Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E027906.6ON65653323e-42
CAGL0A01111g6.6ON69622111e-23
NCAS0D022006.6ON85621946e-21
NDAI0I027406.6ON66621875e-20
Kpol_1045.826.6ON62631866e-20
Skud_16.66.6ON62611857e-20
KAFR0B064906.6ON66641857e-20
Smik_6.4796.6ON62611858e-20
Suva_16.346.6ON62611849e-20
TPHA0J002306.6ON62591841e-19
TDEL0G046506.6ON62611831e-19
ZYRO0F00418g6.6ON62611822e-19
Kthe_YGOB_Anc_6.66.6ON62621822e-19
YPL271W (ATP15)6.6ON62611813e-19
TBLA0A072006.6ON65631735e-18
Sklu_YGOB_Anc_6.66.6ON61631702e-17
Kwal_56.223336.6ON62631674e-17
Klac_YGOB_Anc_6.66.6ON61591423e-13
ACR021W6.6ON62631015e-07
Ecym_30086.6ON6163972e-06
Suva_8.1895.474ON62629630.75
Suva_16.4773.491ON42329582.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02790
         (65 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...   132   3e-42
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    86   1e-23
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    79   6e-21
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    77   5e-20
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    76   6e-20
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       76   7e-20
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    76   7e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    76   8e-20
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    75   9e-20
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    75   1e-19
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    75   1e-19
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    75   2e-19
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    75   2e-19
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    74   3e-19
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    71   5e-18
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    70   2e-17
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    69   4e-17
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    59   3e-13
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    44   5e-07
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    42   2e-06
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...    29   0.75 
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...    27   2.9  

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score =  132 bits (332), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 65/65 (100%), Positives = 65/65 (100%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 61 LQETS 65
          LQETS
Sbjct: 61 LQETS 65

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 85.9 bits (211), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 50/62 (80%)

Query: 2  SAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPL 61
          S  W+KAG++Y+++L + A+T+R +LK ELQT  V+ RG TDAAYT YEKG+PK+DP PL
Sbjct: 8  STAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67

Query: 62 QE 63
          QE
Sbjct: 68 QE 69

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 79.3 bits (194), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          +SA  +KAG+TYA YL V ++TLR++LK ELQT  V++R  TDA YT YEKG+P ADP P
Sbjct: 20 LSATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAP 79

Query: 61 LQ 62
          LQ
Sbjct: 80 LQ 81

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 76.6 bits (187), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 48/62 (77%)

Query: 2  SAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPL 61
          SA W+KAGITY+ YL++ A+TLR+ALK ELQT  V++R  TDA +T Y+ G P ++P+ L
Sbjct: 4  SAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63

Query: 62 QE 63
          Q+
Sbjct: 64 QK 65

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 76.3 bits (186), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 47/63 (74%), Gaps = 1/63 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAGITY  Y+N+ A+T+R ALKNEL+T  VL+R  T+A +  +E G PK +P P
Sbjct: 1  MSA-WRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVP 59

Query: 61 LQE 63
          +Q+
Sbjct: 60 IQQ 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAGI+YA YLNV A+T+RS+LK ELQT +VLSR  TDA YT Y+ G   ++P P
Sbjct: 1  MSA-WRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTP 59

Query: 61 L 61
          +
Sbjct: 60 I 60

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MS+ W+KAG+TYA+YL++ +KTLR  LK E QT  V SR  T+A  T Y+ G+P +DP+P
Sbjct: 1  MSSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEP 60

Query: 61 LQET 64
          LQ++
Sbjct: 61 LQKS 64

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAGI+YA YLNV AK +RS+LK ELQT +VLSR  TDA YT Y+ G   ++P P
Sbjct: 1  MSA-WRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTP 59

Query: 61 L 61
          +
Sbjct: 60 I 60

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 75.5 bits (184), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG++YA YLNV A+T+RS+LK ELQT NVLSR  TDA YT Y+ GT  ++P  
Sbjct: 1  MSA-WRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVS 59

Query: 61 L 61
          +
Sbjct: 60 I 60

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 75.5 bits (184), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (77%)

Query: 5  WKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQE 63
          W+KAG+TY+ YL V AKT+R +LKN+L+T +VLSR  TD  YT++EKGT K++P  + +
Sbjct: 4  WRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSISD 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 75.1 bits (183), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (73%)

Query: 3  AYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQ 62
          A W+KAG+TY TYL+V A+T+R+ALK ELQ   VL+R  TDA Y  YEKG+  +D  PLQ
Sbjct: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61

Query: 63 E 63
          E
Sbjct: 62 E 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 74.7 bits (182), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG+TY  YL+V AKT+RSALK E QT  VLSR   D+ YT +EKG P+ +P+P
Sbjct: 1  MSA-WRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKP 59

Query: 61 L 61
          L
Sbjct: 60 L 60

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 74.7 bits (182), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (75%), Gaps = 1/62 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG+TY  Y+ + A+T+RSALKN+LQT  VL R  T+A +  YEKGTP A+ QP
Sbjct: 1  MSA-WRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQP 59

Query: 61 LQ 62
          L+
Sbjct: 60 LK 61

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 74.3 bits (181), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAGI+YA YLNV A+ +RS+LK ELQT +VL+R  TDA YT Y+ GT  ++P P
Sbjct: 1  MSA-WRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTP 59

Query: 61 L 61
          +
Sbjct: 60 I 60

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 71.2 bits (173), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAGITY  Y+ + AKT+R+ALK ELQT  V+ R  T+A +T Y KG+P ADP  
Sbjct: 1  MSA-WRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPAL 59

Query: 61 LQE 63
          L+E
Sbjct: 60 LKE 62

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 70.1 bits (170), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 47/63 (74%), Gaps = 2/63 (3%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG+TY  YL++ AKT+R+ALK E QT  VLSR  ++A +  +E GTP +DP P
Sbjct: 1  MSA-WRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIP 58

Query: 61 LQE 63
          L++
Sbjct: 59 LKK 61

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 68.9 bits (167), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 1/63 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG+TY  Y+ + A+T+RSALK E QT  VL R  T+A +  YE GT  A+ QP
Sbjct: 1  MSA-WRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQP 59

Query: 61 LQE 63
          L+E
Sbjct: 60 LKE 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 59.3 bits (142), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 43/59 (72%), Gaps = 1/59 (1%)

Query: 5  WKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQE 63
          W+KAG+T+  Y++V A T+R+ALK ELQT +VL+R  ++A +  +E G   ++P PL++
Sbjct: 4  WRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLKK 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 43.5 bits (101), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 1/63 (1%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG+TY +YL V A+T+R+ALK ELQ+  VL+R  T+A    Y      A+  P
Sbjct: 1  MSA-WRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVP 59

Query: 61 LQE 63
          L++
Sbjct: 60 LRK 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 42.0 bits (97), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60
          MSA W+KAG++Y TY+ V A+ +RSALK EL+   VLSR  T+A    Y+ G   +D  P
Sbjct: 1  MSA-WRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVP 58

Query: 61 LQE 63
          L++
Sbjct: 59 LKK 61

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 28.9 bits (63), Expect = 0.75,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 4   YWKKAGITYATYLNVTAKTLRSALKNELQ 32
           Y  + GI Y +YL V AK ++S LKN ++
Sbjct: 105 YSLQTGIFYNSYLYVHAKNIQSKLKNSIK 133

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa]
          {ON} YPR148C (REAL)
          Length = 423

 Score = 26.9 bits (58), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 1  MSAYWKKAGITYATYLNVTAKTLRSALKN 29
          MS YW K   + AT  + T  TL SAL N
Sbjct: 1  MSGYWNKITDSIATAAHKTQDTLNSALAN 29

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.120    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,326,598
Number of extensions: 180602
Number of successful extensions: 421
Number of sequences better than 10.0: 23
Number of HSP's gapped: 421
Number of HSP's successfully gapped: 23
Length of query: 65
Length of database: 53,481,399
Length adjustment: 38
Effective length of query: 27
Effective length of database: 49,124,091
Effective search space: 1326350457
Effective search space used: 1326350457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)