----INECRVDNNMSAFYPSINANRWLAYRLEFIGSV---IILGAATLSIFK--LRAGT 1225

Query: 372  LTA--------FMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR----INPT 419
            +TA        + L    T N I  ++    E+     +  RI E ++LK      I   
Sbjct: 1226 MTAGMIGLSLSYALQITQTLNWIVRMT---VEVETNIVSVERIKEYSELKSEAPLVIESN 1282

Query: 420  RGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
            R  K  P   GEI+F++    Y  R  +  + +++N +I+    + IVG +G GKS++  
Sbjct: 1283 RPPKEWPV-AGEIKFEHYYTRY--REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTL 1339

Query: 479  LLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538
             L      + G ILIDG  I+ +    LR H+ I+ Q+  +  GTIR+NI     +T   
Sbjct: 1340 ALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA- 1398

Query: 539  EEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEA 598
            +  R++       + +    D   T +   G+ LS GQ+Q + +ARAL+    VL+LDEA
Sbjct: 1399 DIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEA 1458

Query: 599  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            T+A+DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL + G VVE
Sbjct: 1459 TAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVE 1509

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 182/418 (43%), Gaps = 60/418 (14%)

Query: 266 LLLSAKVFGKQIRDNSKKLQ-EVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFN----- 319
           +++    F  +I+ N +K Q +     TRV  E  N +K+++ +  EQ    K       
Sbjct: 476 IMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEILNNMKSLKLYAWEQPYKEKLEYVRNE 535

Query: 320 GSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYT 379
             ++ +  +G   A  + +F         + FLV  S  +  V+ +  +   LT  +++ 
Sbjct: 536 KELKNLKKLGVYMACTSFQF-------NIVPFLVSCSTFAVFVYTEDKA---LTTDLVFP 585

Query: 380 EYTGNAIFNLSGF--------FSEIMQGAGAASRIFEL-------TDLKPRINPTRGSKF 424
             T   +FNL  F         + I++ + + SR+F          D   R+   +    
Sbjct: 586 ALT---LFNLLSFPLMVIPNVITAIIESSVSVSRLFNFLTNEELQKDAVQRLPKVKEIGD 642

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
           +    G+    N +F +  +P   +  +N+N++ ++G   CIVG  G GKS     LL  
Sbjct: 643 VAVNVGD----NATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLLGD 698

Query: 484 YNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRS 543
               +G   I G              +  V Q   +M+GT+RDN+ +G  Y P  E    
Sbjct: 699 LFRVKGFATIHGS-------------VAYVSQVAWIMNGTVRDNVLFGHKYDP--EFYEK 743

Query: 544 VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 603
             K C     +    D   T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D
Sbjct: 744 TIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVD 803

Query: 604 VE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
              S   + +  G   L+ SK+  + +  +++S +  ++++ +L N G + +QG + +
Sbjct: 804 EHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSAADSITLLEN-GEITQQGTYAD 858

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 216/470 (45%), Gaps = 41/470 (8%)

Query: 202  FFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXX 257
            FF+T  +G +++R  ND +    I+ R+  Q  ++ VK  F                   
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSF---------TIVVICMATW 1093

Query: 258  XXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EEQFNGIKTIQSFVAEQ 312
                +  PL +    + +     S++L+ + + +TR       +E   G+ TI+ +  + 
Sbjct: 1094 QFIFIVLPLSVLYIYYQQYYLRTSRELRRLDS-VTRSPIYAHFQETLGGLTTIRGYSQQN 1152

Query: 313  SEMH----KFNGSIRKIFAVGKEAAFINAKF-FTTASIIGDLSFLVVLSYGSWLVFQQQL 367
              +H    + + ++   +       ++  +  F  + II   S L V+  G+  +     
Sbjct: 1153 RFVHINQTRVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGNGTLTAGM- 1211

Query: 368  SVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA 427
             +G   +F L    + N I  ++    E+     +  RI E  +LK            PA
Sbjct: 1212 -IGLSLSFALQITQSLNWIVRMT---VEVETNIVSVERIKEYAELKSEAPYIIKDHRPPA 1267

Query: 428  ---KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
               + GEI+F N S  Y  RP +  I ++++  I     + IVG +G GKS++   L   
Sbjct: 1268 SWPESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRI 1325

Query: 484  YNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEI-R 542
               + G I+IDG  I ++    LR  + I+ Q+  +  GT+R+NI     Y  T EEI  
Sbjct: 1326 IEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRY--TDEEIWN 1383

Query: 543  SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 602
            ++A      + +    +  +T +   G+ LS GQ+Q + +ARAL+    +LILDEAT+A+
Sbjct: 1384 ALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAV 1443

Query: 603  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            DVE++  I  T     K +  TI++IAHR++TI  S+ +IVL + G V E
Sbjct: 1444 DVETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/399 (24%), Positives = 180/399 (45%), Gaps = 50/399 (12%)

Query: 282 KKLQEVTA----NLTRVSEEQFNGIKTIQSFVAEQSEMHKFN-----GSIRKIFAVGKEA 332
           KKLQ++        TRV+ E  N IK+++ +  E     K +       ++ +  +G   
Sbjct: 468 KKLQKIQMKNKDERTRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTL 527

Query: 333 AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
           A  N +F         + FLV  S  +  V+ ++  +     F   T      +FNL  F
Sbjct: 528 ALANFQF-------NIVPFLVSCSTFAVFVYTEERPLSTDLVFPALT------LFNLLSF 574

Query: 393 --------FSEIMQGAGAASRIFE-LTDLKPRINPTRGSKFIPAKGGE-IEFKNVSFNYP 442
                    S  ++ + + +R+F  LT+ + + +       +   G E ++  + +F + 
Sbjct: 575 PLAVVPNAISSFIEASVSINRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQ 634

Query: 443 TRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
            +P   +  +N+NF  ++G   CIVG  G GKS +   LL             G  I   
Sbjct: 635 RKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLL-------------GDLIRVK 681

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
              ++   +  V Q P +M+GT++DNI +G  Y P  E  +   K C     ++  PD  
Sbjct: 682 GFATVHGDVANVSQVPWIMNGTVKDNILFGHKYDP--EFYQLTIKACALSIDLSMLPDGD 739

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKS 620
            T +G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  I +  G     
Sbjct: 740 QTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLL 799

Query: 621 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            S T V   ++++ +  ++++ ++ N G +++QG + ++
Sbjct: 800 HSKTKVLATNKITVLSIADSITLMEN-GEIIQQGSYDQV 837

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 125/515 (24%), Positives = 233/515 (45%), Gaps = 48/515 (9%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N VA + A+      ++  ++H   +FFD    G +++R   D   + + +T  I     
Sbjct: 1126 NFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFY 1185

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRV 294
            ++    + V ++                S L      F        K+ + ++ + + + 
Sbjct: 1186 SLIECLSTVILITFITPQFLSVAIVV--SILYYFVGYFYMAGSRELKRFESISRSPIYQH 1243

Query: 295  SEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVV 354
              E   G+ TI++F  E   M +   +++KI    K   ++       A  I  +  LV+
Sbjct: 1244 FSETLVGVTTIRAFGDEGRFMQE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVI 1300

Query: 355  LSYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
               G +++F    L  G     + Y   +T  A++ L   ++E+     +  R+ E  ++
Sbjct: 1301 FGAGLFILFNINHLDSGMAGISLTYAISFTEGALW-LVRLYAEVEMNMNSVERVKEYMEI 1359

Query: 413  KPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVG 467
            +    P    K +P     + G+IE  ++S  Y   P +P + +N++F ++  S + IVG
Sbjct: 1360 EQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYA--PNLPRVIKNVSFSVDAQSKIGIVG 1415

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKSTI   L  +  P  G I ID  DIS +  + LRR I I+ Q+P L SGTI+ N
Sbjct: 1416 RTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTN 1475

Query: 528  ITYGLTYTPTK--EEIRSV------------AKQCFCHNF------ITRFPDTYDTAIGP 567
            +     ++  K  E ++ V             ++    N       + +F D   + +  
Sbjct: 1476 LDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLDL-SSEVSE 1534

Query: 568  HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 627
             G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  TI++
Sbjct: 1535 GGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRK--EFQGSTILT 1592

Query: 628  IAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            IAHRL ++   + ++V+ + G V E      L  N
Sbjct: 1593 IAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLN 1626

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 112/478 (23%), Positives = 209/478 (43%), Gaps = 42/478 (8%)

Query: 196 IHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXX 255
           I+ D +   +  +G +I+ +  DAF VS  I   +   ++A  +    + ++        
Sbjct: 463 INGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGFAA 521

Query: 256 XXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEM 315
                 + + L L+ K+  K I D  KK   VT N  +   E F  I+ I+ F  E++  
Sbjct: 522 IVGVLIIVAMLPLNYKL-AKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFE 580

Query: 316 HKFNG---------SIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQ 366
              N           +R I  V   ++F+   +F T +I+   SF       ++ ++ Q 
Sbjct: 581 KDINAIRENELSLLLMRSI--VWSISSFV---WFVTPTIVTAASF-------AYYIYVQG 628

Query: 367 LSVGDLTAFMLYTEYT--GNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF 424
             +    AF   + +T   + +  LS   S ++Q   +  R+ +   L  +         
Sbjct: 629 EVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDF--LNEKDTKKYDQLT 686

Query: 425 IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
           I   G    F+N + ++         ++LN + + G    ++GP+G GK+++   LL   
Sbjct: 687 IDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEM 746

Query: 485 NPSQGQILIDG----QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540
               G++++      Q++  +        I    Q   L++ T+++NI +   +   +  
Sbjct: 747 YLLSGKVVVPALEPRQEL-VVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEAR-- 803

Query: 541 IRSVAKQC-FCHNF-ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEA 598
            ++V + C    +F I +  D   T IG  G  LSGGQKQR+++ARAL      ++LD+ 
Sbjct: 804 YKAVVEACGLKRDFEILKAGDL--TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDC 861

Query: 599 TSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
            SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V +QG
Sbjct: 862 LSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 131/514 (25%), Positives = 212/514 (41%), Gaps = 84/514 (16%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K IIH    F DT  +G +++R   D   +   + + +   V   F    GV +
Sbjct: 968  LNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQ-FANIVGVCV 1026

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF--------GKQIRDNSKKLQEVTANLTRVS-EE 297
            M              +  P L+   VF        G++I    K+L+ +  +    +  E
Sbjct: 1027 MCIVYLPWFA-----IAVPFLVFIFVFIQNHYQSAGREI----KRLEAIQRSFVYNNFNE 1077

Query: 298  QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSY 357
               G+ TI+ + +E+  + K +  I K+     EA ++        +I+ D+  +     
Sbjct: 1078 ILGGMDTIKFYKSEERYIAKSDYLIDKM----NEAGYLTVCVQRWVAILVDMIAVAFALI 1133

Query: 358  GSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFEL- 409
             + L   +Q  +   +  +L T      +  L G F+ +++          +  R+    
Sbjct: 1134 ITLLCVTRQFHISASSVGVLLT-----YVLQLPGLFNTLLRAVSQVENDMNSTERLVSYA 1188

Query: 410  TDL-------KPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGS 461
            TDL       KP   P         + G I+F+NV F Y  RP +PI  +N+N +I    
Sbjct: 1189 TDLPLEAQYHKPETAPPESW----PEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTE 1242

Query: 462  NVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMS 521
             + I G +G GKSTI   L      + G ILID  DI+ L    LR+ + I+ Q+P+L  
Sbjct: 1243 KIGICGRTGAGKSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFR 1302

Query: 522  GTIRDNITYGLTYTPTKEEIRSV-----------------------AKQCFCHNFITRFP 558
            G IR N+     +  T EE+  V                             H F     
Sbjct: 1303 GDIRKNL--DPFHERTDEELWDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKF----- 1355

Query: 559  DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLM 618
               D  +   G   S G++Q +A+ RAL++   +LILDEATS++D E++  I        
Sbjct: 1356 -HLDKVVEEDGANFSLGERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF 1414

Query: 619  KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
                 TI+ IAHRL TI   + ++VL + G V E
Sbjct: 1415 --SHCTILCIAHRLKTILNYDRILVLEH-GEVAE 1445

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 108/202 (53%), Gaps = 19/202 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F NLNF+I++G  V I GP G GK+++      +   + G I I+G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  Y   +++ + V + C   + +   P    T IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYE--EDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR + K+  + +LD+  SA+D    +  ++    +L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 629 AHRLSTIRRSENVIVLGNDGSV 650
            H+LS I ++  +IVLGNDGSV
Sbjct: 775 -HQLSLIDKASRIIVLGNDGSV 795

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 126/509 (24%), Positives = 227/509 (44%), Gaps = 42/509 (8%)

Query: 182  NLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGS 241
            N   K+   ++  ++H   +FFD    G +++R   D   + + +T  I     ++    
Sbjct: 1132 NASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECL 1191

Query: 242  AGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEEQFN 300
            + V ++                S L      F        K+ + ++ + + +   E   
Sbjct: 1192 STVILITFITPQFLSIAIVV--SILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLV 1249

Query: 301  GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360
            G+ TI++F  E   M +   +++KI    K   ++       A  I  +  LV+   G +
Sbjct: 1250 GVTTIRAFGDEGRFMQE---NLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLF 1306

Query: 361  LVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP 418
            ++F    +  G     + Y   +T  A++ L   +SE+     +  R+ E   +K    P
Sbjct: 1307 ILFNIDHIDSGMAGISLTYAISFTEGALW-LVRLYSEVEMNMNSVERVKEY--MKIEQEP 1363

Query: 419  TRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGK 473
                K +P     + G+IE  ++S  Y   P +P +  N++F ++  S + IVG +G GK
Sbjct: 1364 YNQHKEVPPSQWPQDGKIEVNDLSLRYA--PNLPRVINNVSFSVDAQSKIGIVGRTGAGK 1421

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT 533
            STI   L  +  P  G I ID  DIS +  + LRR I I+ Q+P L SGTI+ N+     
Sbjct: 1422 STIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDE 1481

Query: 534  YTPTK--EEIRSV--AKQCFCHNFITRFPDTYDTA----------------IGPHGTLLS 573
            ++  K  E ++ V    +   H    R  D  DT+                +   G+ LS
Sbjct: 1482 FSDKKIFEALKRVNLISEEQSHQGAVREADN-DTSSNSSENINKFLDLSSEVSEGGSNLS 1540

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 633
             GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL 
Sbjct: 1541 QGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLR 1598

Query: 634  TIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            ++   + ++V+ + G V E      L  N
Sbjct: 1599 SVIDYDKILVM-DAGEVKEYDHPYSLLLN 1626

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 112/480 (23%), Positives = 212/480 (44%), Gaps = 46/480 (9%)

Query: 196 IHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXX 255
           I+ D +   +  +G +I+ +  DAF VS  I   +   ++A  +    + ++        
Sbjct: 463 INGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHLLGFAA 521

Query: 256 XXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEM 315
                 + + L L+ K+  K I D  KK   VT N  +   E F  I+ I+ F  E++  
Sbjct: 522 IVGVLIIVAMLPLNYKL-AKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFE 580

Query: 316 HKFNGSIRK-----------IFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQ 364
            + N +IR+           I+++   ++F+   +F T +I+   SF       ++ ++ 
Sbjct: 581 KEIN-TIRENELSLLLMRSIIWSI---SSFV---WFVTPTIVTAASF-------AYYIYV 626

Query: 365 QQLSVGDLTAFMLYTEYT--GNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGS 422
           Q   +    AF   + +T   + +  LS   S ++Q   +  R+ +   L  +       
Sbjct: 627 QGEVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDF--LNEKDTKKYDQ 684

Query: 423 KFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLH 482
             I   G     +N + ++         ++LN + + G    ++GP+G GK+++   LL 
Sbjct: 685 LTIDPNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLG 744

Query: 483 YYNPSQGQILIDG----QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK 538
                 G+I++      Q++  +        I    Q   L++ TI+ NI +   +   +
Sbjct: 745 EMYLLNGKIVVPALEPRQEL-VVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEAR 803

Query: 539 EEIRSVAKQC-FCHNF-ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILD 596
              ++V + C    +F I +  D   T IG  G  LSGGQKQR+++ARAL      ++LD
Sbjct: 804 --YKAVVEACGLKRDFEILKAGDL--TEIGEKGIALSGGQKQRVSLARALYSNARHVLLD 859

Query: 597 EATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           +  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + +QG
Sbjct: 860 DCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 141/272 (51%), Gaps = 31/272 (11%)

Query: 408  ELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIV 466
            E T  KP  +P      I  + G+I+FK+ +F Y  +  +P I +N N  ++ G  + I 
Sbjct: 782  ERTSSKPETSPGH----IWPENGKIQFKDANFRY--KEGLPLILKNFNMLVQSGEKIGIC 835

Query: 467  GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRD 526
            G +G GKSTI   L      + G I ID  DIS L    LR+++ I+ Q+PIL  GTIR 
Sbjct: 836  GRTGAGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRK 895

Query: 527  NI---TYGLTYTPTKEEIRS--VAKQCFCH--------NFITRFPDTYDTAIGPHGTLLS 573
            N+   +Y    T  +  I S  + +  F H          +T+F  T    +   GT  S
Sbjct: 896  NLDPFSYFDDATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYS 953

Query: 574  GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM---TIVSIAH 630
             G+KQ +A  RA+I    V++LDEA+S++D E++  I     Q + SK     TI+ IAH
Sbjct: 954  LGEKQLLAFTRAIIHHSKVVVLDEASSSVDYETDAKI-----QTLISKQFSHNTILCIAH 1008

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            RL+TI + + ++VL + G+++     + LF N
Sbjct: 1009 RLNTILKYDRILVL-DHGNIIGFENPRVLFEN 1039

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F NLNF I  G  + I GP G GK+++ + +       +G I IDG            + 
Sbjct: 205 FNNLNFSI-XGEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGN----------LQL 253

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
            G     P + + T+RDNI +G  Y   KE+   V + C     +  F     T IG  G
Sbjct: 254 CGY----PWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 627
             LSGGQK RI +ARA+ K   + + D+  SA+D      I  N   G L   K+  I++
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA 366

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             H+LS I++++ ++VLGND S  E G +KEL
Sbjct: 367 -THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 124/517 (23%), Positives = 226/517 (43%), Gaps = 58/517 (11%)

Query: 182  NLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVF--- 238
            N   K+  +++  ++H   +FFD   +G +++R   D      ++ Q+++  ++A F   
Sbjct: 1155 NASRKIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDI----EAVDQELTPYLEAAFYCL 1210

Query: 239  IGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRVSEE 297
            +      ++              +G    L    +    R+  K+ + VT + + +   E
Sbjct: 1211 VECVSTMLLIAFITPQFLILAIFIGFLYYLVGYFYMAASRE-LKRFESVTKSPIYQHFSE 1269

Query: 298  QFNGIKTIQSFVAEQ----SEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLV 353
               GI TI+++  E+      +HK + + +  F +     +++ +      +IG L   V
Sbjct: 1270 TLVGIVTIRAYGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRI----DMIGSL---V 1322

Query: 354  VLSYGSWLVFQ-QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELT-- 410
            V   G +++     L  G     + Y      A   L  F++++     +  R+ E    
Sbjct: 1323 VFGAGVFIILNIDNLDSGLAGISLTYAISFTEAALWLVRFYADVEMNMNSVERLKEYMEI 1382

Query: 411  DLKPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCI 465
            D +P       S+ +      + G+IE  N+S  Y   P +P + +N+ F +E    V +
Sbjct: 1383 DQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYA--PNLPKVIKNVTFVVEPNCKVGV 1440

Query: 466  VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
            VG +G GKSTI   L  + +   G I ID  DI+ ++   LRR I I+ Q+P L SGTIR
Sbjct: 1441 VGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIR 1500

Query: 526  DNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT--------------------YDTAI 565
             N+     Y    ++  ++ K     N I     T                        I
Sbjct: 1501 SNLD---PYNEFSDD--AIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNEI 1555

Query: 566  GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 625
               G  LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  + K  TI
Sbjct: 1556 TEGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTI 1613

Query: 626  VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            ++IAHRL ++   + ++V+ + G V E      L  N
Sbjct: 1614 LTIAHRLRSVCDYDKILVM-DAGEVKEYDHPYSLLLN 1649

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 115/459 (25%), Positives = 201/459 (43%), Gaps = 28/459 (6%)

Query: 208 VGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLL 267
           +G +I+ +  DAF VS  I   +   V+A+ +    + ++              + + L 
Sbjct: 512 LGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFLP 570

Query: 268 LSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRK--- 324
           L+ K+    + +  KK   VT    +   E F  I+ I+ F  E +          K   
Sbjct: 571 LNLKL-ATLLGEYQKKSLAVTDKRIQKLNETFQAIRIIKYFSWEDNFTRDIETVREKELH 629

Query: 325 -IFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYT- 382
            +F      AF +  +F T SI+   SF       ++ ++ Q  ++    AF   + +T 
Sbjct: 630 LLFKRSLIWAFSSFIWFITPSIVTSCSF-------AFYIYVQGETLTTPVAFTALSLFTL 682

Query: 383 -GNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNY 441
               +  LS   S ++Q   +  RI +L  L+ +         I   G  I F+N +  +
Sbjct: 683 LKTPLDQLSNMISFVIQSKVSLDRIQDL--LQEKETEKYSQLTIDKNGNRIAFQNATVAW 740

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDI 498
             + +    R+LN   + G    ++GP+G GKS++   LL   +   G I++   D +D 
Sbjct: 741 DKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIVPSLDPRDE 800

Query: 499 SALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF-ITRF 557
             +    +   I    Q   L++ T+R+NI +   Y   +     V   C   +F I + 
Sbjct: 801 LVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYN-AVVEACCLKRDFEILKA 859

Query: 558 PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFG 615
            D   T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   G
Sbjct: 860 GDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWIYDNCITG 917

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
            LM++++  +VS  H ++   R+  ++V+  DG V +QG
Sbjct: 918 PLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 126/514 (24%), Positives = 232/514 (45%), Gaps = 48/514 (9%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N +A L A+      ++K +++   +FFD+  +G +++R   D   V + +T  + +G  
Sbjct: 905  NFMAGLNASRKIFNLILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFV-EGAF 963

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN-LTRV 294
               +      ++              +     L    +    R+  K+ + ++ + + + 
Sbjct: 964  VSLVQCLSTVILIAYITPGFFVVAIFIAILYYLVGYFYMAGSRE-LKRFESISRSPIHQH 1022

Query: 295  SEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVV 354
              E   GI TI++F  E+  M +   ++ KI    K   ++       A  I  +   V+
Sbjct: 1023 FSETLVGITTIRAFGDERRFMQE---NLEKIDENNKPFFYLWVANRWLAFRIDMIGACVI 1079

Query: 355  LSYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
             + G +++   + L  G     + Y   +T  A++ L   +S +     +  R+ E  ++
Sbjct: 1080 FAAGIFVLLNIKSLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMEV 1138

Query: 413  KPRINPTRGSKFIPA----KGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVG 467
            +    P   S   P       G+IE  ++S  Y   P++P + +N++F ++    V IVG
Sbjct: 1139 EQE--PHYQSTHTPPPEWPSQGKIEVNDLSLRYA--PSLPKVIKNVSFTVDPNCKVGIVG 1194

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKSTI   L  + +P  G I ID  DI+++  K LR+ I I+ Q+P L +GT++ N
Sbjct: 1195 RTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSN 1254

Query: 528  ITYGLTYTP-------------TKEEIRSV-----AKQCFCHNFITRFPDTYDTAIGPHG 569
            +     Y+              T+EE+ S               + +F    D  I   G
Sbjct: 1255 LDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFL-RLDNEITEGG 1313

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSI 628
              LS GQ+Q + +AR+L++ P V++LDEAT+++D  S+  I  T  G+   S   TI++I
Sbjct: 1314 ANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTI 1370

Query: 629  AHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            AHRL +I   + ++V+ + G V E      L  N
Sbjct: 1371 AHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLN 1403

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 90/378 (23%), Positives = 170/378 (44%), Gaps = 32/378 (8%)

Query: 297 EQFNGIKTIQSFVAEQS---EMHKFNGSIRKIFA----VGKEAAFINAKFFTTASIIGDL 349
           E F  I+ I+ F  E++   ++        K+      V    AF+   +F T SI+  +
Sbjct: 345 ETFQAIRIIKFFSWEENFEKDIQNIRDQELKMLVKRSIVWALTAFV---WFVTPSIVTTV 401

Query: 350 SFLVVLSYGSWLVFQQQLSVGDL--TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
           SF       +++  Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ 
Sbjct: 402 SF------ATYIYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRV- 453

Query: 408 ELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVG 467
               +    + T     I      I F+N +F++  +      +N++ +   G    ++G
Sbjct: 454 ---QVFLEEDETEKYDQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIG 510

Query: 468 PSGKGKSTIAWLLLHYYNPSQGQI---LIDGQDISALSTKSLRRHIGIVQQEPILMSGTI 524
           P+G GK+++   LL   +  +G++    +D ++   +    +   I    Q   L++ T+
Sbjct: 511 PTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTV 570

Query: 525 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIAR 584
           ++NI +   +   + +  +V + C              T IG  G  LSGGQKQR+++AR
Sbjct: 571 KNNILFSSPFNEARYD--AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLAR 628

Query: 585 ALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 642
           AL      L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +
Sbjct: 629 ALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCILVS--HNVALTLKNADWV 686

Query: 643 VLGNDGSVVEQGKFKELF 660
           V   +G V +QG+  ELF
Sbjct: 687 VFMENGKVKDQGEPLELF 704

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 140/282 (49%), Gaps = 32/282 (11%)

Query: 402  AASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKI 457
            +  RI E  +L P     I  +R  K  P++G  I F+N S  Y      P+ +++  +I
Sbjct: 1264 SVERILEYCNLPPEADAIIEESRPPKEWPSRGA-ITFQNYSTKYRENLD-PVLKDITVEI 1321

Query: 458  EQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEP 517
            +    + IVG +G GKST++  L     PS G I+IDG DI+ L    LR ++ I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 518  ILMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNF-----ITRFPDTY 561
                GTI+ N           I   L  +  K  I  +A +    N       TR  +  
Sbjct: 1382 QAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
               I  +G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 622  SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
              TI++IAHR+ T+  S+ ++VL       ++G+ KE F  P
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDTP 1533

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 133/285 (46%), Gaps = 27/285 (9%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR-RHIG 511
           +F+  +G   CIVG  G GKST    +L       GQ+  I G D        +R + I 
Sbjct: 650 HFEARKGDLTCIVGRVGSGKSTFLQAIL-------GQLPCISGLDEHVPPKLIIRAKSIA 702

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              Q+P +M+ +++DN+ +G  +   ++  ++  ++C     +   PD   T +G  G  
Sbjct: 703 YCPQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGIS 760

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIV 626
           LSGGQK R+++ARA+  +  V +LD+  SA+D E      E  +N   G L   K+ T++
Sbjct: 761 LSGGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---KNKTVI 817

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE-LFANPAXXXXXXXXXXXXGNNAAPEIQ 685
              + +S ++ S+N+  L  DG +VE   + + +  + +              N+  + +
Sbjct: 818 LTTNAVSVLKHSQNIYALL-DGEIVENKSYADAMSCDDSSILKTLIQEFDSNENSREDTK 876

Query: 686 PQEISQTIEEDP----SFSGEATPASSVTG--FKAETEAETINEV 724
             + S T ++D     S   E    +S T   +  +TE   +NEV
Sbjct: 877 DGQPSSTAKDDQKSFHSIKDEQEDRASTTKLVYSLDTEENMLNEV 921

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 123/511 (24%), Positives = 228/511 (44%), Gaps = 42/511 (8%)

Query: 182  NLVAKLRAN------VIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235
            N +A L A+      ++K +++   +FFD+  +G +++R   D   V + +T  + +G  
Sbjct: 1118 NFMAGLNASRKIFNLILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFV-EGAF 1176

Query: 236  AVFIGSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS 295
               +      ++              +G    L    +    R+  +      + + +  
Sbjct: 1177 VSLVQCLSTVILIAYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHF 1236

Query: 296  EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVL 355
             E   GI TI++F  E+  M +   ++ KI    K   ++       A  I  +   V+ 
Sbjct: 1237 SETLVGITTIRAFGDERRFMQE---NLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIF 1293

Query: 356  SYGSWLVFQ-QQLSVGDLTAFMLYT-EYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK 413
            + G +++   + L  G     + Y   +T  A++ L   +S +     +  R+ E  +++
Sbjct: 1294 AAGIFVLLNIKSLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMEVE 1352

Query: 414  --PRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSG 470
              P    T          G+IE  ++S  Y   P++P + +N+ F ++    V IVG +G
Sbjct: 1353 QEPHYQSTHNPPPEWPSQGKIEVNDLSLRYA--PSLPKVIKNVTFTVDPNCKVGIVGRTG 1410

Query: 471  KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
             GKSTI   L  + +P  G I ID  DI+++  K LR+ I I+ Q+P L +GT++ N+  
Sbjct: 1411 AGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDP 1470

Query: 531  GLTYTP-------------TKEEIRSVAK------QCFCHNFITRFPDTYDTAIGPHGTL 571
               Y+              T+EE+   A            N + +F    +  I   G+ 
Sbjct: 1471 YDEYSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSN 1528

Query: 572  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
            LS GQ+Q + +AR+L++ P V++LDEAT+++D +S+  I  T     +    TI++IAHR
Sbjct: 1529 LSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHR 1586

Query: 632  LSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
            L +I   + ++V+ + G V E      L  N
Sbjct: 1587 LRSIIDYDKILVM-DAGEVKEYDHPYSLLLN 1616

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 112/474 (23%), Positives = 209/474 (44%), Gaps = 42/474 (8%)

Query: 205 TYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGS 264
           T  +G +I+ +  DAF VS  I   +   V+A+ +    + ++              +G+
Sbjct: 469 TANLGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAI-----IGA 522

Query: 265 PLLLSAKVFGKQIRDNSKKLQEVTANLT--RVSE--EQFNGIKTIQSFVAEQSEMHKFNG 320
            L+++      ++     KLQ+ T + T  R+ +  E F  I+ I+ F  E++    F  
Sbjct: 523 LLIVAILPLNFRLATLIGKLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN----FEK 578

Query: 321 SIRKI------FAVGKEAAFINAKF--FTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDL 372
            I+ I        V +  A+    F  F T +I+  +SF   + Y    V    ++   L
Sbjct: 579 DIQSIRDQELKMLVKRSVAWALTAFVWFITPTIVTSVSFAFYI-YVQGEVLTTPVAFTAL 637

Query: 373 TAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEI 432
           + F L      N +  LS   S ++Q   +  R+ E  + +      +    I     +I
Sbjct: 638 SLFTLLR----NPLDMLSDMLSYVIQSKVSLDRVQEFLEEEETEKYEQ----ITVHRNKI 689

Query: 433 EFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI- 491
            F+N +F++  +      +N+N   + G    ++GP+G GK+++   LL   +  +G++ 
Sbjct: 690 GFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVY 749

Query: 492 --LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKE-EIRSVAKQC 548
              +D ++   +    +   I    Q   L++ T+++NI +    +P  E    +V + C
Sbjct: 750 APCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEAC 806

Query: 549 FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 608
                         T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 807 GLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTAL 866

Query: 609 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660
            I  N   G LM+ ++  +VS  H ++   ++   +V   +G V +QG+  EL+
Sbjct: 867 WIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 152/304 (50%), Gaps = 37/304 (12%)

Query: 381  YTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA----KGGEIEFKN 436
            +T  A++ L   +S +     +  R+ E  D++    P   S   P     + G IE  +
Sbjct: 1316 FTEGALW-LVRLYSNVEMNMNSVERLKEYMDVEQE--PYDQSILTPPVEWPQQGRIEVND 1372

Query: 437  VSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
            +S  Y   P +P + +N++F ++  S V IVG +G GKSTI   L  + +P  G I ID 
Sbjct: 1373 LSLRYA--PNLPKVIKNVSFTVDPRSKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDN 1430

Query: 496  QDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP-------------TKEEIR 542
             DI+++  + LRR I I+ Q+P L +GTI+ N+     YT              T+EE+ 
Sbjct: 1431 VDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQIFEALKRVNLVTQEELD 1490

Query: 543  ---SVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEAT 599
               +          I +F D   + I   G  +S GQ+Q + +AR+L++ P +++LDEAT
Sbjct: 1491 RRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCLARSLLRSPKIILLDEAT 1549

Query: 600  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            +++D  S+  I  T  +       TI++IAHRL ++   + ++V+       + G+ KE 
Sbjct: 1550 ASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKILVM-------DAGEVKE- 1599

Query: 660  FANP 663
            F +P
Sbjct: 1600 FDHP 1603

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 111/476 (23%), Positives = 209/476 (43%), Gaps = 36/476 (7%)

Query: 196 IHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXX 255
           I+ D +   +  +G +I+ +  DAF VS  I   +   V+AV +      ++        
Sbjct: 465 INGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLGFAA 523

Query: 256 XXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLT--RVSE--EQFNGIKTIQSFVAE 311
                 +G+ L+++      ++      LQ+ T ++T  R+ +  E F  I+ I+ F  E
Sbjct: 524 I-----VGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAFQAIRIIKFFSWE 578

Query: 312 QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGD 371
               + F   IR +     +     +  +  +S +  ++  +V S   W     Q  V  
Sbjct: 579 ----NNFEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEV-- 632

Query: 372 LTAFMLYTEYTGNAIF-----NLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIP 426
           LT  + +T  +  ++       LS   S ++Q   +  R+ E  + K   +  + ++   
Sbjct: 633 LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEK---DTEKYNQLST 689

Query: 427 AKGGE-IEFKNVSFNYPT-RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYY 484
           AK  + I F+N +  +   RP   + +NLN   + G    I+GP+G GK+++   LL   
Sbjct: 690 AKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEM 748

Query: 485 NPSQGQILI---DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEI 541
           +   G+I++   D +    +    +   +    Q   L++ T+++NI +   Y   + E 
Sbjct: 749 HLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGRYE- 807

Query: 542 RSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
            +V + C      +       T IG  G  LSGGQKQRI++AR+L      ++LD+  SA
Sbjct: 808 -AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSA 866

Query: 602 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
           +D  +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V  QG+
Sbjct: 867 VDSHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 99/347 (28%), Positives = 166/347 (47%), Gaps = 38/347 (10%)

Query: 346  IGDLSFLV--VLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
            IG+L  L   +LS+ + L  ++QLS G +   M Y+    +++  +     +I     + 
Sbjct: 1215 IGNLIILATGLLSFAT-LGTKKQLSSGMVGLLMSYSLQVTSSLMWIVRMTVQIETRIVSV 1273

Query: 404  SRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQ 459
             R  E  +LKP     I  +R  +  P +G  IEF N +  Y      P+ +++N  I+ 
Sbjct: 1274 ERTLEYCELKPEALEIIENSRPPEGWPREGA-IEFNNYTTKYRENLD-PVLKDINVSIKP 1331

Query: 460  GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
               + IVG +G GKST+   L      + G I IDG DIS +  + LR ++ I+ Q+   
Sbjct: 1332 KEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLEDLRSNLAIIPQDAQA 1391

Query: 520  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF------------------PDTY 561
              GTIR N+     +  + EE+    +       I R                   PD++
Sbjct: 1392 FEGTIRSNLDPFDQH--SDEELWRAVELSHLKQHILRMNEEANDRESDSSRTDITTPDSH 1449

Query: 562  D------TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
            +      T I  +G+ +S GQ+Q + ++RAL+    VLILDEAT+A+D+E++  +  T  
Sbjct: 1450 NIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATAAIDMETDKIVQDTIK 1509

Query: 616  QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
               K +  TI++IAHR+ T+   + ++VL + G V E      L ++
Sbjct: 1510 NEFKER--TILTIAHRIDTVMNYDKILVL-DKGEVAEFDTVSNLLSD 1553

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 110/213 (51%), Gaps = 19/213 (8%)

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR-RHIG 511
           NF +++GS  CIVG  G GKSTI   +L       GQ+  I   D +     ++R   I 
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIA 702

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              QE  +M+ ++++NI +G  +      +  V + C   + ++  PD  +T +G  G  
Sbjct: 703 YCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGIS 760

Query: 572 LSGG-QKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIV 626
           L GG QK RI++ARA+  +  V +LD+  SA+D   S+  I Y   +   L+++K  TI+
Sbjct: 761 LVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TII 818

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
              + ++ ++ S+ +  +   G +VE+  ++ +
Sbjct: 819 LSTNNVNVLKNSQKIYAI-EKGEIVEESDYENV 850

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 139/263 (52%), Gaps = 12/263 (4%)

Query: 395  EIMQGAGAASRIFELTDLKPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIF 450
            E+     +  RI E +++K      I   R     P+KG +I+F++ S  Y     + + 
Sbjct: 1234 EVETNIVSVERIKEYSEIKSEAPLVIEDHRPPADWPSKG-DIKFEHYSTRYRENMNL-VL 1291

Query: 451  RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510
            +++N  ++    + IVG +G GKS++   L      ++G+I+IDG  I+ +    LR  +
Sbjct: 1292 KDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEIGLHDLRHKL 1351

Query: 511  GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFP-DTYDTAIGPHG 569
             I+ Q+  +  GT+R+NI     Y  + EEI  V +     N +     D   T +   G
Sbjct: 1352 SIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVLELSHLKNHVLSMSKDGLMTRLTEGG 1409

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 629
              LS GQ+Q + +ARAL+    +LILDEAT+A+DVE++  I  T     K +  TI++IA
Sbjct: 1410 ANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRTAFKDR--TILTIA 1467

Query: 630  HRLSTIRRSENVIVLGNDGSVVE 652
            HRL+TI  S+ ++VL + G V E
Sbjct: 1468 HRLNTIMDSDRILVL-DAGEVRE 1489

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 116/246 (47%), Gaps = 39/246 (15%)

Query: 428 KGGEIEFK---NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
           K G++  K   + +F +  +P   +  +N+N ++++G   C+VG  G GKS +   LL  
Sbjct: 625 KAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGD 684

Query: 484 YNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRS 543
               +G   + G                 V Q P +M+GT++DNI +G  Y P   ++  
Sbjct: 685 LYRVKGYAAVHGS-------------TAYVSQVPWIMNGTVKDNILFGHKYDPVFYDL-- 729

Query: 544 VAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALD 603
             K C     +   PD   T +G  G  LSGGQK R+++ARA   +    +LD+  +A+D
Sbjct: 730 TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVD 789

Query: 604 VE-SEGAINYTFGQ--LMKSKS-------MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
              ++  I +  G   L+KSK+       +T++SIA  +S +            G +++ 
Sbjct: 790 EHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQH 839

Query: 654 GKFKEL 659
           G ++++
Sbjct: 840 GSYEDI 845

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 122/498 (24%), Positives = 218/498 (43%), Gaps = 43/498 (8%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSA 242
            L A +   +     +FF+T  +G +++R  ND F    ++ R+ +Q +++ +K  F    
Sbjct: 1032 LHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSF---- 1087

Query: 243  GVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-----EE 297
                                  PL +    + +     S++L+ + +  TR       +E
Sbjct: 1088 -----TIIVICFTTWQFTLFVIPLGILYVYYQQYYLRTSRELRRLDST-TRSPIYAHFQE 1141

Query: 298  QFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSY 357
               G+ TI+ +  ++  +H     +    +    +   N         IG      ++ +
Sbjct: 1142 SLGGLSTIRGYNQQRRFIHINQSRMDNNMSAYYPSVNANRWLAYRLEFIG-----TIIIF 1196

Query: 358  GSWLVFQQQLSVGDLTAFML-----YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDL 412
            G+  +   +L  G LT  M+     Y      ++  +     E+     +  RI E +++
Sbjct: 1197 GASSLSILRLKSGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEI 1256

Query: 413  KPR----INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVG 467
                   I   R S   P  G  I+F++ S  Y  RP +  I +++N  I+    + IVG
Sbjct: 1257 PSEAPYLIEDRRPSPNWPTDGA-IQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVG 1313

Query: 468  PSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN 527
             +G GKS++   L      ++G+I+IDG  I  +    LR  + I+ Q+  +  G++R+N
Sbjct: 1314 RTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVREN 1373

Query: 528  ITYGLTYTPTKEEIRSVAKQCFCHNFITRF-PDTYDTAIGPHGTLLSGGQKQRIAIARAL 586
            I     Y  + EEI  V       N +     D   T +   G  LS GQ+Q + +ARAL
Sbjct: 1374 IDPTEQY--SDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARAL 1431

Query: 587  IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGN 646
            +    +L+LDEAT+A+DVE++  +  T       +  TI++IAHRL+TI  S+ ++VL +
Sbjct: 1432 LVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-D 1488

Query: 647  DGSVVEQGKFKELFANPA 664
             G V E    + L  NP 
Sbjct: 1489 AGRVAEFDTPENLLKNPG 1506

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 121/237 (51%), Gaps = 25/237 (10%)

Query: 430 GEIEFK---NVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
           G++  K   N +F +  +P   +  +N+NF+ ++G   C+VG  G GKS +   LL    
Sbjct: 626 GDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLLGDLF 685

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
             +G   + G             +I  V Q   +M+GT++DNI +G  Y P  E      
Sbjct: 686 RVKGFATVHG-------------NIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTI 730

Query: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
           K C     +   PD   T +G  G  LSGGQK R+++ARA+  +  + +LD+  +A+D  
Sbjct: 731 KACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEH 790

Query: 606 -SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            S   I++  G   L+K+K+  + +  +++S +  +++V +L N G +++QG F E+
Sbjct: 791 VSTHLIDHVLGPNGLLKTKTKILAT--NKISALSIADSVTLLEN-GEIIQQGTFCEI 844

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 222/514 (43%), Gaps = 69/514 (13%)

Query: 187 LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSA-GVG 245
           L    +K I+H    F DT  +G +++R   D   +   +T+ I   +    +G+  GV 
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIR--LMMFQLGNIIGVI 539

Query: 246 MMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKT 304
           +M              +    ++ A  +    R+  K+L+ V  +    +  E   G+ T
Sbjct: 540 VMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGRE-VKRLEAVQRSFVYNNLNEVLGGLDT 598

Query: 305 IQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQ 364
           I+++ ++   + K +  I K+     EA ++ A      +I  D+  ++     + L   
Sbjct: 599 IRAYRSQDRFLVKSDFLINKM----NEAGYMVAALQRWVAIFLDMLAVIFALIITLLCVT 654

Query: 365 QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQ-------GAGAASRIFELTDLKPRIN 417
           +Q  +   +  +L T      +  L G  + +++       G  +A R+       P+  
Sbjct: 655 RQFKISPSSTGVLLT-----YVLQLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEA 709

Query: 418 PTRGSKFIPAKG----GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKG 472
             R  +  P +     GEI+F+ VSF Y  RP++P + +N +  I  G  + I G +G G
Sbjct: 710 EYRRPEMSPPENWPDRGEIKFEGVSFAY--RPSLPPVLKNFSLNIGSGEKIGICGRTGAG 767

Query: 473 KSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI---- 528
           KSTI   L        G+I ID  +I+ L    LR  + I+ Q+P+L  GTI+ N+    
Sbjct: 768 KSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFG 827

Query: 529 -----------TYGLTYTPTKEEIRSVAKQ----CFCHNFITRFPDTYDTAIGPHGTLLS 573
                        G    P  E+I     Q       H+ + +F    +  +   G   S
Sbjct: 828 EKTDQELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFS 883

Query: 574 GGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY----TFGQLMKSKSMTIVSIA 629
            G+KQ +A+ RAL++   +LILDEATS++D E++  I       FG        TI+ IA
Sbjct: 884 LGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFGDC------TILCIA 937

Query: 630 HRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
           HRL+TI   + ++VL       EQG+  E F  P
Sbjct: 938 HRLNTILNYDRILVL-------EQGEVAE-FDTP 963

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 106/211 (50%), Gaps = 20/211 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F+NLNF I++G  + + GP G GK+++   +  +   S G + ++G+ +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLSC--------- 156

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
                  P + + T+RDNI +G  Y   K   R V K C   + +   P    T IG  G
Sbjct: 157 -----GYPWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RI +AR + K   + + D+  SA+D    +  ++     L+  K+  + + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILAT- 268

Query: 629 AHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            H+L+ I ++  +IVLGNDGS    G ++EL
Sbjct: 269 -HQLALIEKATRLIVLGNDGSFT-IGTYEEL 297

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 126/507 (24%), Positives = 228/507 (44%), Gaps = 50/507 (9%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    ++ ++H    F D   +G +++R   D    + ++  +I++ V+ +    A +  
Sbjct: 944  LNIKALQRLLHAPMSFMDVTPIGRVMNRFTKD----TDTLDNEITESVRLLIFQIANLTG 999

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF-GKQIRDNSKKLQEVTANLTRVSEEQFN----G 301
            +              M  P L+   VF     + + ++++ + A         FN    G
Sbjct: 1000 IIILCIIYIPWFAIAM--PFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEVLGG 1057

Query: 302  IKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWL 361
            + TI+++ +EQ  + K +  I K+     EA ++        +I  D+  ++     + L
Sbjct: 1058 MDTIKAYRSEQRFLMKSDFLINKM----NEAGYLVTSIQRWVAISLDMLAVIFALIIALL 1113

Query: 362  VFQQQL-----SVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRI----FEL-TD 411
               +Q      SVG +  ++L      NA+       ++      +A R+    ++L  +
Sbjct: 1114 CVTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQ---TQTENDLNSAERLVNYAYDLPIE 1170

Query: 412  LKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSG 470
             K RI  T+  +  P++G  I+F+NVS  Y  RP +P+  +N++  I     + I G +G
Sbjct: 1171 AKYRILETQPPEQWPSEG-RIKFENVSLAY--RPELPVALKNVSIDIGSNEKIGICGRTG 1227

Query: 471  KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITY 530
             GKSTI   L        G+I ID  DIS L    LR  + I+ Q+P+L  G IR N+  
Sbjct: 1228 AGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDP 1287

Query: 531  GLTYTP-------------TKEEIRSVAKQCFCHNFIT--RFPDTYDTAIGPHGTLLSGG 575
                T               ++++ S+  Q    N ++   F    D  +   G+  S G
Sbjct: 1288 FQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLG 1347

Query: 576  QKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 635
            ++Q +A+ RAL++   +LILDEATS++D  ++  I     +  +  + TI+ IAHRL TI
Sbjct: 1348 ERQLLALTRALVRGSKILILDEATSSVDYATDAKIQSRIVE--EFSNCTILCIAHRLKTI 1405

Query: 636  RRSENVIVLGNDGSVVEQGKFKELFAN 662
                 ++VL + G VVE    K+L+ +
Sbjct: 1406 LAYNRILVL-DQGQVVEFDTPKKLYND 1431

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F  LNF +++   + I GP G GKS++   L  +   S G + I G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T++DNI +G  +   K + + V + C     +   P    T IG  G
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 628
             LSGGQK RIA+AR++ K   + + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 629 AHRLSTIRRSENVIVLGNDGS 649
            H+LS I ++  VI LG DGS
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS 774

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 122/503 (24%), Positives = 221/503 (43%), Gaps = 68/503 (13%)

Query: 180  SENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFI 239
            + NL+ K    ++  +++    FFD   +G +++R   D  ++   +   + DGV + FI
Sbjct: 1131 TANLIFK---KLLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFL-DGVFSCFI 1186

Query: 240  GSAGVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTAN----LTRVS 295
             +    M+              +   ++ S+   G      S++L+   ++    + +  
Sbjct: 1187 QAVTALMLIVFITPKFLI----IAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHF 1242

Query: 296  EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFI---NAKFFTTASIIGDLSF- 351
             E  +G+ TI++F  E             I  + +   FI   N  FF   S+   LSF 
Sbjct: 1243 TETLSGLVTIRAFGNE-------------IKFLKENLDFIDENNKFFFYMWSVNSWLSFR 1289

Query: 352  ------LVVLSYGSWLVFQ-QQLSVG----DLTAFMLYTEYTGNAIFNLSGFFSEIMQGA 400
                  + V   G++++    ++  G     LT  + +TE+       +  F+S +    
Sbjct: 1290 IDLLGAITVFGSGAFILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSM 1345

Query: 401  GAASRIFELTDLKPRINPTRG----SKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNF 455
             +  R+ E  +++       G    S+  P +G  I F N S  Y   P +P + + LN 
Sbjct: 1346 NSVERLKEYMEIEEEALADPGAITPSENWPVQGA-ITFANYSLRYA--PKLPDVLKQLNL 1402

Query: 456  KIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQ 515
            KI+ GS + +VG +G GKSTI   L  + + S G+ILID  DIS ++ + LR  + I+ Q
Sbjct: 1403 KIDGGSKIGVVGRTGAGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQ 1462

Query: 516  EPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPD--------------TY 561
            +P L  GTIR N+     Y         V       +++                     
Sbjct: 1463 DPSLFVGTIRSNLDPNEEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNL 1522

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
            D+ I   G  LS GQ+Q I +AR+++    +++LDEAT+++D +S+  +  T       K
Sbjct: 1523 DSPISEGGINLSQGQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK 1582

Query: 622  SMTIVSIAHRLSTIRRSENVIVL 644
              TI++IAHR+ ++   + ++VL
Sbjct: 1583 --TILTIAHRIKSVIDYDKILVL 1603

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 169/378 (44%), Gaps = 40/378 (10%)

Query: 297 EQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAF---INA-KFFTTASIIGDLSFL 352
           E F  I+ I+SF  E + + K  G   K  +V K  +    INA  ++ + +II  LSF 
Sbjct: 582 ETFQSIRIIKSFGWENNIIQKILGLRNKEISVLKRNSITWSINALVWYLSPTIITTLSFS 641

Query: 353 VVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNL--------SGFFSEIMQGAGAAS 404
             +     LV +Q L+            +T  A+FNL        S   + + Q   +  
Sbjct: 642 YYI-----LVDKQDLTTP--------VAFTALALFNLLKAPLDQLSNTINFLTQSKVSLD 688

Query: 405 RIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVC 464
           RI +   +K        S  + +    + F   +  +         RN+N + E G    
Sbjct: 689 RIEKFLSVKETTKFENLS--VDSSQNRLAFSGATLGWCGNKKSFQLRNINAEFEMGKLNL 746

Query: 465 IVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALS----TKSLRRHIGIVQQEPILM 520
           ++GP+G GK+++   LL   +   G++ +   + S  +    + +L   I    Q P + 
Sbjct: 747 VIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIF 805

Query: 521 SGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRI 580
           + TIR+NI + + Y   K+   +V   C              T +G  G+ LSGGQKQRI
Sbjct: 806 NDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILNLGDKTIVGDKGSCLSGGQKQRI 863

Query: 581 AIARALIKKPTVLILDEATSALDVESEGAINYTF--GQLMKSKSMTIVSIAHRLS-TIRR 637
           ++ARAL  K   LILD+  SA+D  S   I      G LM+ ++  +VS  H +S TI++
Sbjct: 864 SLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGRTCILVS--HNVSLTIKK 921

Query: 638 SENVIVLGNDGSVVEQGK 655
           +  V ++ N G +V  G+
Sbjct: 922 ASKVFMIEN-GYIVASGR 938

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 123/514 (23%), Positives = 217/514 (42%), Gaps = 69/514 (13%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    ++ ++H    + DT  +G +++R   D   +   +T+ +   +   F    GV +
Sbjct: 958  LNLKAVERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLRLFMTQ-FANIIGVCV 1016

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVF---GKQI-RDNSKKLQEVTANLTRVSEEQFNGI 302
            M              +    +L A  +   G+++ R ++ +   V  NL  V      G+
Sbjct: 1017 MCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEV----LGGM 1072

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLV 362
             TI+++ +++  + K +  I K+     EA ++        +I  D+  +      S L 
Sbjct: 1073 DTIKAYGSQERFLVKTDFLINKM----NEAGYLLVALQRWVAIFLDMIAVAFALIISLLC 1128

Query: 363  FQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG-------AGAASRIFELTDLKPR 415
              +Q  +   +  +L T      +  L G  + I++          +A R+    +  P 
Sbjct: 1129 VTRQFHISPASVGVLLT-----YVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPL 1183

Query: 416  INPTRGSKFIPAKG----GEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSG 470
                +  +  P +     GEI F++VSF Y  RP +P+  + ++  I+    + I G +G
Sbjct: 1184 EADYKRPELAPPESWPSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTG 1241

Query: 471  KGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN--- 527
             GKSTI   L      S G+I ID  DI  +    LR+ + I+ Q+P+L  GTIR N   
Sbjct: 1242 AGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDP 1301

Query: 528  -------------ITYGLTYTPTKEEIR-----SVAKQCFCHNFITRFPDTYDTAIGPHG 569
                         ++ G       E ++     S+      H F        D  +   G
Sbjct: 1302 FQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVEEEG 1355

Query: 570  TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 629
               S G++Q +A+ RAL+++  +LILDEATS++D E++  I             TI+ IA
Sbjct: 1356 ANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIA 1413

Query: 630  HRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
            HRL TI   + ++VL       EQG+ +E F  P
Sbjct: 1414 HRLKTILTYDRILVL-------EQGEIEE-FDTP 1439

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 104/212 (49%), Gaps = 22/212 (10%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F+NLN  I++G  V I GP G GKS++   +  +   + G + +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  Y   KE    V + C     I   P    T IG  G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 627
             LSGGQK RI +AR++ K   + + D+  SA+D      I      G+L   K  T + 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             H+LS I ++  VIVLG DGS  E GK ++L
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 132/251 (52%), Gaps = 29/251 (11%)

Query: 430  GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
            G+IE  ++S  Y   P++P + +N++F +E    V +VG +G GKSTI   L  + +P  
Sbjct: 1374 GKIEVNDLSLRYA--PSLPKVIKNVSFTVEPKMKVGVVGRTGAGKSTIITALFRFLDPET 1431

Query: 489  GQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK---------- 538
            G I ID  DI+ +  K LR+ I I+ Q+P L +GTI+ N+     Y   +          
Sbjct: 1432 GYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDDQIFKALRRVNL 1491

Query: 539  -------EEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPT 591
                    ++ SV+ +      + +F +   + I   G+ LS GQ+Q + +AR+L++ P 
Sbjct: 1492 IVDGNLNSDVTSVSSEN-----VNKFLNL-QSEISEGGSNLSQGQRQLMCLARSLLRAPN 1545

Query: 592  VLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVV 651
            +++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++   + ++V+ + G V 
Sbjct: 1546 IMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVM-DAGEVK 1602

Query: 652  EQGKFKELFAN 662
            E      L  N
Sbjct: 1603 EYDHPYSLLLN 1613

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 110/224 (49%), Gaps = 10/224 (4%)

Query: 429 GGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
           G +I  +NV+ ++  +      RNLN   + G    ++GP+G GK+++   LL   +  +
Sbjct: 695 GNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLE 754

Query: 489 GQILIDGQDISA---LSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           G+I +   D        +  L   +    Q   L++ T+++NI +   Y   +E   +V 
Sbjct: 755 GKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYN--EERYLAVI 812

Query: 546 KQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE 605
             C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  
Sbjct: 813 SACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSH 872

Query: 606 SEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGN 646
           +   I  N   G LM++++  +VS  H ++ T++ +E VI++ N
Sbjct: 873 TAAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN 914

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 131/244 (53%), Gaps = 30/244 (12%)

Query: 430  GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
            G+IE  N+S  Y +   +P + +N+ F +E  S V IVG +G GKSTI   L  + +P  
Sbjct: 1400 GKIEVNNLSLRYAS--NLPKVIKNVTFTVEPQSKVGIVGRTGAGKSTIITALFRFLDPDT 1457

Query: 489  GQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTY-------------- 534
            G I +D  DI+++  K LR+ I I+ Q+P+L +GTI+ N+     Y              
Sbjct: 1458 GTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRIFEALKRVNL 1517

Query: 535  ------TPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIK 588
                  TPT  +I S +      N + +F D   + I   G+ LS GQ+Q + +AR+L++
Sbjct: 1518 IVQEELTPT--DIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQLVCLARSLLR 1573

Query: 589  KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648
             P  ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I   + V+V+ + G
Sbjct: 1574 NPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIIDYDKVLVI-DSG 1630

Query: 649  SVVE 652
             + E
Sbjct: 1631 ELAE 1634

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 94/381 (24%), Positives = 167/381 (43%), Gaps = 37/381 (9%)

Query: 297 EQFNGIKTIQSFVAEQSEMHKFNGSIRKI-----------FAVGKEAAFINAKFFTTASI 345
           E    I+ I+ F  E     KF   ++KI             V   ++F+   ++ T ++
Sbjct: 581 ETLQAIRIIKFFAWED----KFESDVQKIREMELSVMLRRVVVWSLSSFV---WYITPTL 633

Query: 346 IGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASR 405
           +   SF V + Y    V    ++   L+ F+L      N +  L      ++Q + +  R
Sbjct: 634 VASASFCVYI-YVQGEVLTTPVAFTALSLFVLLR----NPLDQLCDIVFSLVQCSVSLRR 688

Query: 406 IFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVC 464
           I    D     + T   + +  K   + F N +  +          +NLN   + G    
Sbjct: 689 IQNFLDQ----DETPKYRQLTVKKDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNV 744

Query: 465 IVGPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTKSLRRHIGIVQQEPILMS 521
           IVGP+G GK+++   LL   N S+G+I +   + ++   +    +   IG   Q   L++
Sbjct: 745 IVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLN 804

Query: 522 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIA 581
            T+R+NI +   Y   +    +V   C     +        T +G  G  LSGGQKQR++
Sbjct: 805 DTLRNNILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVS 862

Query: 582 IARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSE 639
           +ARA+  +   ++LD+  SA+D  +   I  +   G LM+ ++  +VS    L T++ ++
Sbjct: 863 LARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCVLVSHNTAL-TLKNAD 921

Query: 640 NVIVLGNDGSVVEQGKFKELF 660
            V++L N   V  QG+  ELF
Sbjct: 922 WVVILEN-AKVTAQGEPLELF 941

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 121/502 (24%), Positives = 215/502 (42%), Gaps = 60/502 (11%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +K ++H    F DT  +G +++R   D   +   +T+ +      +F  S  VG+
Sbjct: 961  LNLKAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVR---LFLFQASNIVGV 1017

Query: 247  MXXXXXXXXXXXXXXMGSP-LLLSAKVFGKQIRDNSKKLQEVTA----NLTRVSEEQFNG 301
            +              +  P LLL         + +S++++ + A    ++     E  +G
Sbjct: 1018 VIMCIIYLPWFA---IAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSG 1074

Query: 302  IKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWL 361
            + TI+++  E   + K +  I K+     EA ++        SI  D+  +      + L
Sbjct: 1075 MDTIRAYRGEARFLTKSDFLINKM----NEAGYVVVAIQRWVSIALDMIAMAFALIITLL 1130

Query: 362  VFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFEL-TDL- 412
               +Q S+   +  +L T      +  L G  + +M+          +A R+    TDL 
Sbjct: 1131 CVTRQFSISAASVGVLLT-----YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLP 1185

Query: 413  ------KPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCI 465
                  +P  +P       P++G  I+F +VS  Y  RP +P +  +++  +  G  + I
Sbjct: 1186 LEAAYRRPETSPPES---WPSEGA-IDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGI 1239

Query: 466  VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
             G +G GKSTI   L        G I IDG DI+ L    LR  + I+ Q+P+L  G +R
Sbjct: 1240 CGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVR 1299

Query: 526  DNIT--------------YGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY-DTAIGPHGT 570
             N+                      T++E  + A        +T     + +  +   G+
Sbjct: 1300 KNLDPFHERSDNELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGS 1359

Query: 571  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
              S G++Q +A+ RAL++   +LILDEATS++D E++  I             T++ IAH
Sbjct: 1360 NFSLGERQLLALTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAH 1417

Query: 631  RLSTIRRSENVIVLGNDGSVVE 652
            RL+TI   + ++VL + G V E
Sbjct: 1418 RLNTILDYDRILVL-DQGRVCE 1438

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 97/214 (45%), Gaps = 26/214 (12%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F+NLN +I +G  V + G  G GKS++   +  +     G I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPT--KEEIRSVAKQCFCHNFITRFPDTYDTAIGP 567
             ++   P + + T++DNI +G  +     KE IR     C     +   P    T IG 
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQADLDLLPAGDKTEIGE 695

Query: 568 HGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 625
            G  LSGGQK RI +AR++ KK  + + D+  SA+D      I      G L      T 
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKTR 752

Query: 626 VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           V   H+LS I R+  VI +  DG+ V+ G   EL
Sbjct: 753 VLATHQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 144/287 (50%), Gaps = 35/287 (12%)

Query: 393  FSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPA---KGGEIEFKNVSFNYPTRPTVPI 449
            FS +     +  RI E  ++    + +  S   P    + GEIEFKN+S  Y    +  +
Sbjct: 1264 FSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTGEIEFKNLSLRYSPHSSKAL 1323

Query: 450  FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
              N++FK+  G+ V IVG +G GKS+I   +    +   G I+ID +DI  +S + LR  
Sbjct: 1324 -DNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRNS 1382

Query: 510  IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK-------QCFCHNFIT------- 555
            I  + Q P L  GTIR N+     Y+  K+   ++AK       +  C   +T       
Sbjct: 1383 ISCIPQNPTLFDGTIRSNLDPYNQYSD-KQVFDALAKVGLIERNEVLC--LVTDRQQSSS 1439

Query: 556  ----RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611
                +F D  ++ +   G+ LS GQ+Q + +AR+++    ++++DEAT+++D  S+  I 
Sbjct: 1440 FSPNKFSDL-NSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASIDYISDAKIQ 1498

Query: 612  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
             T  + M++   TI++IAHRL ++     ++V+       + G+ KE
Sbjct: 1499 KTIRETMENT--TILTIAHRLRSVIDYNKILVM-------DMGRVKE 1536

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 126/258 (48%), Gaps = 11/258 (4%)

Query: 409 LTDLKPRINPTRGSKF--IPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
           L  ++  ++ +  SK+  +     ++ FK+ +  +    T    +N++ + +  S   I+
Sbjct: 639 LKRIEDYLDESETSKYEILTQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAII 698

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILI---DGQDISALSTKSLRRHIGIVQQEPILMSGT 523
           GP+G GKS++   LL   N   GQI +   D +D   +    +   +    Q P L+SGT
Sbjct: 699 GPTGSGKSSLLLGLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGT 758

Query: 524 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIA 583
           I DNI +G    P +    +V K C     +        T++G  G  LSGGQ+QR+A+A
Sbjct: 759 IEDNIVFG--ERPNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALA 816

Query: 584 RALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 641
           RA+      L+LD+  SA+D E+   I      G +MK ++  I S  H +S I +    
Sbjct: 817 RAIYSSSRFLLLDDCLSAVDPETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEW 874

Query: 642 IVLGNDGSVVEQGKFKEL 659
           +V+ ++G V  QGK  +L
Sbjct: 875 LVILDNGEVKGQGKPSDL 892

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 121/513 (23%), Positives = 214/513 (41%), Gaps = 63/513 (12%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVG 245
            +L    ++ ++H    F DT  +G +++R   D   V   +T+ +      VF  S  VG
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR---LFVFQLSNIVG 1031

Query: 246  MMXXXXXXXXXXXXXXMGSPLLLSAKV-FGKQIRDNSKKLQEVTANLTRVSEEQFN---- 300
            ++              +  P L+   V      + +S++++ + A         FN    
Sbjct: 1032 VIVMCIIYLPWFA---IAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLG 1088

Query: 301  GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360
            G+ TI+++  E+  + K +    K+     EA ++        +I  D+  +      + 
Sbjct: 1089 GMDTIRAYRGERRFLTKSDFLTNKM----NEAGYLVVAIQRWVAIALDMIAMAFALIVTL 1144

Query: 361  LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGA-------GAASRIFELTDLK 413
            L   +Q  +   +  +L T      +  L G  + +++          +  R+       
Sbjct: 1145 LCVTRQFHISAASVGVLLT-----YVLQLPGLLNMLLRAMTQGENDMNSTERLISYATEL 1199

Query: 414  PRINPTRGSKFIPAK----GGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGP 468
            P     R  +  P       G IEF +VS  Y  RP +P + +++   +  G  + I G 
Sbjct: 1200 PLEAAYRRPEMSPPAEWPTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGR 1257

Query: 469  SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
            +G GKSTI   L        G I IDG DIS L    LR  + I+ Q+P++  G +R N+
Sbjct: 1258 TGAGKSTIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNL 1317

Query: 529  TYGLTYTPTKEEIRSV---AKQCFCHNFITRFPDTYDTA--------------IGPHGTL 571
                 +  T +E+             +  T    T++ A              +   GT 
Sbjct: 1318 --DPFHERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTN 1375

Query: 572  LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
             S G++Q +A+ RAL+++  +LILDEATS++D E++  I     +     + TI+ IAHR
Sbjct: 1376 FSLGERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNCTILCIAHR 1433

Query: 632  LSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
            L+TI   + ++VL       +QG+  E F  PA
Sbjct: 1434 LNTILDYDRILVL-------DQGRVCE-FDTPA 1458

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F NLN +I +G  V + G  G GKS++ + L  +   + G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
             ++   P + + T+RDNI +G  Y   +     + + C     +   P    T IG  G
Sbjct: 650 -MLLCGYPWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 627
             LSGGQK RI +ARA+ KK  + + D+  SA+D      I      G+L  S   T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRVL 763

Query: 628 IAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
             H+LS I R+  VI +  DGS V+ G  +EL
Sbjct: 764 ATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 128/505 (25%), Positives = 211/505 (41%), Gaps = 48/505 (9%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGM 246
            L    +  I+H    F DT  +G +++R   D   +   +T+ +   +  +     GVG 
Sbjct: 976  LNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQI-ANIIGVGA 1034

Query: 247  MXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTI 305
            M              +    LL A  +    R+  K+L+ +  +    +  E   G+ TI
Sbjct: 1035 MCIIYLPWFAIAIPFLLLIFLLIADHYQSTGRE-VKRLEAIQRSFVYNNLNEMLTGMDTI 1093

Query: 306  QSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQ 365
            +++ A+     K    I K+     EAA+I+      A I  DL  +      + L   +
Sbjct: 1094 KAYNAQDRFATKSEFLIDKM----NEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTR 1149

Query: 366  QLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQG-------AGAASRIFELTDLKPRINP 418
            Q  +      +L T      +  L G  + +++          +  R+       P+   
Sbjct: 1150 QFHISGADTGVLLT-----YVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQ 1204

Query: 419  TRGSKFIPA----KGGEIEFKNVSFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGK 473
             R  +  P     + G I F+N++F Y  RP +PI  +N N  I+    + I G +G GK
Sbjct: 1205 YRKPECSPPIDWPQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGK 1262

Query: 474  STIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDN------ 527
            STI   L      + G+I+ID  DIS L    LR  + I+ Q+P+L  G IR N      
Sbjct: 1263 STIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDE 1322

Query: 528  ----------ITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQK 577
                      +  G   +   E ++S  K     N + +F    + ++   G   S G++
Sbjct: 1323 YQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGER 1379

Query: 578  QRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 637
            Q +A+ RAL+++  +LILDEATS++D E++  I             TI+ IAHRL TI  
Sbjct: 1380 QVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILN 1437

Query: 638  SENVIVLGNDGSVVEQGKFKELFAN 662
             + ++VL   G V E      LF N
Sbjct: 1438 YDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 105/220 (47%), Gaps = 23/220 (10%)

Query: 445 PTV--PIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALS 502
           PT+  P+  N+NF I +G  V + GP G GK+++ + L        G++   G  +    
Sbjct: 618 PTILKPLLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLLC-- 675

Query: 503 TKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYD 562
                   GI    P + + TIRDNI +G  Y PT    + V   C   + +   P    
Sbjct: 676 --------GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDK 721

Query: 563 TAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSK 621
           T +G  G  LSGGQK RI++ARA+ K   + + D+  SA+D       ++Y     +  K
Sbjct: 722 TEVGERGVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK 781

Query: 622 SMTIVSIAHRLSTIRRSENVIVLGN--DGSVVEQGKFKEL 659
           +  + +  H+LS + +++ +IVL    D    E G FKEL
Sbjct: 782 TRILAT--HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 118/511 (23%), Positives = 221/511 (43%), Gaps = 72/511 (14%)

Query: 186  KLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKA-VFIGSAGV 244
            +L  +  K I++    F DT  +G +++R   D  ++   +T    D  +  VF  +  V
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELT----DSTRMFVFQMANVV 953

Query: 245  GMMXXXXXXXXXXXXXXMGSPLLL-----SAKVFGKQIRDNSKKLQEVTANLTRVS-EEQ 298
            G+                 S LLL       +  G+++    K+L+ +  +    +  E 
Sbjct: 954  GVFILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREV----KRLEAIQRSFVYNNLGEV 1009

Query: 299  FNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYG 358
             +G+ TI+++ A+   + K +  + +      EA ++        ++  DL  + +    
Sbjct: 1010 LDGLDTIRAYNAQSRFLRKSDYFLNRT----NEAGYLVIGARCWVALTTDLVAIAIALIV 1065

Query: 359  SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINP 418
            + L   + + +   +A +L T      +  +  +F+ +++G          T+L+  +N 
Sbjct: 1066 TLLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRG---------FTELENNMNS 1111

Query: 419  TRGSKF----IPAKG----------------GEIEFKNVSFNYPTRPTVPI-FRNLNFKI 457
            T+   +    +P +                 GEI F+ VSF Y  RP +P+    ++F +
Sbjct: 1112 TQRVHYYATALPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHV 1169

Query: 458  EQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEP 517
              G  + I G +G GK+++   L        G I IDG DI+ L    LR  + I+ Q+P
Sbjct: 1170 RAGEKIGICGRTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDP 1229

Query: 518  ILMSGTIRDNI------TYGLTYTP-TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570
            +L  GT+R N+      T G  ++   +  +         H F        D  +   G 
Sbjct: 1230 LLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKF------HLDQEVDEGGA 1283

Query: 571  LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
              S G++Q +A+ARAL++   +LILDEATS++D  ++  +        + +  T++ +AH
Sbjct: 1284 NFSLGERQLLALARALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAH 1341

Query: 631  RLSTIRRSENVIVLGNDGSVVEQGKFKELFA 661
            RL TI   + ++VL + G V E      LFA
Sbjct: 1342 RLRTIISYDRILVL-DQGRVAEFDTPYRLFA 1371

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 96/198 (48%), Gaps = 17/198 (8%)

Query: 452 NLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIG 511
           +L F I++G  + ++G  G GK+++   +  Y   + G + ++G  +            G
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLL----------FCG 602

Query: 512 IVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
           +    P + + TIRDNI +G ++  T+ +   V   C        FP    T +G  G  
Sbjct: 603 V----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERGIT 656

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGGQK RI++ARA+ K   + + D+  SA+D      I      L + ++ T +   H+
Sbjct: 657 LSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILATHQ 715

Query: 632 LSTIRRSENVIVLGNDGS 649
           L+ ++ +  VI LG DGS
Sbjct: 716 LALVQEASRVIFLGQDGS 733

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 123/235 (52%), Gaps = 22/235 (9%)

Query: 428  KGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS 487
            + G+IEF+N++  Y    +  +   ++FK++ G+ V IVG +G GKS+I   +    +  
Sbjct: 1315 QTGDIEFENLTLRYSPHSSKAL-DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWE 1373

Query: 488  QGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK--EEIRSVA 545
             G I+ID +DI  +  + LR  I  + Q P L  GTIR N+     Y+  +  E +  V 
Sbjct: 1374 DGTIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVG 1433

Query: 546  ----KQCFC------------HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589
                 +  C            H    RF D  +T +   G+ +S GQ+Q + +AR+++  
Sbjct: 1434 LIEQSEGLCSLPGQKLSYPSNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLGA 1492

Query: 590  PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 644
              ++++DEAT+++D  S+  I  T  + M++   T+++IAHRL ++   + ++V+
Sbjct: 1493 RNIMLIDEATASIDYVSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM 1545

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 119/246 (48%), Gaps = 9/246 (3%)

Query: 419 TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
           TR  + +     ++ F+N +  +    T    +N++   +Q +   I+GP+G GKS++  
Sbjct: 652 TRKYEILTQSKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLL 711

Query: 479 LLLHYYNPSQGQI---LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
            LL   N   G+I    +  +D   +    +   +    Q P L+SGTI+DNI +G  + 
Sbjct: 712 GLLGELNLRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFN 771

Query: 536 PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595
             +++   V K C     I        T +G  G  LSGGQ+QRIA+ARA+      L+ 
Sbjct: 772 --QQKFDDVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLF 829

Query: 596 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
           D+  SA+D E+   I      G +MK ++  + S  H +S I +    +V+ ++G V  Q
Sbjct: 830 DDCLSAVDPETALHIYEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQ 887

Query: 654 GKFKEL 659
           GK  +L
Sbjct: 888 GKPSDL 893

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 123/521 (23%), Positives = 222/521 (42%), Gaps = 80/521 (15%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSA---G 243
            L    +  +IH    F ++  +G +++R   D    + S+  +I D ++ V   +    G
Sbjct: 873  LNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVG 928

Query: 244  VGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGI 302
            + ++              +G  L ++   +    R+  K+L+ V  +       +   G+
Sbjct: 929  ISVLCIIYLPWFAIAIPGLGLILFVACSHYQSSARE-IKRLEAVQRSFIYNHLNDVLGGV 987

Query: 303  KTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL---SFLVVLSY-- 357
             TI+++ AE+   +K +  I K      EA+++        +I+ +L   SF +++S   
Sbjct: 988  DTIRAYGAEERFSYKLDYLIDKT----NEASYLYTAVQRWINIVINLVGISFTLIVSLLC 1043

Query: 358  ----------GSWLVFQQQLSVGDLT----AFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403
                       + +V    L + DL       +  TE   N++  L  + +E+ Q A   
Sbjct: 1044 VTKVFNLSGASTGVVLSYVLLIPDLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHG 1103

Query: 404  SRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSN 462
              +               SK  P + GEI+F+NV   Y  R  +P +      KI  G  
Sbjct: 1104 EEV--------------PSKTWP-ENGEIKFENV--RYTHRDGLPAVLDKFTLKIAAGER 1146

Query: 463  VCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSG 522
            V I G +G GKST+   L        G+++ID  D+S L+  +LR  + I+ Q+P+L  G
Sbjct: 1147 VGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQG 1206

Query: 523  TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDT---------------------Y 561
            ++R N+       P  E    V K       + +F  T                      
Sbjct: 1207 SVRHNL------DPFGEYDDDVLKNALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRL 1260

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
            D  +  +G   S G++Q +A+ARALI+  ++L+LDEAT+A+D  ++  +     +  K +
Sbjct: 1261 DQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR 1320

Query: 622  SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFAN 662
              T++ +AHRL TI   + ++VL N G ++     K L  N
Sbjct: 1321 --TVLCVAHRLDTILNYDRILVLEN-GKIIGLDTPKSLLDN 1358

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 113/215 (52%), Gaps = 26/215 (12%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKST----IAWLLLHYYNPSQGQILIDGQDISALSTKS 505
           F +LNF+I +G  + IVGP G GK++    I  L+  Y N  +G++ +DG  +S      
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGSLVSC----- 583

Query: 506 LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAI 565
                      P + + T+RDNI +G  Y  +K   + V + C     + +      T I
Sbjct: 584 ---------GYPWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLSAYDMTEI 632

Query: 566 GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQLMKSKSMT 624
           G  G  LSGGQK RI +AR+L K+  + + D+  SA+D    +  +     + +K+K+  
Sbjct: 633 GERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTRV 692

Query: 625 IVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           + +  H+LS I +++ +IVLGNDG   + G++++L
Sbjct: 693 LAT--HQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 127/249 (51%), Gaps = 22/249 (8%)

Query: 430  GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ 488
            G I+  ++S  Y   P +P + +N+NF +E    V IVG +G GKSTI   +  + +P  
Sbjct: 1352 GRIDVSDLSLRYA--PNLPKVIKNVNFSVEPKLKVGIVGRTGAGKSTIITAMFRFLDPET 1409

Query: 489  GQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK--EEIRSV-- 544
            G + ID  DI+ +    LR+ I I+ Q+P L +GT++  +     Y+  +  E ++ V  
Sbjct: 1410 GFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQIYEALQRVNL 1469

Query: 545  -----------AKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVL 593
                                I +F D  +  +   G  LS GQ+Q + +AR+L++ P ++
Sbjct: 1470 LSDTDINSLSSPSTQSSGENINKFLDL-NNEVTEGGANLSQGQRQLVCLARSLLRSPKII 1528

Query: 594  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
            +LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   + V+V+ + G V E 
Sbjct: 1529 MLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLVM-DAGEVKEY 1585

Query: 654  GKFKELFAN 662
                 L  N
Sbjct: 1586 DHPYSLLLN 1594

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 114/464 (24%), Positives = 200/464 (43%), Gaps = 36/464 (7%)

Query: 207 KVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXXXXXXXXXXXXMGSPL 266
            +G++I+ +  DAF VS     +IS  +   FIGS  + ++              +G  L
Sbjct: 454 NLGEIINLMAVDAFKVS-----EISSYLY-FFIGSFVMVVVSMIFLYRLLGWSALVGVAL 507

Query: 267 LLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQS-----FVAEQSEMHKFNGS 321
           L++      ++      L  VT   T    ++ N  +T+QS     F A ++   K   +
Sbjct: 508 LVAMLPLNYKLAQKLGNLTVVTLGFTDKRIQKLN--ETLQSIRIIKFFAWETNFEKEVQA 565

Query: 322 IRK--IFAVGKEA---AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFM 376
           IR+  +  + K A   + I+  +F  ++I+   SF   + Y    V    ++   L+ F+
Sbjct: 566 IREDELATLLKRAIVWSAISFLWFMVSTIVVSASFACYI-YIQGEVLTIPVAFTALSLFV 624

Query: 377 LYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKN 436
           +      N +  L+   S ++Q   +  RI    D     + T   + +   G  + F+N
Sbjct: 625 MLR----NPLDVLADMLSYVVQSKVSLDRIQAFLDE----DETTKYEQLTISGNRLAFEN 676

Query: 437 VSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILI--- 493
            +  +   P+    RN++ +   G      GP+G GKS++   LL      +G+I +   
Sbjct: 677 ATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSL 736

Query: 494 DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 553
           D ++   +    L   I    Q   L++ T R NI +   Y   ++    V + C     
Sbjct: 737 DPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEACGLKKD 794

Query: 554 ITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--N 611
                    T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N
Sbjct: 795 FEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYEN 854

Query: 612 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
              G LM+ ++  +VS  H ++   R+ + +V+  +G V  QG+
Sbjct: 855 CIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 155/326 (47%), Gaps = 30/326 (9%)

Query: 352  LVVLSYG----SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
            L+VL+ G    S +   +QL+ G +   M Y+    N++  +     +I     +  RI 
Sbjct: 1211 LIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERIL 1270

Query: 408  ELTDLKPRINP----TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463
            E  +L P        T+  K  PA G  I+F + S  Y  +   P+   +N +IE    +
Sbjct: 1271 EYCELPPEPPHEIEETKPEKSWPAHGS-IKFIDYSTKY-RKNLDPVLNKINLEIEPREKI 1328

Query: 464  CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
             IVG +G GKST+   L      + G+I+IDG DIS L    LR ++ I+ Q+     GT
Sbjct: 1329 GIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGT 1388

Query: 524  IRDNITYGLTYT--------------PTKEEI---RSVAKQCFCHNFITRFPDTYDTAIG 566
            IR N+     ++              P  E I   R    +    N   +  +  +  I 
Sbjct: 1389 IRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKIN 1448

Query: 567  PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
             +G+ LS GQ+Q + ++RAL+    +L+LDEAT+++D+E++  I  T       +  TI+
Sbjct: 1449 ENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TIL 1506

Query: 627  SIAHRLSTIRRSENVIVLGNDGSVVE 652
            +IAHR+ T+   + ++VL + G V E
Sbjct: 1507 TIAHRIDTVLGYDKILVL-DKGEVRE 1531

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 113/217 (52%), Gaps = 19/217 (8%)

Query: 450 FRNLN-FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR 507
           F+N+N F++++GS  CIVG  G GK+T+   +L       GQ+  I G   S      +R
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 696

Query: 508 -RHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIG 566
              I    Q+  +M+ ++++NI +G  Y      +    + C     +   PD  +T +G
Sbjct: 697 GNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVG 754

Query: 567 PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKS 622
             G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I     +   L+KSK 
Sbjct: 755 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 813

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            TI+   + +S ++ S+ +  L N   ++E+G + ++
Sbjct: 814 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 848

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 155/326 (47%), Gaps = 30/326 (9%)

Query: 352  LVVLSYG----SWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIF 407
            L+VL+ G    S +   +QL+ G +   M Y+    N++  +     +I     +  RI 
Sbjct: 1239 LIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERIL 1298

Query: 408  ELTDLKPRINP----TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463
            E  +L P        T+  K  PA G  I+F + S  Y  +   P+   +N +IE    +
Sbjct: 1299 EYCELPPEPPHEIEETKPEKSWPAHGS-IKFIDYSTKY-RKNLDPVLNKINLEIEPREKI 1356

Query: 464  CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523
             IVG +G GKST+   L      + G+I+IDG DIS L    LR ++ I+ Q+     GT
Sbjct: 1357 GIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGT 1416

Query: 524  IRDNITYGLTYT--------------PTKEEI---RSVAKQCFCHNFITRFPDTYDTAIG 566
            IR N+     ++              P  E I   R    +    N   +  +  +  I 
Sbjct: 1417 IRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKIN 1476

Query: 567  PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIV 626
             +G+ LS GQ+Q + ++RAL+    +L+LDEAT+++D+E++  I  T       +  TI+
Sbjct: 1477 ENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TIL 1534

Query: 627  SIAHRLSTIRRSENVIVLGNDGSVVE 652
            +IAHR+ T+   + ++VL + G V E
Sbjct: 1535 TIAHRIDTVLGYDKILVL-DKGEVRE 1559

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 113/217 (52%), Gaps = 19/217 (8%)

Query: 450 FRNLN-FKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI-LIDGQDISALSTKSLR 507
           F+N+N F++++GS  CIVG  G GK+T+   +L       GQ+  I G   S      +R
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 724

Query: 508 -RHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIG 566
              I    Q+  +M+ ++++NI +G  Y      +    + C     +   PD  +T +G
Sbjct: 725 GNSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVG 782

Query: 567 PHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFGQ---LMKSKS 622
             G  LSGGQK R+++ARA+  +  + +LD+  SA+D E S+  I     +   L+KSK 
Sbjct: 783 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 841

Query: 623 MTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKEL 659
            TI+   + +S ++ S+ +  L N   ++E+G + ++
Sbjct: 842 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 876

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 117/532 (21%), Positives = 216/532 (40%), Gaps = 77/532 (14%)

Query: 187  LRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAF----IVSRSITQKISDGVKAVFIGSA 242
            L + ++  ++     FF+T  +G +++R  ND +    ++ R+ +Q  S+ VK  F    
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFT--- 1065

Query: 243  GVGMMXXXXXXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNG 301
               ++                S L +  + +  +     ++L  VT + T    +E   G
Sbjct: 1066 ---LVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQETLGG 1122

Query: 302  IKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWL 361
            I TI+ +  E   +H     +    +    +   N         +G +  L   + G + 
Sbjct: 1123 ISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIYR 1182

Query: 362  VFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK---PRINP 418
            + Q  ++ G +   + Y      ++  +     E+     +  RI E ++L    P I  
Sbjct: 1183 LSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIVE 1242

Query: 419  TRGSKFIPAKGGEIEFKNVSFNYPTRPTVP---IFRNLNFKIEQGSNVCIVGPSGKGKST 475
             +       + G ++F +    Y TR       + +++   I+    + IVG +G GKS+
Sbjct: 1243 DKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSS 1298

Query: 476  IAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
            +   L      S+G I +DG +   +    LR  + I+ Q+  +  GT+RDNI     YT
Sbjct: 1299 LTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQYT 1358

Query: 536  PTKEEIRSVAKQCFCHNFITRFP------------------------------------- 558
               EEI    +     + I                                         
Sbjct: 1359 --DEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTSS 1416

Query: 559  -------DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611
                   +  +T +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE++  I 
Sbjct: 1417 GLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQ 1476

Query: 612  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
             T     K++  TI++IAHRL+TI  S+ ++VL       ++G+ KE F +P
Sbjct: 1477 ETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-------DKGEIKE-FDSP 1518

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/409 (23%), Positives = 183/409 (44%), Gaps = 59/409 (14%)

Query: 282 KKLQEVTAN----LTRVSEEQFNGIKTIQSFV-----AEQSEMHKFNGSIRKIFAVGKEA 332
           KKLQ++        TR+  E  N IK+++ +       E+ E  +    ++ +  +G   
Sbjct: 454 KKLQKIQMKNKDERTRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYV 513

Query: 333 AFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGF 392
           AF + +F         + FLV  S  +  V+ Q      LT  +++   T   +FNL  F
Sbjct: 514 AFTHFQF-------NIVPFLVSCSTFAVFVWTQD---RPLTTDLVFPALT---LFNLLSF 560

Query: 393 --------FSEIMQGAGAASRIFEL-------TDLKPRINPTRGSKFIPAKGGEIEFKNV 437
                    +  ++ + + +R+F          D   R+   + +  +  K G+    + 
Sbjct: 561 PMAAIPIMITSFIEASISINRLFSFLTNEELQKDAVQRLPNVKNTGDVSIKLGD----DA 616

Query: 438 SFNYPTRPTVPI-FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQ 496
           +F +  +P   +  +N+NF+  +G   CIVG  G GKS +              IL D  
Sbjct: 617 TFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALI-----------QSILGDLF 665

Query: 497 DISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITR 556
            +   +T  +   +  V Q P +M+GT+++NI +G  +   K+      K C     ++ 
Sbjct: 666 RVKGFAT--VHGDVAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKACALTIDLSI 721

Query: 557 FPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVE-SEGAINYTFG 615
            PD   T +G  G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I +  G
Sbjct: 722 LPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLG 781

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA 664
                 S T V   ++++ +  ++ + +L N G ++++GK++E+ ++P 
Sbjct: 782 PNGLLHSKTKVLATNKITVLNIADYITLLDN-GEIIQRGKYEEVTSDPG 829

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 119/246 (48%), Gaps = 9/246 (3%)

Query: 419 TRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAW 478
           TR  + +     +  F++ S  +    T    +N++   +  S   I+GP+G GKS++  
Sbjct: 638 TRKYEILEQSNTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLL 697

Query: 479 LLLHYYNPSQGQILI---DGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535
            LL   N   G+I +   + +D   +    +   +    Q P L+SGTI+DN+ +G  + 
Sbjct: 698 GLLGELNLLSGKIYVPTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN 757

Query: 536 PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595
             K++   V K C     I        T +G  G  LSGGQ+QRIA+ARA+      LIL
Sbjct: 758 --KQKFDDVMKSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLIL 815

Query: 596 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
           D+  SA+D E+   I      G +MK ++  I S  H +S + +  + +V+ + G V  Q
Sbjct: 816 DDCLSAVDPETALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQ 873

Query: 654 GKFKEL 659
           GK  +L
Sbjct: 874 GKPSDL 879

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 100/452 (22%), Positives = 195/452 (43%), Gaps = 52/452 (11%)

Query: 296 EEQFNGIKTIQSFVAEQSEMHKF----NGSIRKIFAVGKEAAFINAKFFTTASIIGDLSF 351
            E F+ IK I+ F  E + ++      +  +RK+  +    +     ++ T ++I  +SF
Sbjct: 558 NELFSSIKIIKCFTWEDNFINHILRTRDSEVRKMKLISVIWSCNAIIWYLTPTLITSISF 617

Query: 352 LVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIF-----NLSGFFSEIMQGAGAASRI 406
                  ++ +F ++     LTA + +T  +   +       LS   + I+Q   +  RI
Sbjct: 618 -------AYFIFCER---ATLTAPIAFTALSLFGLLKMPLDQLSSTINYIVQSVISLRRI 667

Query: 407 FELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIV 466
               D +P ++  + +  +   G    F   +  +       I  NLN K +      + 
Sbjct: 668 QSFLD-EPDMDKQK-NLLLSKDGTYFMFSGATIGWSINNKGFILENLNVKFKSKKLNVVA 725

Query: 467 GPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKS--------LRRHIGIVQQEPI 518
           GP+G GKS +   LL   +  +G+I      + +L++K         L   I    Q P 
Sbjct: 726 GPTGAGKSLLLMSLLGETHLFKGEI-----HVPSLASKHELMIHGDGLTNSISYCSQIPW 780

Query: 519 LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQ 578
           +++ +I++NI +G  +   +     V + C   N +    D  ++ +G  G  LSGGQ+Q
Sbjct: 781 IINDSIKNNILFGSEFNLKRYN--DVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQ 838

Query: 579 RIAIARALIKKPTVLILDEATSALDVESEGAINYTF---GQLMKSKSMTIVSIAHRLSTI 635
           R+++ARA+  K   +ILD+  SA+D +    I Y     G LMK ++  +VS  H +  +
Sbjct: 839 RVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGRTCILVS--HNVELV 895

Query: 636 RRSENVIVLGNDGSVVEQGKFKELFANPAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEE 695
            +    +++ ++ +   +G   +L  + A              N   E  P + + ++  
Sbjct: 896 IKKAAYLLILDNRTTAYKGPPGDLLKDKALRQRYCKFDF----NELNENCPNQCTTSVVH 951

Query: 696 DPSFSGEATPASSVTGFKAETEAETINEVLKD 727
            P +  E   +SS      +T+++TI + L D
Sbjct: 952 KPDYYLEDRDSSS------KTQSQTILKNLDD 977

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 31/172 (18%)

Query: 327  AVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLT------------- 373
            A G E  FI   F        + SF  +    +WL F+ +L +G +T             
Sbjct: 1212 AFGDELRFIKVIFTRVDEY--NKSFFYLWEANNWLSFRIEL-IGSITILATGLFLLSNAN 1268

Query: 374  ---------AFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLK--PRINPTRGS 422
                      F     +T +A++ +  F++ +     +  R++E T+L+  P        
Sbjct: 1269 MVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEYTNLEQEPYSRCITNV 1327

Query: 423  KFIPAKGGEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGK 473
                   G+I+FKNV+  Y   P +P + +++ F I     + +VG +G GK
Sbjct: 1328 DNQWPNSGDIKFKNVTLRYS--PELPKVLQDVTFVIGDKEKIGVVGRTGAGK 1377

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
            similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 148/349 (42%), Gaps = 24/349 (6%)

Query: 192  IKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMXXXX 251
            +  ++H    F DT  +G +++R   D  I+   +T+ +       F    GV +M    
Sbjct: 959  LHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLR-MFSYQFTVIWGVIIMSIIY 1017

Query: 252  XXXXXXXXXXMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS-EEQFNGIKTIQSFVA 310
                      +    +L +  +    R+  K+L+ V  +    +  E  +G+ TI+++ A
Sbjct: 1018 LPWFAVAVPLLVVVFILVSDHYQCSARE-IKRLEAVQRSFVLNNFNEVISGVDTIKAYHA 1076

Query: 311  EQSEMHKFNGSIRKIFAVGKEAAF-INAKFFTTASIIGDLSFLV-----VLSYGSWLVFQ 364
            E   + K +  I ++     E  F + A     + +IG ++ L      +L    W    
Sbjct: 1077 EARFLKKSDILIDRM----NEMTFPLYASQRWVSILIGMIAVLFALIISILCVTGWF--- 1129

Query: 365  QQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKF 424
              +S       + Y     N    L    +++     +A R+    +  P+  P R  + 
Sbjct: 1130 -NISPASTGVLLTYVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEAPYRIPEM 1188

Query: 425  IPAKG----GEIEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWL 479
             P K     G I F NV+  Y  RP +P + ++++F I  G  + I G +G GKSTI   
Sbjct: 1189 APPKAWPERGAITFDNVALAY--RPGLPLVLQDVSFHISSGEKIGICGRTGAGKSTITNA 1246

Query: 480  LLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528
            L      S G + IDG DI+ +   +LR  + I+ Q+P+L  GTIR N+
Sbjct: 1247 LYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
           F +L+F++++G  + I G  G GK+++   L  + + + G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITRFPDTYDTAIGPH 568
             +    P + + TIRDNIT+G   +P  E + R V + C     ++  P    T +G  
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 569 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI--NYTFGQLMKSKSMTIV 626
           G  LSGGQK RI +AR + K   + + D+  SA+D     +I  +   G+L      T +
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRI 749

Query: 627 SIAHRLSTIRRSENVIVLGNDGS 649
              H++S   ++  VI LG DGS
Sbjct: 750 LATHQISLTEQASRVIYLGTDGS 772

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 10/102 (9%)

Query: 562  DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
            D  +   G+  S G++Q +A+ARAL+++  +LILDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 622  SMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANP 663
              TI+ +AHRL TI   + ++V+       E+G+  E F  P
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-------EKGRVAE-FDTP 1509

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 120/274 (43%), Gaps = 57/274 (20%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I  K  +        I+ ++VSF Y      P+ +++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEEEKSINFKFPDCEKLSPPIIQLQDVSFGY--EENSPLLKDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P++G +           +++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV-----------SRNPRLRIGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +       D++           ++ + A       F  +  + Y   +G  G    
Sbjct: 601 TQHHV-------DSM-----------DLNTSAVDWMSKTFPGKTDEEYRRHLGAFGITGS 642

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P +L+LDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALIDALKNFTGGVLM 702

Query: 619 KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVE 652
            S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 703 VSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 97/196 (49%), Gaps = 21/196 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GKS+I  ++   + P   +        + L +     +I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFFIPQKPYF 688

Query: 520 -MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              GT+RD I Y ++           KE ++ + +    +        TY  AI     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKDL 748

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 632 LSTIRRSENVIVLGND 647
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 21/196 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GKS+I  ++   + P   +        + L +     +I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIADVW-PVYNK--------NGLLSIPSENNIFCIPQKPYF 688

Query: 520 -MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              GT+RD I Y ++           KE ++ +A+    +        TY  A+     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADWKDL 748

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 632 LSTIRRSENVIVLGND 647
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 130/276 (47%), Gaps = 32/276 (11%)

Query: 404 SRIFELTDLKPRINPTRGSKFIPAKG-GEIEFKNVSFNYPT----RPTVPIFRNLNFKIE 458
           + IF LT +       R   F+ +K    + F+N+S+N P+         I +N++  ++
Sbjct: 404 TTIFGLTAVADTSIQGRDDDFLTSKHVAALSFENISYNVPSISDNNSERDILKNVSGIVK 463

Query: 459 QGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ--GQILIDGQDISALSTKSLRRHIGIVQQ- 515
            G  + I+G SG GK+T+  +L          G I I+G+++S    + + + IG V Q 
Sbjct: 464 PGEIMAILGGSGAGKTTLLDILAFKRKSGHVSGDIKINGKNVSR---EIISKMIGFVDQD 520

Query: 516 ----------EPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF-PDTYDTA 564
                     E +L S  +R  +   +T+   ++ +  V ++   +N   R   D ++  
Sbjct: 521 DFLFPTLTVYEAVLNSALLR--LPNSMTFYQKQQRVFQVLEELRIYNIKDRLIGDDFERG 578

Query: 565 IGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT 624
           I       SGG+K+R++IA  L+  P +L LDE TS LD  +   +     +L K+ + T
Sbjct: 579 I-------SGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVVECLVRLAKNYNRT 631

Query: 625 IVSIAHR-LSTIRRSENVIVLGNDGSVVEQGKFKEL 659
           +V   H+  S I    + +VL + G +V  G+ + +
Sbjct: 632 LVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIRRV 667

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 97/196 (49%), Gaps = 21/196 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GKS+I  ++   + P   +        + L +     +I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPPENNIFFIPQKPYF 688

Query: 520 -MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
              GT+RD I Y ++           KE ++ + +    +        TY  A+     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKDL 748

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 632 LSTIRRSENVIVLGND 647
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 126/279 (45%), Gaps = 38/279 (13%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    + P    K    +  E+E        F  +SF Y
Sbjct: 343 AGTYANLVRQAKSRQKILDKMEADGLVQPVVPDKVFSFRFQEVERLPPPVLAFDEISFAY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
              P   ++ NLNF ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 403 DGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC-FCHNFITRFPDT 560
            ++     +G+  Q     S    D     L +   +E+   +++   +    + R+  T
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VREKYSHISQDFQYWRGQLGRYGLT 505

Query: 561 YDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKS 620
            D      GT LS GQ+ R+  A   ++ P +L+LDE T+ LD+ +  ++     + + +
Sbjct: 506 GDGQKAQMGT-LSEGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSL----AEAINT 560

Query: 621 KSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
            +  +V ++H    + + ++++ V+ N      DGS++E
Sbjct: 561 FNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGSILE 599

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 112/272 (41%), Gaps = 64/272 (23%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P  G K +  K  E        I+ ++V+F Y       + +++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGYNENNL--LLKDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P +G +           +++ R  +G  
Sbjct: 552 NLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV-----------SRNPRLRLGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +                     ++ + A +     F  R  + Y   +G  G    
Sbjct: 601 AQHHV------------------DAMDLNASAVEWMSKTFPGRSDEEYRRHLGSFGITGS 642

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P VLILDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFTGGVLM 702

Query: 619 KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
                    ++H +S I    N I +  DGS 
Sbjct: 703 ---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 94/197 (47%), Gaps = 19/197 (9%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GK++I  ++   +       L        LS  + R  I I Q+   +
Sbjct: 601 GSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGL--------LSVPAERELICIPQKPYFI 652

Query: 520 MSGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTLL 572
             GT R+ I Y ++           +E+  V K+      + R     Y  A+     +L
Sbjct: 653 QGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDVL 712

Query: 573 SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 632
           SGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K      ++I+ R 
Sbjct: 713 SGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQRP 768

Query: 633 STIRRSENVIVLGNDGS 649
           S I+  +  + +G D S
Sbjct: 769 SLIKYHDLALEIGADES 785

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 96/196 (48%), Gaps = 21/196 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+  GKS+I  ++   + P   +        + L +     +I  + Q+P  
Sbjct: 638 GSSLLILGPNSCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFCIPQKPYF 688

Query: 520 MSG-TIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITR-FPDTYDTAIGPHGTL 571
             G T+RD I Y ++           +E+  +  +      + R    TY  A+     L
Sbjct: 689 SKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTYLDAVADWKDL 748

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 632 LSTIRRSENVIVLGND 647
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 104/249 (41%), Gaps = 55/249 (22%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I  K  +        I+ ++VSF Y   P   + +++
Sbjct: 498 AQSRIKKLEKL-PVLEPPEEEKTISFKFPDCEKLSPPIIQLQDVSFGYD--PESLLLKDV 554

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P++G +  +G           R  IG  
Sbjct: 555 NLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFVSRNG-----------RLRIGYF 603

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +      +  + +  T  P K +                  + Y   +G  G    
Sbjct: 604 TQHHVDSLDLTKSAVDWMSTAYPGKND------------------EEYRRHLGSFGITGS 645

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDE-----ATSALDVESEGAINYTFGQLM 618
                  LLSGGQK R+A A   +  P +L+LDE      TS LD   +   N++ G LM
Sbjct: 646 LGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLDALEDSLKNFSGGVLM 705

Query: 619 KSKSMTIVS 627
            S  ++I+ 
Sbjct: 706 VSHDISIID 714

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 113/232 (48%), Gaps = 14/232 (6%)

Query: 432 IEFKNVSFNYPTRPTVP-IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ-- 488
           + F+N+++N  +  T   I + ++  I+ G  + ++G SG GK+T+  +L       Q  
Sbjct: 377 LSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVT 436

Query: 489 GQILIDGQDISALSTKSLRRHIGIVQQEPILM-SGTIRDNI-TYGLTYTPTKEEIRSVAK 546
           G I ++G DI     K   + IG V Q+  L+ + T+ + +    L   P        AK
Sbjct: 437 GSIKVNGSDIP---RKDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLP--RSFSFAAK 491

Query: 547 QCFCHNFIT--RFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALD 603
           Q   +  +   R  D  D  IG      +SGG+K+R++IA  L+  P +L LDE TS LD
Sbjct: 492 QTRVYQVLEELRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLD 551

Query: 604 VESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVEQG 654
             +   +     +L K+ + T+V SI    S I +  + +VL ++G +V  G
Sbjct: 552 ANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSG 603

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 112/242 (46%), Gaps = 31/242 (12%)

Query: 432 IEFKNVSFNYP----TRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS 487
           + F+N+S++ P    ++    +  ++   ++ G  + I+G SG GK+T+  +L       
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 488 --QGQILIDGQDISALSTKSLRRHIGIVQQ-----------EPILMSGTIRDNITYGLTY 534
             QG I ++G  I     K   + IG V Q           E +L S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSIL---NKLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 535 TPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVL 593
           T  ++ +  V ++        R  D  D  IG      +SGG+K+R++IA  L+  P +L
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 594 ILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVE 652
            LDE TS LD  +   +     +L K+ + T+V SI    S I    + +VL +DG ++ 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 653 QG 654
            G
Sbjct: 624 SG 625

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 90/190 (47%), Gaps = 19/190 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+  GKS+I  +L   +       L+     S L        + I Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDL--------MCIAQRPYFI 649

Query: 520 MSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTLL 572
             GT RD I Y ++     E      E+  + K+      + R    +Y   +     +L
Sbjct: 650 QGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWKDIL 709

Query: 573 SGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 632
           SGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    +SI+ R 
Sbjct: 710 SGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISISQRP 765

Query: 633 STIRRSENVI 642
           S I+  + ++
Sbjct: 766 SLIKYHDYLL 775

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 95/198 (47%), Gaps = 20/198 (10%)

Query: 459 QGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPI 518
           Q S++ I+GP+G GKS+I  ++   +       L+   D S+L        + I Q+   
Sbjct: 639 QASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSL--------LCIPQKPYF 690

Query: 519 LMSGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTL 571
              GT RD I Y ++           + +  +  +      + R P  +Y   +     +
Sbjct: 691 TRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKDV 750

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  L K +  + ++I+ R
Sbjct: 751 LSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FSFITISQR 806

Query: 632 LSTIRRSENVIVLGN-DG 648
            S I+  + ++ + + DG
Sbjct: 807 PSLIKYHDMLLEIADRDG 824

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 109/253 (43%), Gaps = 55/253 (21%)

Query: 398 QGAGAASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPI 449
           + + A SRI +L  L P + P    K I  K  +        I+ ++VSF Y   P   +
Sbjct: 491 KSSEAQSRIKKLEKL-PVLEPPEQEKSIDFKFPDCEKLSPPIIQLQDVSFGYS--PDKLL 547

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
            +++N  I+  S + +VG +G GK+T+  ++L    P  G +           +++ R  
Sbjct: 548 LKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV-----------SRNPRLR 596

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG 569
           IG   Q  +       D++           ++ + A       F  +  + Y   +G  G
Sbjct: 597 IGYFTQHHV-------DSM-----------DLSTSAVDWMSKTFPGKTDEEYRRHLGSFG 638

Query: 570 ----------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTF 614
                      LLSGGQK R+A A   +  P +LILDE ++ LD     A+     N+T 
Sbjct: 639 ITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGIDALVDAMKNFTG 698

Query: 615 GQLMKSKSMTIVS 627
           G LM S  +++++
Sbjct: 699 GILMVSHDISVIN 711

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 98/223 (43%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    + P    +    +  E+E        F  +SF+Y
Sbjct: 342 AGTYANLVKQAKSRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSY 401

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +P   ++ NLNF ++  S V +VGP+G GKST+  ++     P  G++          
Sbjct: 402 DEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV---------- 451

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 452 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYGHISEDFQ-YWRGQLGRYGLTG 505

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +      GT LS GQ+ R+  A   + +P VL+LDE T+ LD+
Sbjct: 506 EGQTVQMGT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 100/223 (44%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    K    +  ++E        F ++SF+Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLIQPVAPDKIFSFRFPQVERLPPPVLAFDDISFHY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
            + P+  ++ +LNF ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 403 ESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q F    + R+  T 
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-FWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +       T LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 507 EGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 124/289 (42%), Gaps = 69/289 (23%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K +     E        I+ ++VSF Y  +    + +++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEEDKSVTFHFPECEKLSPPIIQLQDVSFGYDEKNL--LLKDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P QG +  +G           R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYVSRNG-----------RLRIGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +       D++           ++ + A       F  +  + Y   +G  G    
Sbjct: 601 TQHHV-------DSM-----------DLTTSAVDWMSKTFPGKNDEEYRRHLGAFGITGS 642

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P +LILDE ++ LD     A+     N++ G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGLDALIDALKNFSGGVLM 702

Query: 619 KSKSMTIV-SIAHRL-----STIRR--------SENVIVLGNDGSVVEQ 653
            S  ++++ S+ + +      T+++         +++I L ND  VV++
Sbjct: 703 VSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHIISLANDAGVVKK 751

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 25/197 (12%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHY---YNPSQGQILIDGQDISALSTKSLRRHIGIVQQE 516
           GS++ I+GP+  GKS+I  +L      YN +             LST        + Q+ 
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKN-----------GLLSTPPSHDLFCVPQRP 663

Query: 517 PILMSGTIRDNITYGLTYTPTKEE------IRSVAKQCFCHNFITRFPD-TYDTAIGPHG 569
             +  GT RD I Y +TY    E       +  + ++      + R     Y  AI    
Sbjct: 664 YFIQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKRDRGLNYFDAIADWK 723

Query: 570 TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 629
            +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  +      ++K      +SI+
Sbjct: 724 DVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL----FTMLKRYRFNFISIS 779

Query: 630 HRLSTIRRSENVIVLGN 646
            R S I+  + ++ L N
Sbjct: 780 QRPSLIKYHDYLLELTN 796

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 104/244 (42%), Gaps = 33/244 (13%)

Query: 414 PRINPTRGSKFI--------PAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI 465
           P  N  +G+K I        P   GE++  N      + P        N  +  GS++ I
Sbjct: 550 PSPNGLKGAKLISKLKFQIPPVLAGELKKAN------SAPASSNLTQANVLLGPGSSLLI 603

Query: 466 VGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIR 525
           +GP+  GKS+I  ++         +I         LS  S    + I Q+   +  GT R
Sbjct: 604 LGPNSCGKSSIQRII--------AEIWPIYNKTGLLSIPSESDMMCIAQRPYFIQGGTFR 655

Query: 526 DNITYGLTYTPTKE------EIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTLLSGGQKQ 578
           D I Y +      E      E+  V K+      + R     Y   +     +LSGG+KQ
Sbjct: 656 DQIIYPMFVDTFYEKGHKDRELVRVLKEVKLDYLLKRADALNYLDHVADWKDVLSGGEKQ 715

Query: 579 RIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 638
           R+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +    +SI+ R S I+  
Sbjct: 716 RMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNFISISQRPSLIKYH 771

Query: 639 ENVI 642
           + ++
Sbjct: 772 DYLL 775

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 125/278 (44%), Gaps = 36/278 (12%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    + P    K    +  ++E        F ++SF+Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
            + P+  ++ +LNF ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 403 ESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q F    + R+  T 
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-FWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
           +       T LS GQ+ R+  A   +++P VL+LDE T+ LD+ +  ++     +     
Sbjct: 507 EGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---- 561

Query: 622 SMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
           +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 562 NGGVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQ 599

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 98/232 (42%), Gaps = 52/232 (22%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           I+ ++VSF +   P+  + +++N  ++  S + IVG +G GK+T+  +L+    P QG  
Sbjct: 532 IQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQG-- 587

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 551
                                V + P L        + Y   +     ++ + A     +
Sbjct: 588 --------------------YVSRNPRL-------RVAYFTQHHVDSMDLNASAVDWMSN 620

Query: 552 NFITRFPDTYDTAIGPHG----------TLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
            F  R  + Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 602 LDVESEGAI-----NYTFGQLMKSKSMTIVS-IAHRL-----STIRRSENVI 642
           LD     A+      +T G LM S  ++++  + + +      T+RR E  I
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGVCNEIWVSENGTVRRFEGTI 732

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 85/174 (48%), Gaps = 19/174 (10%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           + F ++SF+Y + P+  ++ NLNF ++  S + +VGP+G GKST+  ++     P  G++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC-FC 550
                      ++     +G+  Q     S    D     L +   +++  SV++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPSVSQDFQYW 495

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
              + R+  T +       T LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 100/223 (44%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    + P    K    +  ++E        F ++SF+Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
            + P+  ++ +LNF ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 403 ESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q F    + R+  T 
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-FWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +       T LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 507 EGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 117/266 (43%), Gaps = 41/266 (15%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    + I  K  E        I+ ++VSF Y  +    +  ++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEEERSISFKFPECEKLSPPIIQLQDVSFGYNEKNL--LLADV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P +G +  +G           R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYVSQNG-----------RLRIGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTP--TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL 571
            Q  +      +  + +  T  P  T EE R           +  F  T   ++     L
Sbjct: 601 TQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR---------RHLGAFGITGSLSLQKM-QL 650

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLMKSKSMTIV 626
           LSGGQK R+A A   +  P +LILDE ++ LD     A+      +T G LM S  ++++
Sbjct: 651 LSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGIDALVDAMKKFTGGILMVSHDISVI 710

Query: 627 SIAHRLSTIRRSENVIVLGNDGSVVE 652
           S  +  + I  SEN  V   DG++ +
Sbjct: 711 S--NVCNEIWVSENGTVKRFDGTIYD 734

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 118/278 (42%), Gaps = 57/278 (20%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I  K  +        I+ ++VSF Y    +  + +++
Sbjct: 496 AQSRIKKLEKL-PVLEPPEEEKSITFKFADCEKLSPPIIQLQDVSFGYD--ESQLLLKDV 552

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P  G +           +++ R  IG  
Sbjct: 553 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV-----------SRNPRLRIGYF 601

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  I       D++           ++ + A       F  +  + Y   +G  G    
Sbjct: 602 TQHHI-------DSM-----------DLNASAVDWMSKTFPGKTDEEYRRHLGAFGITGS 643

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P +LILDE ++ LD     A+     N++ G LM
Sbjct: 644 LGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGLDALVQALKNFSGGVLM 703

Query: 619 KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKF 656
            S  ++++        I  SE+  V   DG++ +  K+
Sbjct: 704 VSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 4/62 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 632 LS 633
            S
Sbjct: 425 RS 426

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 99/223 (44%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P +  K    +   +E        F ++SF+Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLIQPVQADKVFSFRFPPVERLPPPVLAFDSISFSY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
              P   ++ NL+F ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 403 DGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPNISQDFQ-YWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 507 EGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 123/270 (45%), Gaps = 40/270 (14%)

Query: 421 GSKFIPAK-GGEIEFKNVSFNYPT---------RPTVPIFRNLNFKIEQGSNVCIVGPSG 470
           G  F+ ++    + F+N+++  P+            V + ++++  ++ G    I+G SG
Sbjct: 378 GDNFLKSETSATLSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSG 437

Query: 471 KGKSTIAWLLLHYYNPSQ--GQILIDGQDISALSTKSLRRHIGIVQQ-----------EP 517
            GK+T+  +L       Q  G+I ++G   + +S KS  + IG V Q           E 
Sbjct: 438 AGKTTLLDILAMKRKTGQVGGEIKVNG---NIMSRKSYSKLIGFVDQNDYLHPTLTVYET 494

Query: 518 ILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQ 576
           +L S  +R  +   +++   +  +  + ++        R  D  D  IG      +SGG+
Sbjct: 495 VLNSALLR--LPRTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERGISGGE 545

Query: 577 KQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTI 635
           K+R++IA  L+  P +L LDE TS LD  +   +  +  +L K+ + T++   H+  S I
Sbjct: 546 KRRVSIACELVTSPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNI 605

Query: 636 RRSENVIVLGNDGSVVEQG---KFKELFAN 662
               N +VL + G +V  G   K  E   N
Sbjct: 606 FNQFNKLVLLSQGEMVFSGDSIKIHEFLYN 635

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 100/213 (46%), Gaps = 27/213 (12%)

Query: 445 PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTK 504
           P VP+  +       G+++ I+GP+  GKS+I  ++   +       L+    I A S  
Sbjct: 622 PNVPLIDS------TGASLLILGPNSCGKSSIQRIITEVWPVYNKNGLLS---IPAPS-- 670

Query: 505 SLRRHIGIVQQEPILM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITR- 556
               ++  V Q P     GT RD I Y ++           + +  + K+      + R 
Sbjct: 671 ----NLFCVPQRPYFTRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDRE 726

Query: 557 FPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQ 616
              +Y  A+     +LSGG+KQR+  AR L  +P  ++LDEAT+A+ V+ E   +Y F  
Sbjct: 727 IGCSYMDAVADWKDVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLF-N 782

Query: 617 LMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGS 649
           L+K      ++I+ R S I+  + ++ + + GS
Sbjct: 783 LLKRYRFNFITISQRPSLIKYHDMLLEVDSSGS 815

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 116/277 (41%), Gaps = 61/277 (22%)

Query: 380 EYTGNAIF--NLSGFFSEIMQGAG----AASRIFELTDLKPRINPTRGSKFIPAKGGE-- 431
           EY    ++  +L  F  +    A     A SRI +L  L P + P    K I  K  E  
Sbjct: 467 EYDNQMVYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKL-PVLEPPEQDKIIDFKFPECD 525

Query: 432 ------IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
                 I+ ++VSF Y  +    + +++N  ++  S + +VG +G GK+T+  +++    
Sbjct: 526 KLSPPIIQLQDVSFGYDEKNL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLR 583

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           P +G +           +++ R  IG   Q  +       D++           ++ + A
Sbjct: 584 PLKGFV-----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSA 614

Query: 546 KQCFCHNFITRFPDTYDTAIGPHG----------TLLSGGQKQRIAIARALIKKPTVLIL 595
                 +F  +  + Y   +G  G           LLSGGQK R+A A   +  P +L+L
Sbjct: 615 VDWMSKSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVL 674

Query: 596 DEATSALDVESEGAI-----NYTFGQLMKSKSMTIVS 627
           DE ++ LD     A+     N+  G LM S  ++++ 
Sbjct: 675 DEPSNHLDTTGLDALVDALKNFNGGVLMVSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.366
           YFR009W
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 105/248 (42%), Gaps = 53/248 (21%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I  K  +        I+ ++V F Y  +    +  ++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEEEKSISFKFPDCEKLSPPIIQLQDVDFGYDNKEL--LLNDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  I+  S + +VG +G GK+T+  +++    P +G +  +G           R  IG  
Sbjct: 552 NLDIQMDSRIALVGANGCGKTTLLKVMMEQLRPVKGYVSRNG-----------RLRIGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTP--TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT- 570
            Q  +      +  + +  T  P  T EE R                  +  A G  G+ 
Sbjct: 601 TQHHVDSMDLDKSAVDWMSTAFPGKTDEEYRR-----------------HLGAFGITGSL 643

Query: 571 ------LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLMK 619
                 LLSGGQK R+A A   ++ P +L+LDE ++ LD     A+     N+T G LM 
Sbjct: 644 SLQKIQLLSGGQKSRVAFAALCLENPHILVLDEPSNHLDTAGIDALVDALKNFTGGVLMV 703

Query: 620 SKSMTIVS 627
           S  ++++ 
Sbjct: 704 SHDISVID 711

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTVLTVSH 422

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 93/198 (46%), Gaps = 21/198 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GK++I  ++   +       L+     S L           V Q+P  
Sbjct: 600 GSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC---------VPQKPYF 650

Query: 520 MSG-TIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTL 571
           + G T R+ I Y ++           +E+  +  +      + R     Y  A+     +
Sbjct: 651 IQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKDV 710

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K      ++I+ R
Sbjct: 711 LSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITISQR 766

Query: 632 LSTIRRSENVIVLGNDGS 649
            S I+  +  + +  DG+
Sbjct: 767 PSLIKYHDLALDISTDGT 784

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 86/177 (48%), Gaps = 25/177 (14%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           + F ++SF+Y   P   ++  LNF ++  S + +VGP+G GKST+  ++     P  G++
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP---TKEEIRSVAKQC 548
                      ++     +G+  Q         +D +   LT +P    +++  ++++  
Sbjct: 451 -----------SRHTHVKLGVYSQHS-------QDQLD--LTKSPLEFVRDKYPNISQDF 490

Query: 549 -FCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
            +    + R+  T +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 491 QYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 99/202 (49%), Gaps = 21/202 (10%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPIL 519
           GS++ I+GP+G GKS+I  ++   + P   +        + L +K    ++  V Q+P  
Sbjct: 644 GSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSKPTEANLLCVPQKPYF 694

Query: 520 M-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITRFPD-TYDTAIGPHGTL 571
              GT+RD I Y ++           + +  V ++      + R    +Y   +     +
Sbjct: 695 TRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKRDKGWSYLDTVSDWKDV 754

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 631
           LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K      ++I+ R
Sbjct: 755 LSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKRYRFNFITISQR 810

Query: 632 LSTIRRSENVIVLGNDGSVVEQ 653
            S I+  + ++ + +D S + Q
Sbjct: 811 PSLIKYHDLLLEISDDNSGLWQ 832

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 29/203 (14%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLHY---YNPSQGQILIDGQDISALSTKSLRRHIGIVQQE 516
           GS++ I+GP+  GK++I  ++      YN + G + +  Q+           +I  + Q 
Sbjct: 665 GSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQE-----------NIFCIPQR 712

Query: 517 PILMS-GTIRDNITYGLTYTPTKEE------IRSVAKQCFCHNFITRFPD-TYDTAIGPH 568
           P   S GT+RD I Y ++     +       +  + K+      + R    TY   +   
Sbjct: 713 PYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLKYLMKRSKGLTYLDTVADW 772

Query: 569 GTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 628
             LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E   +Y F  ++K      ++I
Sbjct: 773 KDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---DYLFN-ILKKYRFNFITI 828

Query: 629 AHRLSTIRRSENVIVLG--NDGS 649
           + R S I+  + ++ +   NDG+
Sbjct: 829 SQRPSLIKYHDLLLEISDHNDGT 851

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 102/228 (44%), Gaps = 43/228 (18%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           I+ ++VSF+Y  + + P+  ++N  ++  S + +VG +G GK+T+  +++    P++G +
Sbjct: 532 IQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGFV 589

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP--TKEEIRSVAKQCF 549
                      +++ R  IG   Q  +      +  + +  T  P  T EE R       
Sbjct: 590 -----------SRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRR------ 632

Query: 550 CHNFITRFPDTYDTAIGPHGTL-------LSGGQKQRIAIARALIKKPTVLILDEATSAL 602
                      +  A G  G+L       LSGGQK R+A A   +  P +L+LDE ++ L
Sbjct: 633 -----------HLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHL 681

Query: 603 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
           D     A+       +KS +  ++ ++H +S I    N I +   G V
Sbjct: 682 DTAGLDAL----VDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 422

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 118/275 (42%), Gaps = 55/275 (20%)

Query: 398 QGAGAASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPI 449
           + + A SRI +L  L P + P    K I  K  +        I+ ++VSF Y  +    +
Sbjct: 490 KSSEAQSRIKKLEKL-PVLEPPEEDKSIHFKFPDCENLSPPIIQLQDVSFGYDEKNL--L 546

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
            +++N  ++  S + +VG +G GK+T+  ++++   P +G +  +G           R  
Sbjct: 547 LKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYVSSNG-----------RLR 595

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTP--TKEEIRSVAKQCFCHNFITRFPDTYDTAIGP 567
           IG   Q  +      +  + +     P  T EE R                  +  + G 
Sbjct: 596 IGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYRR-----------------HLGSFGI 638

Query: 568 HGTL-------LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFG 615
            GTL       LSGGQK R+A A   +  P +L+LDE ++ LD     A+     N++ G
Sbjct: 639 TGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLDALVESLKNFSGG 698

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
            LM S  ++++    +   I  SEN  V   DG++
Sbjct: 699 VLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTI 731

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 126/284 (44%), Gaps = 48/284 (16%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    K    +  E+E        F ++SF Y
Sbjct: 340 AGTYANLVRQAKSRQKILDKMEADGLIEPVVPDKVFSFRFPEVERLPPPVLAFDDISFAY 399

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +P   ++ +LNF ++  S V +VGP+G GKST+  ++        G++          
Sbjct: 400 DGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV---------- 449

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF------IT 555
            ++     +G+  Q         +D +   LT +P  E +R        H+F      + 
Sbjct: 450 -SRHTHVKLGVYSQHS-------QDQLD--LTKSPL-EFVRDKYSH-ISHDFQYWRGQLG 497

Query: 556 RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFG 615
           R+  T +       T LS GQ+ R+  A   ++ P VL+LDE T+ LD+ +  ++     
Sbjct: 498 RYGLTGEGQTSQMAT-LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLADAIN 556

Query: 616 QLMKSKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
           +     +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 557 EF----NGGVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSILD 596

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 258

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 124/278 (44%), Gaps = 36/278 (12%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P +  K    +   +E        F ++SF+Y
Sbjct: 342 AGTYANLVKQAKSRQKILDKMEADGLIQPVQQDKVFSFRFPPVERLPPPVLAFDSISFSY 401

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
              P   ++ NL+F ++  S + +VGP+G GKST+  ++     P  G++          
Sbjct: 402 DGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV---------- 451

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 452 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPNISQDFQ-YWRGQLGRYGLTG 505

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
           +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+ +  ++     +     
Sbjct: 506 EGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF---- 560

Query: 622 SMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
           +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 561 NGGVVVVSHDFRLLDKIAKDIFVVENRTATRWDGSILQ 598

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON}
           (76084..76926) [843 nt, 281 aa]
          Length = 280

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 101/227 (44%), Gaps = 11/227 (4%)

Query: 436 NVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDG 495
           N+S+ +P    VP   ++N ++   +   +VG +G GKST+  LL   +    G++L++G
Sbjct: 12  NLSYTFP-ESEVPSLVDINLEVPWNTRTLVVGCNGAGKSTLLRLLSGKHLCRNGELLVNG 70

Query: 496 QD-ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCF---CH 551
            D  + +S    R+    VQ    L  GT   ++T         E + S+  + +   C 
Sbjct: 71  LDPFAPISLTKKRQEDVDVQTTTYL--GTEWCHMTIINRDIGVTELLNSIGMKVYQERCD 128

Query: 552 NFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611
             +    D  D  +      LS GQK+R+ +A  L+K   +L+LDE T  LDV     + 
Sbjct: 129 TLV----DILDIDLNWRMHRLSDGQKRRVQLAMGLLKPWRILLLDEVTVDLDVICRSRLL 184

Query: 612 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKE 658
                  +S+  +++   H    +    N I+  + G +V    +K+
Sbjct: 185 NFLKFETESRKCSVIYATHIFDGLANWPNRILHMDYGKIVSDVDYKK 231

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 114/277 (41%), Gaps = 61/277 (22%)

Query: 380 EYTGNAIF--NLSGFFSEIMQGAG----AASRIFELTDLKPRINPTRGSKFIPAKGGE-- 431
           EY    ++  +L  F  +    A     A SRI +L  L P + P    K I  K  E  
Sbjct: 467 EYDNQMVYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKL-PVLEPPEQDKTIDFKFPECD 525

Query: 432 ------IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
                 I+ ++VSF Y       + +++N  ++  S + +VG +G GK+T+  +++    
Sbjct: 526 KLSPPIIQLQDVSFGYDENNL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLR 583

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           P +G +           +++ R  IG   Q  +       D++           ++ + A
Sbjct: 584 PLKGFV-----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSA 614

Query: 546 KQCFCHNFITRFPDTYDTAIGPHG----------TLLSGGQKQRIAIARALIKKPTVLIL 595
                 +F  +  + Y   +G  G           LLSGGQK R+A A   +  P +L+L
Sbjct: 615 VDWMSKSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVL 674

Query: 596 DE-----ATSALDVESEGAINYTFGQLMKSKSMTIVS 627
           DE      T+ LD   E   N+  G LM S  ++++ 
Sbjct: 675 DEPSNHLDTTGLDALVEALKNFNGGVLMVSHDISVID 711

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 85/174 (48%), Gaps = 19/174 (10%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           + F N+SF Y   P   ++ NL+F ++  S + +VGP+G GKST+  ++        GQ+
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGQL 443

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQC-FC 550
           +     +S    +     +G+  Q     S    D     L +   +++  S+++   + 
Sbjct: 444 MAQAGRVS----RHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSSISQDFQYW 493

Query: 551 HNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
              + R+  T ++     GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 494 RGQLGRYGLTGESQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 107/249 (42%), Gaps = 55/249 (22%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K +  K  E        I+ ++V F Y       + R++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEQDKTVDFKFPECDKLSPPIIQLQDVFFGYNENNL--LLRDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +++    P++G +           +++ R  IG  
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPTKGFV-----------SRNPRLRIGYF 600

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +       D++           ++ + A     ++F  +  + Y   +G  G    
Sbjct: 601 TQHHV-------DSM-----------DLTTSAVDWMSNSFPGKTDEEYRRHLGSFGITGT 642

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P +L+LDE ++ LD     A+     N+  G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVDALKNFNGGVLM 702

Query: 619 KSKSMTIVS 627
            S  ++++ 
Sbjct: 703 VSHDISVID 711

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   TI++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPNTILTVSH 422

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 99/234 (42%), Gaps = 55/234 (23%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           I+ ++VSF Y  +    + +++N  ++  S + +VG +G GK+T+  +++    P+ G +
Sbjct: 532 IQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 551
             +G           R  IG   Q  +       D++           ++ + A      
Sbjct: 590 SRNG-----------RLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 552 NFITRFPDTYDTAIGPHG----------TLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
            +  +  + Y   +G  G           LLSGGQK R+A A   +  P +L+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 602 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
           LD     A+      +T G LM         ++H +S I    N I +  DG+V
Sbjct: 681 LDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNV 725

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 111/241 (46%), Gaps = 29/241 (12%)

Query: 432 IEFKNVSFNYPTR--PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ- 488
           + FK++ +  P     +  +   ++  ++ G  + ++G SG GK+T+  +L       + 
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 489 -GQILIDGQDISALSTKSLRRHIGIVQQ-----------EPILMSGTIRDNITYGLTYTP 536
            GQI ++G+ IS    K   + IG V Q           E +L S  +R  +   L +  
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLIL 595
            +  +  V ++        R  D  D  IG      +SGG+K+R++IA  L+  P +L L
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFL 563

Query: 596 DEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           DE TS LD  +   +     +L ++   T+V SI    S I +  + +VL ++G +V  G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 655 K 655
           +
Sbjct: 624 E 624

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 101/218 (46%), Gaps = 14/218 (6%)

Query: 449  IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--QGQILIDGQDISALSTKSL 506
            I  N++  ++ G+   ++G SG GK+T+  +L +        G I +DG     L   S 
Sbjct: 860  ILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRDTSF 915

Query: 507  RRHIGIVQQEPIL-MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFP-DTY-DT 563
            +R  G  QQ+ +   + T+RD + +   Y    + I    K  +  + I     + Y D 
Sbjct: 916  QRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEKNAYVEDIIKLLGMEAYADA 974

Query: 564  AIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGAINYTFGQLMKSKS 622
             +G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     +L+    
Sbjct: 975  VVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

Query: 623  MTIVSIAHRLSTIRRSE--NVIVLGNDGSVVEQGKFKE 658
              + +I H+ S I   E   +++L N G  V  G   E
Sbjct: 1035 AILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009W
           (GCN20) - 1:1 [contig 265] FULL
          Length = 752

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 100/249 (40%), Gaps = 55/249 (22%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I     E        I+ ++VSF +   P   + +++
Sbjct: 495 AQSRIKKLEKL-PVLEPPEEEKNIDFHFPECEKLSPPIIQLQDVSFGFD--PKQLLLKDV 551

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           N  ++  S + +VG +G GK+T+  +L+    P QG                       V
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKILMEQLRPIQG----------------------YV 589

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            + P L        + Y   +     ++ + A       F  +  + Y   +G  G    
Sbjct: 590 SRNPRL-------RVAYFTQHHVDSMDLNTSAVDWMSTTFPGKTDEEYRRHLGAFGITGS 642

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P +L+LDE ++ LD     A+      +T G LM
Sbjct: 643 LGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALMDALKKFTGGVLM 702

Query: 619 KSKSMTIVS 627
            S  ++++ 
Sbjct: 703 VSHDISVID 711

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 120/278 (43%), Gaps = 36/278 (12%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I      +    +  E+E        F  +SF+Y
Sbjct: 340 AGTYANLVKQAKSRQKILDKMEADGLIQAVVADRVFSFRFPEVERLPPPVLAFDEISFSY 399

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
              P   ++  LNF ++  S   +VGP+G GKST+  ++     P  G++          
Sbjct: 400 DGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV---------- 449

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q F    + R+  T 
Sbjct: 450 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYAHISEDFQ-FWRGQLGRYGLTG 503

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
           +       T LS GQ+ R+  A   +++P VL+LDE T+ LD+ +  ++       + + 
Sbjct: 504 EAQTAQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL----ADAIDAF 558

Query: 622 SMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
           +  +V ++H    + R ++++ V+ N      DGS+++
Sbjct: 559 NGGVVVVSHDFRLLDRIAKDIYVVENKTATRWDGSILD 596

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1.427
           YCR011C
          Length = 1057

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 113/235 (48%), Gaps = 17/235 (7%)

Query: 432 IEFKNVSFNYPT----RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLL--HYYN 485
           + F+N+S+  P+         + +N++  ++ G  + I+G SG GK+T+  +L   +   
Sbjct: 396 LSFENISYRVPSLHDSNNHENVLKNVSGIVKPGQMLAIMGGSGAGKTTLLDILAMKNKTG 455

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSG-----TIRDNITYGLTYTPTKEE 540
             QG I ++G   S++S K   + +G V Q+  L+       T+ ++    L  + + E 
Sbjct: 456 SVQGNIKVNG---SSISKKDYSKVVGFVDQDDYLLPTLTVYETVLNSALLKLPRSMSFEA 512

Query: 541 IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600
            RS   Q      I    D    +    G  +SGG+K+R++IA  L+  P +L LDE TS
Sbjct: 513 KRSRVYQVLEELRIIDIKDRIIGSDFKRG--ISGGEKRRVSIACELVTSPLILFLDEPTS 570

Query: 601 ALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVEQG 654
            LD  +   +     +L K+ + T+V SI    S I    + ++L ++G +V  G
Sbjct: 571 GLDANNANNVVECLVRLAKAYNRTLVLSIHQPRSNIFNLFDKLILLSEGEMVYSG 625

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 114/251 (45%), Gaps = 32/251 (12%)

Query: 432 IEFKNVSFNYPTRP----TVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS 487
           + F+N++  Y   P    T  +   +   ++ G  + I+G SG GK+T+  +L       
Sbjct: 370 LTFENIT--YEVSPAKNVTADVLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTG 427

Query: 488 Q--GQILIDGQDISALSTKSLRRHIGIVQQEPILM-SGTIRDNITYG--------LTYTP 536
           +  G I ++G DI         + IG V QE  L+ + T+ + +           L+++ 
Sbjct: 428 KVTGSIKVNGVDIDK---DKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSA 484

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGP-HGTLLSGGQKQRIAIARALIKKPTVLIL 595
            +  +  V ++        R  D  D  IG  +   +SGG+K+R++IA  L+  P VL L
Sbjct: 485 KQRRVYDVLEE-------LRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFL 537

Query: 596 DEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           DE TS LD  +   +     +L    + T+V SI    S+I +  + +VL ++G +V  G
Sbjct: 538 DEPTSGLDANNANNVIECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSG 597

Query: 655 ---KFKELFAN 662
              K  E   N
Sbjct: 598 DAHKVNEFLKN 608

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 107/231 (46%), Gaps = 20/231 (8%)

Query: 419  TRGSKFIPAKGGEIEFKNVSFNYPTRP-TVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIA 477
            T G++ + ++     ++N+ ++ P +  T  +  N++  ++ G+   ++G SG GK+T+ 
Sbjct: 839  TNGARLLKSQA-VFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLL 897

Query: 478  WLLLHYYNPS--QGQILIDGQDISALSTKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTY 534
              L          G +L+DG+       +S  R IG  QQ+ + L + T+R+++ +   Y
Sbjct: 898  DCLAERVTMGVITGDVLVDGRP----RDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AY 952

Query: 535  TPTKEEIRSVAKQCFCHNFIT--RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTV 592
                 E+    K  +    I         D  +G  G  L+  Q++R+ I   L  KP +
Sbjct: 953  LRQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKL 1012

Query: 593  LI-LDEATSALDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE 639
            L+ LDE TS LD ++  +I     QLM+   S    I+   H+ S I   E
Sbjct: 1013 LVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQE 1059

>KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534
           YER036C
          Length = 660

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 97/223 (43%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    +    +  E+E        F N+SF Y
Sbjct: 393 AGTYANLVRQAKSRQKILDKMEADGLIKPVAHERVFTFRFPEVERLPPPVLAFDNISFAY 452

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +    ++ NL+F ++  S + +VGP+G GKST+  ++        G++          
Sbjct: 453 DGKKEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMAQTGRV---------- 502

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + RF  T 
Sbjct: 503 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-YWRGQLGRFGLTG 556

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 557 EGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 598

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 277 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 331

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 117/256 (45%), Gaps = 40/256 (15%)

Query: 425 IPAKGGEIEFKNVSFNYPT---------RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKST 475
           IPA    + F+NVS++            +  V I +N++   + G  + I+G SG GK+T
Sbjct: 384 IPAT---LTFENVSYSITESEGIRRDEGKSNVKILQNVSGVAKPGEIMAIMGGSGAGKTT 440

Query: 476 IAWLLLHYYNPS---QGQILIDGQDISALSTKSLRRHIGIVQQ-----------EPILMS 521
           +  +L           G I I+G+    L     R+ IG V Q           E +L S
Sbjct: 441 LLDILAMKDKTDGDVSGAIKINGK---QLEKSYFRKLIGFVDQYDYLFPTLSVYETVLNS 497

Query: 522 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIG-PHGTLLSGGQKQRI 580
             +R  +   +++   +  +  V  +        R  +  D  IG  +   +SGG+K+R+
Sbjct: 498 ALLR--LPSSMSFAAKQLRVLQVLDE-------LRILEIKDRLIGNDYQRGISGGEKRRV 548

Query: 581 AIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSE 639
           +IA  L+  P++LILDE TS LD  +   +     +L ++ + T IVSI    S I  S 
Sbjct: 549 SIACELVTSPSILILDEPTSGLDSNNANNVINCLVRLAQNHNRTIIVSIHQPRSNIFYSF 608

Query: 640 NVIVLGNDGSVVEQGK 655
           N ++L ++  ++  G+
Sbjct: 609 NKLILLSNSRLIYSGE 624

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 121/276 (43%), Gaps = 36/276 (13%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P +  +    +  +++        F ++SF Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLIQPVQPDRVFSFRFSQVDRLPPPVLSFDDISFAY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +P   ++ +LNF ++  S + +VGP+G GKST+  ++        G++          
Sbjct: 403 DGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 453 -SRHSHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPEISQDFQ-YWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
           +      GT LS GQ+ R+  A   ++ P VL+LDE T+ LD+ +  ++     +     
Sbjct: 507 EAQTVQMGT-LSEGQRSRVVFALLALEAPNVLLLDEPTNGLDIPTIDSLADAINEF---- 561

Query: 622 SMTIVSIAHRLSTIRR-SENVIVLGN------DGSV 650
           +  +V ++H    + R ++++ V+ N      DGS+
Sbjct: 562 NGGVVVVSHDFRLLDRIAKDIFVVENQTATRWDGSI 597

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 100/226 (44%), Gaps = 31/226 (13%)

Query: 390 SGFFSEIMQGAGAASRIF---ELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVS 438
           +G ++ +++ A +  +I    E   L P + P R   F   +  E+E        F  ++
Sbjct: 343 AGTYANLVRQAKSRQKILDKMEADGLIPAVVPDRVFSF---RFPEVERLPPPVLAFDEIN 399

Query: 439 FNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDI 498
           F+Y   P   ++ +LNF ++  S + +VGP+G GKST+  ++     P  G++       
Sbjct: 400 FSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV------- 452

Query: 499 SALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFP 558
               ++     +G+  Q     S    D     L +   K    S   Q +    + R+ 
Sbjct: 453 ----SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPQISQDFQ-YWRGQLGRYG 503

Query: 559 DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
            T +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 504 LTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 95/223 (42%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    +    +   +E        F ++SF Y
Sbjct: 453 AGTYANLVKQAKSRQKILDKMEADGLIQPVVPDRVFSFRFPPVERLPPPVLAFDDISFAY 512

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
              P   ++ +LNF ++  S   +VGP+G GKST+  ++     P  G++          
Sbjct: 513 DGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV---------- 562

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 563 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-YWRGQLGRYGLTG 616

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           D      GT LS GQ+ R+  A   ++ P VL+LDE T+ LD+
Sbjct: 617 DAQKVQMGT-LSEGQRSRVVFALLALENPNVLLLDEPTNGLDI 658

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+   +     + +K    T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 99/223 (44%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    +    +  +++        F ++SF+Y
Sbjct: 343 AGTYANLVKQAKSRQKILDKMEADGLIQPVVQDRVFSFRFPQVDRLPPPVLAFDDISFSY 402

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +P   ++ +LNF ++  S + +VGP+G GKST+  ++        G++          
Sbjct: 403 DGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV---------- 452

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 453 -SRHTHVKLGVYSQH----SQDQLDLTKSALEFVRDKYSNISQDFQ-YWRGQLGRYGLTG 506

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 507 EAQTVLMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 107/239 (44%), Gaps = 21/239 (8%)

Query: 432  IEFKNVSFNYPTR-PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--Q 488
              ++N+ ++   +  T  I  N++  ++ G+   ++G SG GK+T+   L          
Sbjct: 853  FHWRNLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 912

Query: 489  GQILIDGQDISALSTKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTYTPTKEEIRSVAKQ 547
            G +L+DG+       +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K 
Sbjct: 913  GDVLVDGRP----RDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKD 967

Query: 548  CFCHNFIT--RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDV 604
             +    I         D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 968  AYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1027

Query: 605  ESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVVEQGKFKE 658
            ++  +I     QLM+   S    I+   H+ S I   E   ++ L   G  V  G+  E
Sbjct: 1028 QTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 114/232 (49%), Gaps = 14/232 (6%)

Query: 432 IEFKNVSFNYPT-RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLL--HYYNPSQ 488
           + F+N+ +N  + +    I   ++  ++ G  + ++G SG GK+T+  +L        + 
Sbjct: 366 LTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKAS 425

Query: 489 GQILIDGQDISALSTKSLRRHIGIVQQEPILM-SGTIRDNI-TYGLTYTPTKEEIRSVAK 546
           G I I+G +I+    ++L +  G V QE  L+ + T+ + +    L   P K  +  V K
Sbjct: 426 GSIKINGSEITK---QNLSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRK--LSFVQK 480

Query: 547 QCFCHNFIT--RFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALD 603
           Q   +  +   R  D  D  IG      +SGG+K+R++IA  L+  P+VL LDE TS LD
Sbjct: 481 QKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLD 540

Query: 604 VESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGNDGSVVEQG 654
             +   +     +L    + T I+SI    S I +S + +VL + G +V  G
Sbjct: 541 SNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVFSG 592

>TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {ON}
           Anc_3.133 YOL075C
          Length = 1312

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 107/247 (43%), Gaps = 33/247 (13%)

Query: 434 FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS------ 487
           F N+        T  I  ++N   + G    I+GPSG GKS++  L+      S      
Sbjct: 713 FSNIKTGLYHHHTKEILNSINATFKPGMINAIMGPSGSGKSSLLNLISAKQKSSMFATFS 772

Query: 488 -QGQILIDGQDISALSTKSLRRHIGIVQQEPILMSG-TIRDNITYG----LTYTPTKEE- 540
            +G I ++  +IS    KSL  ++   Q +  L+S  T+R++  +     L Y  + E  
Sbjct: 773 KEGSIALNDNEISEEMFKSLCAYVS--QDDDHLLSKLTVRESFKFAADLRLHYMCSDERD 830

Query: 541 ------IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI 594
                 IR++     C N  T   D +   I       SGG+K+R+++   L+K P +L+
Sbjct: 831 EKIDTLIRALGLTN-CQN--TIIGDEFVKGI-------SGGEKRRVSMGIQLLKDPPILL 880

Query: 595 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGNDGSVVE 652
           LDE TS LD  +   +     QL      T++   H  R    ++  NV++L   G    
Sbjct: 881 LDEPTSGLDSFTSLTVLEILEQLSADFGKTVIITIHQPRAELFKKFGNVLLLAKSGRTAF 940

Query: 653 QGKFKEL 659
            G  KE+
Sbjct: 941 NGSPKEM 947

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 107/259 (41%), Gaps = 43/259 (16%)

Query: 412 LKPRINPT--------RGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463
           + P  NPT           KF P     +  ++++    ++    + R+ +  +  GS +
Sbjct: 1   MSPERNPTTTLDDTEENHIKFKPTNKVSLHVRDLTIT-ASKSKKTLIRDFSIDLPSGSVM 59

Query: 464 CIVGPSGKGKSTIAWLL-------LHYY----------------NPSQG-QILIDGQDIS 499
            ++G SG GK+T+  +L       L Y                 NP +   +  D   +S
Sbjct: 60  AVIGGSGSGKTTLLNVLASKISGGLSYTGDISYIADNNSSTTSSNPYEKVSVTSDTFSLS 119

Query: 500 ALSTKSL-RRHIGIV---QQEPILMSGTIRDNITYG--LTYTPTKEEIRSVAKQCFCHNF 553
           + S +S+   H  +    QQ+ +    T R+ + Y   L    +KEE   +  +     +
Sbjct: 120 STSQESIASSHASMAYLPQQDVLAPKLTCRETLMYSAELKLQQSKEENAKLVDELI---Y 176

Query: 554 ITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 612
                D  DT +G      LSGG+K+R++I   +I  P+++ LDE T+ LD  S   +  
Sbjct: 177 ELGLIDCADTLVGDSSHRGLSGGEKRRLSIGTQMISNPSLMYLDEPTTGLDAYSAFLVIK 236

Query: 613 TFGQLMKSKSMTIVSIAHR 631
           T  +L +    T +   H+
Sbjct: 237 TIKRLAQFGGRTFIMSIHQ 255

>Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii AEL032W
          Length = 748

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 110/267 (41%), Gaps = 55/267 (20%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K +  K  +        I+ + VSF Y  +    + +++
Sbjct: 492 AQSRIKKLEKL-PVLEPPEEEKSVNFKFADCEKLSPPIIQLQEVSFGYEDQL---LLKDV 547

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           +  ++  S + +VG +G GK+T+  +++    P           +S   +++ R  IG  
Sbjct: 548 SLDVQMDSRIALVGANGCGKTTLLKIMMEQLTP-----------LSGFVSRNPRLRIGYF 596

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            Q  +          +  LT +                NF  +  + Y   +G  G    
Sbjct: 597 TQHHV---------DSMDLTMSSV---------DWMSKNFPGKSDEEYRRHLGAFGITGS 638

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 623
                  LLSGGQK R+A A   +  P +L+LDE ++ LD     A+       +K+ S 
Sbjct: 639 LGLQRIQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDAL----VDALKAFSG 694

Query: 624 TIVSIAHRLSTIRRSENVIVLGNDGSV 650
            ++ ++H +S I    N I +   G+V
Sbjct: 695 GVLMVSHDISVIDSVCNEIWVSEKGTV 721

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R++++RAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H
Sbjct: 365 FSGGWRMRLSLSRALFCQPDLLLLDEPSNMLDVPS---IAY-LSNYLKTYPATVLVVSH 419

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/282 (20%), Positives = 124/282 (43%), Gaps = 44/282 (15%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    K    +  E+E        F ++SF Y
Sbjct: 340 AGTYANLVRQAKSRQKILDKMEADGLIEPVVPDKVFSFRFPEVERLPPPVLAFDDISFAY 399

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
             +    ++ +LNF ++  S V +VGP+G GKST+  ++    +   G++          
Sbjct: 400 DGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRV---------- 449

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTP---TKEEIRSVAKQC-FCHNFITRF 557
            ++     +G+  Q                L  +P    +++   +++   +    + R+
Sbjct: 450 -SRHTHVKLGVYSQHS---------QEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGRY 499

Query: 558 PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617
             T +      GT LS GQ+ R+  A   ++ P VL+LDE T+ LD+    A   +  + 
Sbjct: 500 GLTGEGQTSQMGT-LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI----ATIDSLAEA 554

Query: 618 MKSKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVVE 652
           +   +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 555 INDFNGGVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSILD 596

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 100/218 (45%), Gaps = 19/218 (8%)

Query: 432  IEFKNVSFNYPTR-PTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--Q 488
              ++N+ ++   +  T  I  N++  ++ G+   ++G SG GK+T+   L          
Sbjct: 893  FHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 952

Query: 489  GQILIDGQDISALSTKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTYTPTKEEIRSVAKQ 547
            G + IDG+       +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K 
Sbjct: 953  GDVFIDGKP----RDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKN 1007

Query: 548  CFCHNFIT--RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDV 604
             +  + I         D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 1008 AYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1067

Query: 605  ESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE 639
            ++  AI     QLM+   ++   I+   H+ S I   E
Sbjct: 1068 QTAWAI----CQLMRKLCNQGQAILCTIHQPSAILMQE 1101

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 97/218 (44%), Gaps = 14/218 (6%)

Query: 449  IFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--QGQILIDGQDISALSTKSL 506
            I  N++  ++ G+   ++G SG GK+T+   L          G I +DG        +S 
Sbjct: 887  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----RNESF 942

Query: 507  RRHIGIVQQEPI-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT--RFPDTYDT 563
             R IG  QQ+ + L + T+R+++ +   Y    +E+    K  +    I         D 
Sbjct: 943  PRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVEEKNAYVEEIIKILEMEKYADA 1001

Query: 564  AIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGAINYTFGQLMKSKS 622
             +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     +L K   
Sbjct: 1002 IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCKHGQ 1061

Query: 623  MTIVSIAHRLSTIRRSE--NVIVLGNDGSVVEQGKFKE 658
              + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1062 AILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 94/205 (45%), Gaps = 18/205 (8%)

Query: 444  RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--QGQILIDGQDISAL 501
            + T  I  N++  ++ G+   ++G SG GK+T+   L          G + IDG+     
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDGKP---- 1019

Query: 502  STKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT--RFP 558
              +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  + I      
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEME 1078

Query: 559  DTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGAINYTFGQL 617
               D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     QL
Sbjct: 1079 KYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQL 1134

Query: 618  MK---SKSMTIVSIAHRLSTIRRSE 639
            M+   ++   I+   H+ S I   E
Sbjct: 1135 MRKLCNQGQAILCTIHQPSAILMQE 1159

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 97/223 (43%), Gaps = 25/223 (11%)

Query: 390 SGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIE--------FKNVSFNY 441
           +G ++ +++ A +  +I +  +    I P    K    +  E+E        F ++SF+Y
Sbjct: 340 AGTYANLVKQAKSRQKILDKMEADGLIQPVAADKVFSFRFPEVERLPPPVLAFDDISFSY 399

Query: 442 PTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISAL 501
                  ++ +L+F ++  S + +VGP+G GKST+  ++        G++          
Sbjct: 400 DGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRV---------- 449

Query: 502 STKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTY 561
            ++     +G+  Q     S    D     L +   K    S   Q +    + R+  T 
Sbjct: 450 -SRHSHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPHVSQDFQ-YWRGQLGRYGLTG 503

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 604
           +      GT LS GQ+ R+  A   +++P VL+LDE T+ LD+
Sbjct: 504 EGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 580 IAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 639
           I +ARAL++   +L++DEAT+++D E++  +  T     + + +TIV+IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 640 NVIVLGNDGSVVE 652
            ++VL + G V+E
Sbjct: 60  KILVL-DAGQVIE 71

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 95/206 (46%), Gaps = 27/206 (13%)

Query: 453 LNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY---YNPSQGQILIDGQDISALSTKSLRRH 509
           L F    GS++ I+GP+  GKS+I  ++      YN + G + I  +D            
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED-----------E 723

Query: 510 IGIVQQEPIL-MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITRFPDTY 561
           +  + Q P     GT RD I Y +            K  ++ +A     +        +Y
Sbjct: 724 LMCIPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKRDKGWSY 783

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
             A+     +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F +++K  
Sbjct: 784 FDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKKY 839

Query: 622 SMTIVSIAHRLSTIRRSENVIVLGND 647
               +SI+ R S ++  + ++ +  D
Sbjct: 840 RFNFISISQRPSLVKYHDLLLEISED 865

>TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.366
           YFR009W
          Length = 753

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 114/278 (41%), Gaps = 57/278 (20%)

Query: 402 AASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPIFRNL 453
           A SRI +L  L P + P    K I  K  +        I+ ++VSF Y     +    +L
Sbjct: 496 AQSRIKKLEKL-PILEPPEQEKSISFKFPDCEKLSPPIIQLQDVSFGYSEDDLLLKDVDL 554

Query: 454 NFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIV 513
           + +++  S + +VG +G GK+T+  +++    P                   LR   G V
Sbjct: 555 DLQMD--SRIALVGANGCGKTTLLKVMMEQLRP-------------------LR---GYV 590

Query: 514 QQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHG---- 569
            + P L        I Y   +     ++ S A       F  +  + Y   +G  G    
Sbjct: 591 SRNPRL-------RIAYFTQHHVDSMDLNSSAVDWMSKRFPGKTDEEYRRHLGSFGITGS 643

Query: 570 ------TLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAI-----NYTFGQLM 618
                  LLSGGQK R+A A   +  P VLILDE ++ LD     A+     N+T G LM
Sbjct: 644 LGLQKMQLLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTNGIDALVDALKNFTGGVLM 703

Query: 619 KSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKF 656
            S  ++++      + I  SEN      DGS+ +  K+
Sbjct: 704 VSHDISVIDSV--CNEIWVSENGTSRRFDGSIHDYKKY 739

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 423

>Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}
           YFR009W (REAL)
          Length = 752

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 114/277 (41%), Gaps = 61/277 (22%)

Query: 380 EYTGNAIF--NLSGFFSEIMQGAG----AASRIFELTDLKPRINPTRGSKFIPAKGGE-- 431
           EY    ++  +L  F  +    A     A SRI +L  L P + P    K +  K  +  
Sbjct: 467 EYDNQMVYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKL-PVLEPPEQDKTVDFKFPDCD 525

Query: 432 ------IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYN 485
                 I+ ++V F Y  +    +  ++N  ++  S + +VG +G GK+T+  +++    
Sbjct: 526 KLSPPIIQLQDVFFGYDEKNL--LLEDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLR 583

Query: 486 PSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVA 545
           P +G +           +++ R  IG   Q  +       D++           ++ + A
Sbjct: 584 PLKGFV-----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSA 614

Query: 546 KQCFCHNFITRFPDTYDTAIGPHG----------TLLSGGQKQRIAIARALIKKPTVLIL 595
                 +F  +  + Y   +G  G           LLSGGQK R+A A   +  P +L+L
Sbjct: 615 VDWMSRSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVL 674

Query: 596 DEATSALDVESEGAI-----NYTFGQLMKSKSMTIVS 627
           DE ++ LD     A+     N+  G LM S  ++++ 
Sbjct: 675 DEPSNHLDTTGLDALVDALKNFNGGVLMVSHDISVID 711

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366
          Length = 753

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 116/275 (42%), Gaps = 55/275 (20%)

Query: 398 QGAGAASRIFELTDLKPRINPTRGSKFIPAKGGE--------IEFKNVSFNYPTRPTVPI 449
           + + A SRI +L  L P + P    K I  K  +        I+ ++VSF Y     +  
Sbjct: 492 KSSEAQSRIKKLEKL-PVLEPPEEEKTITFKFPDCEKLSPPIIQLQDVSFGYDENNLLLN 550

Query: 450 FRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRH 509
             NL+ +++  S + +VG +G GK+T+  +++    P++G +  +G           R  
Sbjct: 551 DVNLDVQMD--SRIALVGANGCGKTTLLKVMMEELRPTKGFVSRNG-----------RLR 597

Query: 510 IGIVQQEPILMSGTIRDNITYGLTYTP--TKEEIRSVAKQCFCHNFITRFPDTYDTAIGP 567
           IG   Q  +         + +     P  T EE R        H+           + G 
Sbjct: 598 IGYFTQHHVDSMDLTTSAVDWMSKAYPGKTDEEYR--------HHL---------GSFGI 640

Query: 568 HGTL-------LSGGQKQRIAIARALIKKPTVLILDE-----ATSALDVESEGAINYTFG 615
            GTL       LSGGQK R+A A   +  P +L+LDE      T+ LD   E   N++ G
Sbjct: 641 TGTLGLQKMELLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVESLKNFSGG 700

Query: 616 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 650
            LM S  ++I  I H  + I  SEN  V   DG +
Sbjct: 701 VLMVSHDISI--IDHVCNEIWVSENGTVKRFDGDI 733

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 572 LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 423

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 86/195 (44%), Gaps = 41/195 (21%)

Query: 460 GSNVCIVGPSGKGKSTIAWLLLH---YYN-------PSQGQILIDGQDISALSTKSLRRH 509
           G+++ I+GP+  GKS+I  ++      YN       PS+G +                  
Sbjct: 640 GASLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEGNLFC---------------- 683

Query: 510 IGIVQQEPILM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITRFPD-TY 561
              V Q+P     GT+RD I Y ++           + +  +  +      + R    TY
Sbjct: 684 ---VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTY 740

Query: 562 DTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSK 621
             A+     +LSGG+KQR+  AR +  KP  ++LDE T+A+  + E   +Y F  L+K  
Sbjct: 741 LDAVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRY 796

Query: 622 SMTIVSIAHRLSTIR 636
               +SI+ R S I+
Sbjct: 797 RFNFISISQRPSLIK 811

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 110/249 (44%), Gaps = 36/249 (14%)

Query: 434 FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS------ 487
           +K  +F++ T+    I +++N   + G    I+GPSG GKS++  L+      S      
Sbjct: 697 WKEGNFHHETKE---ILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 488 -QGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYG-------LTYTPTKE 539
             G I+ +   +S L  K++  ++     + +L + T+++ + Y        LT     E
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 540 E----IRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLI 594
                IRS+  +  C N I          IG      +SGG+K+R+ +   L+  P +L+
Sbjct: 813 RTDNLIRSLGLK-HCENNI----------IGNEFVKGISGGEKRRVTMGVQLLNDPPILL 861

Query: 595 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGNDGSVVE 652
           LDE TS LD  +   I     +L + +  TI+   H  R    +R  NV++L   G    
Sbjct: 862 LDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAF 921

Query: 653 QGKFKELFA 661
            G   E+ A
Sbjct: 922 NGSPDEMIA 930

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 38/242 (15%)

Query: 443 TRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLH------YYNPSQGQIL---- 492
           ++    +    +  +  GS + ++G SG GK+T+  +L         +N S   +L    
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 493 ------------IDGQDISALSTKSLRRHIGIV---QQEPILMSGTIRDNITYGLTYTPT 537
                       +DGQD        +++H+ +    QQ+ +    T R+ + +       
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 538 KEEIRSVAKQCFCHNFITRF--PDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLI 594
             E     K+      I      D  DT +G +    LSGG+K+R++I   +I  P+++ 
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMF 208

Query: 595 LDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
           LDE T+ LD  S   +  T  +L K    T I+SI    S I    + + + + G+VV  
Sbjct: 209 LDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYC 268

Query: 654 GK 655
            K
Sbjct: 269 DK 270

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 112/240 (46%), Gaps = 29/240 (12%)

Query: 432 IEFKNVSFN-YPTRPT-VPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQ- 488
           + F+N+ +  +P+R + V I  +++  +  G  + ++G SG GK+ +  +L       + 
Sbjct: 364 LTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEV 423

Query: 489 -GQILIDGQDISALSTKSLRRHIGIVQQ-----------EPILMSGTIRDNITYGLTYTP 536
            G + I+G  I+     ++ + +G V Q           E +L S  +R  +   +++  
Sbjct: 424 SGTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFAA 478

Query: 537 TKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLIL 595
            ++ +  V ++        R  D  D  IG      +SGG+K+R++IA  L+  P +L L
Sbjct: 479 KQKRVYQVLEE-------LRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSPLILFL 531

Query: 596 DEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVVEQG 654
           DE TS LD  +   +     +L      T+V SI    S I R  + +VL N+G +V  G
Sbjct: 532 DEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMVYSG 591

>Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ABR125C
          Length = 1474

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 109/234 (46%), Gaps = 30/234 (12%)

Query: 434  FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCI-------VGPSGKGKSTIAWLLLHY-YN 485
            +KNVS+  P + T    R L   +++ S  CI       +G SG GK+T+   L      
Sbjct: 841  WKNVSYTIPYKGTK---RKL---LDEVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVG 894

Query: 486  PSQGQILIDGQDISALSTKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTY-----TPTKE 539
               G +L++G  +      S  R  G VQQ+ + +   T+R+++ +          P  E
Sbjct: 895  IITGDMLVNGLPVDI----SFERRTGYVQQQDVHIKEMTVRESLQFSARLRRPESVPDAE 950

Query: 540  EIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEA 598
            ++  V K       +    D  D  +G  G  L+ GQ+++++I   L+ KP++L+ LDE 
Sbjct: 951  KLDYVEKIIE----VLGMTDYADAVVGDVGYGLNVGQRKKLSIGVELVAKPSLLLFLDEP 1006

Query: 599  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGNDGSVV 651
            TS LD +S  AI     +L K+    + +I    +T+  + + +++L   G  V
Sbjct: 1007 TSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTV 1060

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 103/235 (43%), Gaps = 20/235 (8%)

Query: 444 RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS-------QGQILIDGQ 496
           + T  I +++N   + G    I+GPSG GKS++  L+    N S        G IL++  
Sbjct: 682 KKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFHSTGSILLNTN 741

Query: 497 DISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLT---YTPTKEEIRSVAKQCFCHNF 553
            IS    KS+  ++     + +L S T+R+   +      +  T ++ RS   +      
Sbjct: 742 SISKEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEILLALG 800

Query: 554 ITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 612
           +T      +T IG      +SGG+K+R+ I   L+    +L+LDE TS LD  +  AI  
Sbjct: 801 LTH---CENTVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTSAAILE 857

Query: 613 TFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGNDGSVVEQGKFKEL---FAN 662
               L      T++   H  R    ++  +V++L   G     G   E+   FAN
Sbjct: 858 ILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEMINYFAN 912

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 107/244 (43%), Gaps = 12/244 (4%)

Query: 424 FIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHY 483
           F+ A    +  +NV+ +  ++    +  + +  +  GS + ++G SG GK+T+  +L   
Sbjct: 13  FVRAPPIALHARNVTIS-ASKTNKVLVNSFSVDLPSGSVMAVMGGSGSGKTTLLNVLASK 71

Query: 484 YNPS---QGQILIDGQDISALSTKSLRRHIGIVQQEPILMSG-TIRDN--ITYGLTYTPT 537
            +      G+I    +D S          +  + Q  +L +  T R+   I   L    +
Sbjct: 72  VSKGLQLDGEIHYALEDNSEHFNADTEASMAYLPQHDVLPARLTCRETLMIAADLKLKSS 131

Query: 538 KEEIRSVAKQCFCHNFITRFPDTYDTAIG-PHGTLLSGGQKQRIAIARALIKKPTVLILD 596
            E+   +  Q           D  +T +G      LSGG+K+R+++A  L+  P+ + LD
Sbjct: 132 LEKKNEIVDQLLLE---LGLRDCANTLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLD 188

Query: 597 EATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655
           E T+ LD  S   +  +  +L +    + I+S+    S I    + + + + G+VV  GK
Sbjct: 189 EPTTGLDAYSAFLLVKSLKKLARDGQKSFIMSVHQPRSDIMFLLDSVCILSKGNVVYCGK 248

Query: 656 FKEL 659
             E+
Sbjct: 249 TTEM 252

>TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON}
           Anc_8.42 YFL028C
          Length = 276

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 100/227 (44%), Gaps = 15/227 (6%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           +E KN+++ +P   T P  +N+   I   +   ++G +G GKST+  L+   +    G I
Sbjct: 5   VEIKNLTYKFPEHET-PALKNIELSIPWNTRTLLIGCNGAGKSTLLRLISGKHLCLNGNI 63

Query: 492 LIDGQDISA-----LSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAK 546
           L++G D  +     +S +   ++   +  E   M+   RD    G+      E + S+  
Sbjct: 64  LVNGLDPFSPTSMDVSGEEECQNTTYLGTEWCHMNIINRD---IGIL-----ELLNSIGY 115

Query: 547 QCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVES 606
           Q F      +  D     +      LS GQK+R+ +   L+K   VL+LDE T  LDV +
Sbjct: 116 QHFKERG-DKLIDMLSVDLTWRMHRLSDGQKRRVQLIMGLLKPWRVLLLDEVTVDLDVIA 174

Query: 607 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQ 653
              +        +++  +++   H    +    N ++  N G +V++
Sbjct: 175 RSKLLDFLKWETETRKCSVIYATHIFDGLAEWPNYVIHINGGEIVQR 221

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 115/291 (39%), Gaps = 41/291 (14%)

Query: 434 FKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL-------LHYYNP 486
           FKN   +     T  I +++N   + G    I+GPSG GKS++  L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 487 SQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTY-----------T 535
           + G I+ +   +S L  K++  ++     + +L + T+++ + Y                
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVS-QDDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 536 PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLI 594
            T   IRS+  +  C N I          IG      +SGG+K+R+ +   L+  P +L+
Sbjct: 821 RTDNLIRSLGLK-HCENNI----------IGNEFVKGISGGEKRRVTMGVQLLSDPPILL 869

Query: 595 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGNDGSVVE 652
           LDE TS LD  +   I      L K    T++   H  R    +R  NV++L   G    
Sbjct: 870 LDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAF 929

Query: 653 QGKFKEL---FAN-----PAXXXXXXXXXXXXGNNAAPEIQPQEISQTIEE 695
            G   E+   FAN     P+              N   E+  Q     +EE
Sbjct: 930 NGSPDEMITYFANLGFDCPSFTNVADFFLDLISVNTQNELNEQSSKSRVEE 980

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 559 DTYDTAIGPHGTL-LSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617
           D  DT +G +    LSGG+K+R++I   +I  P+++ LDE T+ LD  S   +  T  +L
Sbjct: 179 DCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKL 238

Query: 618 MKSKSMTIVSIAHR 631
            K    T +   H+
Sbjct: 239 AKEDGRTFIMSIHQ 252

>CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} similar
           to uniprot|P43569 Saccharomyces cerevisiae YFL028c CAF16
           ATP-binding cassette transporter family member
          Length = 294

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 79/183 (43%), Gaps = 12/183 (6%)

Query: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491
           +E  ++++ +   P  P   N+N K+   +   +VG +G GKST+  LL   +    G I
Sbjct: 6   VEVTDLTYRFKESPE-PAVENINLKVPWNTRTLVVGANGAGKSTLLKLLSGKHLCLTGNI 64

Query: 492 LIDGQD-ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTK---------EEI 541
            ++G D  S LS  +   +  I   +     G  + +   G  +             E +
Sbjct: 65  KVNGLDPFSPLSMTTSIDNTLIENDDGFGNKGECQVSTYLGTEWCHMSIINRDIGVLELL 124

Query: 542 RSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSA 601
            S+  Q F      R  D  D  +      LS GQK+R+ +A  L+K   VL+LDE T  
Sbjct: 125 DSIGYQFFKQRG-DRLIDILDIDVNWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVD 183

Query: 602 LDV 604
           LDV
Sbjct: 184 LDV 186

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 105/226 (46%), Gaps = 20/226 (8%)

Query: 444  RPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPS--QGQILIDGQDISAL 501
            R +  I  N++  ++ G+   ++G SG GK+T+   L          G I +DG+    L
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDGK----L 921

Query: 502  STKSLRRHIGIVQQEPI-LMSGTIRDNITYGLTY-----TPTKEEIRSVAKQCFCHNFIT 555
              +S  R IG  QQ+ + L + T+R+++ +          P  E+ + V +     N + 
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI---NVLE 978

Query: 556  RFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLI-LDEATSALDVESEGAINYTF 614
              P   D  +G  G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I    
Sbjct: 979  MEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLI 1037

Query: 615  GQLMKSKSMTIVSIAHRLST--IRRSENVIVLGNDGSVVEQGKFKE 658
             +L  ++   I+   H+ S   I+  + ++ L   G  V  G+  +
Sbjct: 1038 RKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGELGD 1082

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,095,131
Number of extensions: 2921621
Number of successful extensions: 10125
Number of sequences better than 10.0: 515
Number of HSP's gapped: 9646
Number of HSP's successfully gapped: 906
Length of query: 741
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 624
Effective length of database: 40,065,477
Effective search space: 25000857648
Effective search space used: 25000857648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)