Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E027806.10ON65062029240.0
KAFR0B065006.10ON63659617710.0
NCAS0D021906.10ON64559817630.0
NDAI0I027506.10ON66361117190.0
TPHA0M002006.10ON63459717040.0
CAGL0A01067g6.10ON64159916740.0
ZYRO0F00484g6.10ON64359816740.0
TBLA0G011106.10ON63859316510.0
Kpol_1045.776.10ON65060616460.0
TDEL0G046106.10ON63359816110.0
SAKL0E00880g6.10ON63658915930.0
ACR016W6.10ON64060215610.0
KLTH0C11528g6.10ON64260215610.0
KLLA0D00836g6.10ON64059915520.0
Kwal_56.223506.10ON65862315380.0
YPL263C (KEL3)6.10ON65160113990.0
Suva_16.426.10ON65460813980.0
Smik_6.4716.10ON65160513940.0
Skud_16.146.10ON65260513820.0
CAGL0F07997g5.88ON9361981682e-11
Smik_16.685.88ON8942081663e-11
Skud_7.5725.88ON8831861574e-10
Suva_7.5305.88ON8941861564e-10
YGR238C (KEL2)5.88ON8821911565e-10
Kpol_1050.695.88ON10842441531e-09
NDAI0D026005.88ON11671481451e-08
TDEL0G011205.88ON10093001432e-08
SAKL0H02618g5.88ON10851931423e-08
KAFR0B043205.88ON9862121405e-08
ZYRO0B08228g5.88ON12931201352e-07
KLTH0C01474g5.88ON10561201333e-07
Ecym_20615.88ON13621911324e-07
Kwal_14.10195.88ON9781571315e-07
KLLA0E15511g5.88ON9052421306e-07
Smik_8.2425.88ON11682021307e-07
YHR158C (KEL1)5.88ON11641201299e-07
ADL149W5.88ON12112091281e-06
NCAS0F005205.88ON10862111252e-06
Kpol_1010.625.88ON9731831253e-06
TPHA0A051705.88ON10162591243e-06
Suva_15.3575.88ON11721201243e-06
TPHA0H010805.88ON8281671234e-06
KNAG0K005605.88ON11042551201e-05
TBLA0C065305.88ON11722771191e-05
Skud_8.2225.88ON11692971182e-05
CAGL0I02090g5.88ON11361501137e-05
NCAS0B044608.157ON1552110940.013
KAFR0C028908.157ON1451243920.021
CAGL0K02101g8.157ON1633117900.038
KAFR0I029103.15ON691209870.073
KAFR0B021808.157ON154397860.10
KNAG0G013908.157ON1567125820.30
KNAG0D021008.157ON1687123820.34
Smik_10.3151.470ON35068800.43
ZYRO0G19426g8.157ON159486761.6
ADR414C7.9ON78470733.5
CAGL0B01485g3.15ON67463716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02780
         (650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...  1130   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   686   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   683   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   666   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   660   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   649   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   649   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   640   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   638   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   625   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   618   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   605   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   605   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   602   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   597   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   543   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   543   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   541   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   536   0.0  
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    69   2e-11
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    69   3e-11
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    65   4e-10
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    65   4e-10
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    65   5e-10
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    64   1e-09
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    60   1e-08
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    60   2e-08
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    59   3e-08
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    59   5e-08
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    57   2e-07
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    56   3e-07
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    55   4e-07
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    55   5e-07
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    55   6e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    55   7e-07
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    54   9e-07
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    54   1e-06
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    53   2e-06
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    53   3e-06
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    52   3e-06
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    52   3e-06
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    52   4e-06
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    51   1e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    50   1e-05
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    50   2e-05
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    48   7e-05
NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8....    41   0.013
KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8....    40   0.021
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    39   0.038
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    38   0.073
KAFR0B02180 Chr2 complement(425578..430209) [4632 bp, 1543 aa] {...    38   0.10 
KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {...    36   0.30 
KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8....    36   0.34 
Smik_10.315 Chr10 complement(501821..502873) [1053 bp, 350 aa] {...    35   0.43 
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    34   1.6  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    33   3.5  
CAGL0B01485g Chr2 (132868..134892) [2025 bp, 674 aa] {ON} simila...    32   6.5  

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/620 (89%), Positives = 552/620 (89%)

Query: 31  DQKRVKKFGXXXXXXXXXXXXXXXQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNASKP 90
           DQKRVKKFG               QNFKLEQEQFEKVVVELVPHPTPRNNACLVTNASKP
Sbjct: 31  DQKRVKKFGLDSDDEEDLDIDTILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNASKP 90

Query: 91  ELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTIL 150
           ELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTIL
Sbjct: 91  ELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTIL 150

Query: 151 FGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFK 210
           FGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFK
Sbjct: 151 FGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFK 210

Query: 211 DLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAK 270
           DLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAK
Sbjct: 211 DLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAK 270

Query: 271 NNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGV 330
           NNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGV
Sbjct: 271 NNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGV 330

Query: 331 YDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKEL 390
           YDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQ            TVSKEQEKEL
Sbjct: 331 YDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKEL 390

Query: 391 QDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHER 450
           QDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHER
Sbjct: 391 QDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHER 450

Query: 451 FNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD 510
           FNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD
Sbjct: 451 FNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD 510

Query: 511 VQSXXXXXXXXXXXXXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKA 570
           VQS                  PTN                       IPDPRPWLPHPKA
Sbjct: 511 VQSEDDFEYEDDDDEDDGEAEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKA 570

Query: 571 FESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQEL 630
           FESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQEL
Sbjct: 571 FESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQEL 630

Query: 631 GVGGDIIERDAQSPPTARRR 650
           GVGGDIIERDAQSPPTARRR
Sbjct: 631 GVGGDIIERDAQSPPTARRR 650

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/596 (56%), Positives = 420/596 (70%), Gaps = 13/596 (2%)

Query: 55  QNFKLEQEQFEKVVVELVPHPTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLH 114
           +NFK EQE +EK+ +E V  P+ RNN  ++++ +K ELLLFGGE T+ E   TKFYNDL+
Sbjct: 53  ENFKKEQENYEKINIESVEKPSIRNNGSIISSTTKKELLLFGGEHTSKELQTTKFYNDLY 112

Query: 115 VYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDN 174
            ++P NNQWK+ TSQNSPMPRSSAAM +H SG+ +L GGEFSSPKQ+TFYHY+DTW+LD 
Sbjct: 113 TFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILDL 172

Query: 175 TTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTK 234
           TT+EW+K++ K  P  RSGHRITTWKNYFILFGGFKDL   T+Y+NDVWLF++  +KW +
Sbjct: 173 TTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQ 232

Query: 235 WE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNV 293
            E   N   PD RSGHS I ++EG IVYGGYCK+KAK  K L KGK L+ CW LKM  +V
Sbjct: 233 VEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAK--KGLQKGKLLSGCWNLKMKADV 290

Query: 294 NEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNI 353
             I+WERR K+G QPSPRVGCSMA H+  RGILFGGVYD +ETEE L SI+YNDL++YNI
Sbjct: 291 EAIRWERRRKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFDETEESLESIFYNDLFTYNI 349

Query: 354 ESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYSG 413
           ESNRW+ + L+K +               SKE+E+ELQDLLN+ILE+N+LK ++      
Sbjct: 350 ESNRWFNVTLKKRSNATKTISSTKNKS--SKEKERELQDLLNQILEKNNLKPDDEEEEES 407

Query: 414 SNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKD 473
           S+    +       D+++EE+K + ++  + QLPH RFNA TTV++D  YIYGG WEF +
Sbjct: 408 SDIFGSD-------DEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGE 460

Query: 474 NDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXPT 533
            DY+IDSFYSIDLNKLDG+  Y+E+L EIE  K LG+  S                    
Sbjct: 461 IDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEEVE 520

Query: 534 NXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISNN 593
           +                       IPDPRPWLPHPKAFESLR FY+REGP FLEWAISNN
Sbjct: 521 DTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNN 580

Query: 594 KHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649
           +H +GK LKQKSFELCQDRWWERRDQI IEEDKL+E+GV GD++ERD     + RR
Sbjct: 581 RHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/598 (57%), Positives = 421/598 (70%), Gaps = 10/598 (1%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVT--NASKPELLLFGGERTNNETNMTKFYNDL 113
           NFKL+QEQFE V VE +  P  R N+C++T  N SK ELL+FGGE TN ET+MT FYN+L
Sbjct: 55  NFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNEL 114

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
             Y+P N QW+K TSQNSPMPRSSAAMC+H SG+ +L GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 115 ITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
             T+EW+K+D   GP  RSGHRIT WKNYFIL GGFKDL   TSYFND W F++  +KW 
Sbjct: 175 THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWK 234

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHSWI + EG I++GGYCKVKA   K L KGK L DCW LKM  +
Sbjct: 235 QIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKA--GKGLQKGKILNDCWYLKMKSD 292

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
           +++++WERR K+G QPSPRVGCSMA H+  RGILFGGVYD EETEE L SI+YNDL+SYN
Sbjct: 293 LSQVRWERRKKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFEETEESLESIFYNDLFSYN 351

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           +ESNRW+ L LRK  +              SKE+EKELQDLLN+ILE+N+LKD++ +   
Sbjct: 352 VESNRWFSLSLRKAQKFKKVAKSSNNKS--SKEKEKELQDLLNQILEKNNLKDDDDDDEI 409

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
            + T  E  T     D++ +E      +  ++QLPH RFNA TTV++D+ +IYGG+WE  
Sbjct: 410 STGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMG 469

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + DY IDS YSIDLNKLDG++ Y+E+LQEIE+ K +G+  S                   
Sbjct: 470 EKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEI- 528

Query: 533 TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592
            +                       IPD RPWLPHPK FESLR FYIREG  FLEWAISN
Sbjct: 529 EDKKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN 588

Query: 593 NKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARRR 650
           NKH +GKHLK+KSF+LC+DRWWERRDQ++IEEDKL+ELGV G++IE+D  S PT++RR
Sbjct: 589 NKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDT-SVPTSKRR 645

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/611 (55%), Positives = 419/611 (68%), Gaps = 20/611 (3%)

Query: 56  NFKLEQEQFEKVVVELVP-----HPTPRNNACLVTNASK-----PELLLFGGERTNNETN 105
           NFK+EQE+FEK+ VEL+P     H +PR+N+ ++T AS       ELL+FGGE T+ ET 
Sbjct: 56  NFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETG 115

Query: 106 MTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYH 165
           MT FYNDL  Y P   QW+K TSQNSPMPRSSAAMC H SG+ IL GGEFSSPKQNTFYH
Sbjct: 116 MTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYH 175

Query: 166 YNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDL-NQGTSYFNDVWL 224
           Y+DTW+LD +T+EW+K+D K  P ARSGHRI  WKNYF+LFGGFKD+ N  T+YFNDVW 
Sbjct: 176 YSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWC 235

Query: 225 FNVVDFKWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTD 283
           F+++++KWT+ E   N   PDPRSGHSWI   EG I++GGY KVK+K      KGK L D
Sbjct: 236 FDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILND 295

Query: 284 CWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSI 343
           CW LKM  +++ I+WERR K G QPSPRVGCSMA H+  RGILFGGVYD +ETEE L S+
Sbjct: 296 CWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHK-GRGILFGGVYDFDETEESLESL 354

Query: 344 YYNDLYSYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDL 403
           +YNDL+SYN+E+NRW+ L LRK  +              SKE+EKELQDLLN+ILE+N+L
Sbjct: 355 FYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKN--SKEKEKELQDLLNQILEKNNL 412

Query: 404 KDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRT-----NLPKLNQLPHERFNACTTVL 458
           KDE+       N   + +TT      +++E+  RT      +  +NQLPH R+N   TV+
Sbjct: 413 KDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVV 472

Query: 459 NDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXX 518
           +D  +IYGG WE  + DY I+SFYSIDLN++DG+T Y+E+L+EIE+ K LG+  S     
Sbjct: 473 DDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDD 532

Query: 519 XXXXXXXXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFY 578
                                                  IPD RPWLPHPK FESLR FY
Sbjct: 533 EDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFY 592

Query: 579 IREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIE 638
           IREGP FLEWAISNNKH +GKHLK+KSFELC+DRWWERRDQI+IEEDKL+ELGV GD+IE
Sbjct: 593 IREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIE 652

Query: 639 RDAQSPPTARR 649
           +D     + RR
Sbjct: 653 KDTSKGASKRR 663

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/597 (56%), Positives = 412/597 (69%), Gaps = 20/597 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           NFK EQEQFE++ VE V  PT R N+C++ N    K ELLLFGGE T+ E  +T FYNDL
Sbjct: 55  NFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDL 114

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + + P N+ WKK TSQNSPMPRSSAAM +H SG+ +L GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 115 YTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            TTREW+K++ KNGPSARSGHRIT WKNYFIL GGF+DL   TSY ND WLF++  +KW 
Sbjct: 175 CTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWR 234

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS I + EG +++GGYCKVKA   K L KGK L DCW LKM  +
Sbjct: 235 QIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKA--GKGLQKGKILGDCWYLKMKAD 292

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
            + ++WERR K+G QPSPRVGCSM +H   RGILFGGVYD EETEE L SI+YNDL+SY 
Sbjct: 293 PSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           IESNRWY L+LR   +              SKE+E ELQ++LN+ILE+ +LKD++ ++  
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKS-----SKEKELELQNILNEILEKANLKDDDEDANE 406

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
            SN    ++ +D E +   ++E +       NQLPH RFNA TTV++DT +IYGG+WE  
Sbjct: 407 LSNGLGSDSDSDDESEKVSKKEYIVR-----NQLPHHRFNASTTVVDDTLFIYGGVWELG 461

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + DY+IDS YSIDLNKLDG+T Y+ENL +IE+ K LG + S                   
Sbjct: 462 EKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEE--- 518

Query: 533 TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592
                                    IPDPRPWLPHPKAFESLR FY+R G  FLEWAISN
Sbjct: 519 ETVDQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISN 578

Query: 593 NKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649
           NKH +GKHLK KSFELCQDRWWERRDQ++IEEDKL+ELG  G++IE+D  +  T RR
Sbjct: 579 NKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDT-TKSTKRR 634

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/599 (55%), Positives = 415/599 (69%), Gaps = 14/599 (2%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTN----ASKPELLLFGGERTNNETNMTKFYN 111
           NFK EQEQFEKV V+ V     R N C+V N    +SK EL++FGGE TN +T+ T FYN
Sbjct: 52  NFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYN 111

Query: 112 DLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL 171
           DLH + P+NNQWK++TSQN+PMPRSSAAM +H SG+ +L GGEFSSPKQNTFYHY+DTW+
Sbjct: 112 DLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWI 171

Query: 172 LDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFK 231
           LD  T+EW+K+D K GPSARSGHRIT WKN+FIL GGF+DL   T+Y +D WLF++  +K
Sbjct: 172 LDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYK 231

Query: 232 WTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290
           W + E  +N   PD RSGHS+I + EG I++GGYCKVKA N K   KGK L+DCW LKM 
Sbjct: 232 WKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSDCWYLKMK 290

Query: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350
            +++ I+WERR K+G QPSPRVGCSMA H+  RGILFGGVYD EETEE L S ++NDL+S
Sbjct: 291 SDISGIRWERRRKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFEETEESLESNFFNDLFS 349

Query: 351 YNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNS 410
           Y+IESNRWY L +R  ++              SKEQEKEL+ LL+ ILE+ +L+D+   S
Sbjct: 350 YHIESNRWYSLSIR--SRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDK---S 404

Query: 411 YSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWE 470
               +     T   +   ++EEEE++      L QLPH RFNA TTV++DT +I+GG+WE
Sbjct: 405 DDDEDDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWE 464

Query: 471 FKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXX 530
             D ++ IDS YSIDLNKLDG+T Y+E+L+EIE  K LG V+                  
Sbjct: 465 LGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG-VEDSDFEDDDEDDDDEDDDE 523

Query: 531 XPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAI 590
              N                        PDPRPWLPHPK FE+LR FYIREG  FLEWAI
Sbjct: 524 EDDNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAI 583

Query: 591 SNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649
           SNNK+AKGKHLK+ SF+LCQ+RWWERRDQ++IEEDKL+E+G  GDIIERD +S  + RR
Sbjct: 584 SNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERD-KSASSKRR 641

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/598 (54%), Positives = 406/598 (67%), Gaps = 14/598 (2%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNAS--KPELLLFGGERTNNETNMTKFYNDL 113
           +FK EQEQFEKVVVE V  P+ R N CLV+N +  K EL+LFGGE TN   + T FYN+L
Sbjct: 56  SFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNEL 115

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
             + P N+QW+K +SQN+PMPRSSAAM +H SG+ +L GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 116 FTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 175

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            TT+EW+KLD KNGP++RSGHR+T WKN+FI++GGF+DL   T+Y ND WLF++   KWT
Sbjct: 176 CTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWT 235

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS+I   EG I++GGYCKVKA   K L KGK LTDCW LKM+  
Sbjct: 236 QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMNST 293

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
            + I+WERR K+G QPSPRVGCSM  H+  RG+LFGGVYD EETEE L S +YNDL+++ 
Sbjct: 294 PSAIRWERRKKQGFQPSPRVGCSMVPHK-GRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           I++NRWY L LR                + +K+QEKELQD LN+IL+Q  L D++ +   
Sbjct: 353 IKTNRWYSLSLRP-----QRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKED 407

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
                 E+   + +  D +EEE  +       QLPH RFN    V+NDT +IYGG+WE  
Sbjct: 408 -DKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELG 466

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQS-XXXXXXXXXXXXXXXXXX 531
           D DY IDSFY IDLNK+DG+T Y+ENL EIE+ K+L +  S                   
Sbjct: 467 DKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEE 526

Query: 532 PTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAIS 591
                                     IPDPRPWLPHPKAFESLR FY+R GP+FLEWAIS
Sbjct: 527 EVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAIS 586

Query: 592 NNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649
           NN+ A+GKHLKQKSF+LCQDRWWERRDQ++IEEDK++ELG  GDI+ER+  +  T RR
Sbjct: 587 NNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNP-AQKTKRR 643

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/593 (53%), Positives = 407/593 (68%), Gaps = 21/593 (3%)

Query: 55  QNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYND 112
           +NFK +QEQFEK+ +E V  PT R N+C+++N    K EL+LFGGE   N +  T FYND
Sbjct: 54  ENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGE---NTSTTTTFYND 110

Query: 113 LHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL 172
           L  YNP+N+QWKK+TSQNSPMPRSS+AM SH +G+ +L GGEFSSPKQNTFYHY+DTWLL
Sbjct: 111 LFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL 170

Query: 173 DNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKW 232
           D  T+EWSK++ KNGPSARSGHR+T WKN+ IL GGF+DL   T+Y  D+WLF+V  +KW
Sbjct: 171 DCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKW 230

Query: 233 TKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQ 291
           T+ E   N   PD RSGHS I + +G +++GGYCKVKA   K L KGK L+DCW LKM  
Sbjct: 231 TQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKA--GKGLQKGKILSDCWYLKMKS 288

Query: 292 NVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSY 351
           +V+ I+WERR K+G QPSPRVGCSM +H   RGILFGGV+D EETEE L S++YNDL++Y
Sbjct: 289 DVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDLFTY 347

Query: 352 NIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSY 411
            IE NRW+ L +R                  +K++EKELQD+LN IL++N+L D+++   
Sbjct: 348 QIEINRWFSLSMR-----SQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSED- 401

Query: 412 SGSNTPHEETTTDREQDDNEEEEK---MRTNLPKLNQLPHERFNACTTVLNDTFYIYGGM 468
              N   EE   + ++ ++E+E K   +      +NQLPH RFNA T V+NDT YI+GG 
Sbjct: 402 --PNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGS 459

Query: 469 WEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXX 528
           WE  + DY+IDSFYSIDLNKLDG+T Y+E+++EIE  K LG+ Q                
Sbjct: 460 WELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGE-QFSDEEDEDDEEEDEDD 518

Query: 529 XXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEW 588
                                        IPDPRPWLPHPK FE+LR FY+R G  FLEW
Sbjct: 519 GEEEIVDQKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEW 578

Query: 589 AISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDA 641
           AISNN+ +KGKHLK+KSFEL +DRWWERRDQ++IEEDK++ELG   +I+ERD 
Sbjct: 579 AISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDT 631

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/606 (53%), Positives = 407/606 (67%), Gaps = 21/606 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           NFK EQE FE++ +E V  P+ R N C++ N    K EL+LFGGE TN +T+ T+F+NDL
Sbjct: 54  NFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDL 113

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + Y P+N+QW+++TS+NSPMPRSSAAM +H SGV ++ GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 114 YSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            +T+EW+K++ KNGPSARSGHRI+ WKNYF+L GGF+DL   T+Y ND WLF++ ++KW 
Sbjct: 174 CSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYKWK 233

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS+I + EG +++GGYCKVKA   K L KGK LTDCW LKM  +
Sbjct: 234 QIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKAD 291

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
              I+WERR K+G QPSPRVGCSM +H   RGILFGGVYD EETEE L S++YNDL+SY 
Sbjct: 292 PTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           IE NRW+ L+LR   +              SK++EKELQDLLN+ILE+ +L D++     
Sbjct: 351 IEINRWFALQLRPQRKKVVRLNNKS-----SKDKEKELQDLLNQILEKANLNDKDDKDQE 405

Query: 413 GSNTPHEETTTDREQDDNE-------EEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIY 465
             +    ET  DR   D         E+ K +     L QLPH RFNA  TV+NDT +IY
Sbjct: 406 DEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIY 465

Query: 466 GGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXX 525
           GG+WE  + DYTIDSFYSIDLN+ DG+T  +E+L EIE  K  G V S            
Sbjct: 466 GGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDD 525

Query: 526 XXXXXXPT--NXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGP 583
                                             IPDP PWLPHPK FESLR FY+R G 
Sbjct: 526 EDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGA 585

Query: 584 KFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQS 643
            FLEWAISNN+ A+GKHLK+KSF+LCQDRWW+RRDQ++IEEDK++ELG  G++IE+D  S
Sbjct: 586 TFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDT-S 644

Query: 644 PPTARR 649
             T RR
Sbjct: 645 KSTKRR 650

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/598 (52%), Positives = 390/598 (65%), Gaps = 22/598 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           NFK EQEQFEKVVVE +  P+ R N  ++ N    K EL++FGGE T   T+ T F+NDL
Sbjct: 55  NFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDL 114

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
            V++P N QWK+ +SQNSPMPRSSAAM  H SGV +L GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 115 VVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
             T+EW+K++ KNGPSARSGHR+  WKN+ IL GGF+DL   T+Y ND WLF++  +KW 
Sbjct: 175 CATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS I   EG I++GGYCKVKA   K L KGK LTDCW LKMS N
Sbjct: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMSSN 292

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
            + I+W+R+ ++G QPSPRVGCSM  H+  RG+LFGGVYD EETEE L S +YND+++Y 
Sbjct: 293 TSAIRWDRKKRQGFQPSPRVGCSMVPHK-GRGVLFGGVYDFEETEESLESNFYNDVFTYQ 351

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           I  NRWY L LR   +              +K+QEKEL+DLLNKIL    L D+      
Sbjct: 352 INMNRWYSLSLRPQRKKQVKLNNRS-----TKDQEKELEDLLNKILRNAQLDDQ-----G 401

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
                     +   ++D++E E +      +N+LPH RFNA T V++DT +I+GG+WEF 
Sbjct: 402 EEEEIDAAEESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFG 461

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + DY+IDSFY IDLNK DG+T Y+E+L  +E  K     +                    
Sbjct: 462 EKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKD----EDDSDEDEGEEDDDDEEDSEE 517

Query: 533 TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592
                                    IPDPRPWLPHPKAFESLR FY+R G  FLEWAISN
Sbjct: 518 EQVDQKLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISN 577

Query: 593 NKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARRR 650
           N+H KGKHLK KSFE+C+ RWWERRDQ+++EEDKL+ELG  G+IIERD  +  T +RR
Sbjct: 578 NRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERD--TTKTKKRR 633

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/589 (52%), Positives = 399/589 (67%), Gaps = 16/589 (2%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           NFK EQE+FE+VVV  V  PT R N+ +V N    K ELLLFGGE TN+  + T FYNDL
Sbjct: 54  NFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDL 113

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
             Y+   +QW+K +SQNSPMPRSSAA+ +H SGV ++ GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 114 FTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
             T+EW+K++ KNGP+ARSGHR+T WKNYFIL GGF+DL   T+Y +D WLF++  +KW 
Sbjct: 174 CNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWK 233

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + +   N   PD RSGHS + + +G +++GGYCKVKA   K L KGK LTDCW LKM  +
Sbjct: 234 QVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKA--GKGLQKGKILTDCWYLKMKSD 291

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
           +  I+WERR K+G QPSPRVGCSM +H   RGILFGGV+D EETEE L S++YNDL+++ 
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQ 350

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           IE+NRWY   LR   +              ++ ++KEL+D+LN+ILE+ +L D+E    +
Sbjct: 351 IETNRWYSASLRPQRKAAKATSKN------NRNKDKELEDILNQILEKANLNDDENEKET 404

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
             +   E    + + D  EE    +   P   QLPH RFNA T V++DT +I+GG+WE  
Sbjct: 405 IGDVLKE--LDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIG 462

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + DY+IDSFY+IDLN+LDGI  Y+E+L++IE  K LGD +                    
Sbjct: 463 EKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEI 522

Query: 533 TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592
           T+                       IPDPRPWLPHPK FE+LR FY+R G  FLEWAIS+
Sbjct: 523 TD--QKLVAEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISS 580

Query: 593 NKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDA 641
           N+ A+GKHLK+KSF+LCQDRWWERRDQ++IEEDKL+ELG  G+++E+D 
Sbjct: 581 NRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDT 629

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/602 (51%), Positives = 400/602 (66%), Gaps = 23/602 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           NFK +Q +FE V VE V  P  R+++ LV N   +K EL+LFGGE TN  T MT FYNDL
Sbjct: 54  NFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDL 113

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
            +Y+   +QWKK+TSQNSPMPRSSAA+ +H SGV ++ GGEFSSPKQNTFYHY+DTWL D
Sbjct: 114 FIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFD 173

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
             T EW+K++ KNGPS+RSGHR+T WKNY IL GGF+DL   T+Y ND WLF++  +KW 
Sbjct: 174 CATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + +   N   PD RSGHS + + EG I++GGYCKVKA   K L KGK LTDCW LKM  +
Sbjct: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMKSD 291

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
           V  I+WERR K+G QPS R GCSM +H   RGILFGGVYD EETEE L S++YNDL++Y+
Sbjct: 292 VTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYH 350

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           IE+NRWY + LR                  +++++KEL+D+LN IL++ +L D++ +   
Sbjct: 351 IETNRWYSVSLRAQRHSKVKSAPKS-----NRDKDKELEDMLNAILKKANLDDDDGDEDG 405

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
            +    EE     E D   E E+ + + P + +LPH RFNA T +++DT +I+GG+WE  
Sbjct: 406 KTI---EEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQG 462

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + DY IDSFYSID+NK+DG+  Y+E++  +E  K LG+                      
Sbjct: 463 EKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEH 522

Query: 533 TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592
           ++                       IPDPRPWLPHPKAFESLR FY+R G  FLEWAI+ 
Sbjct: 523 SD--RKLVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAIT- 579

Query: 593 NKH-----AKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTA 647
           NKH     AKGKHLK+ SF+LCQ+RWWERR+Q++IEEDKL+ELG  G++IE+D  + PT 
Sbjct: 580 NKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDF-TKPTK 638

Query: 648 RR 649
           RR
Sbjct: 639 RR 640

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/602 (51%), Positives = 399/602 (66%), Gaps = 21/602 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNAS--KPELLLFGGERTNNETNMTKFYNDL 113
           NF+ EQE F++VVV  V  P+PR+N C+V N S  K ELL+FGGE TN  ++ T FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
             Y+   +QWKK TS+N+PMPRSSAA   H SGV ++ GGEFSSPKQNTFYHY+D+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            +++EW+K+D KNGPSARSGHR+T WKN+F++ GGF+DL   T+Y ND WLF++  +KW 
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS I + EG IV+GGYCK+KAK  K L KGK LTDCW L+M  +
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAK--KGLQKGKILTDCWYLRMKSD 291

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
           +  I+WERR K+G QPSPRVGCSMA H   RGILFGGVYD EETEE LSS ++NDL SY 
Sbjct: 292 ITGIRWERRKKQGFQPSPRVGCSMA-HHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQ 350

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           +E+NRWY +K+R   +              +K ++ EL  +LN IL++ +L DEE     
Sbjct: 351 VEANRWYSIKMRPQKKKIVAASKS------AKSKDDELVGILNDILQKANLADEENEENE 404

Query: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472
             +   +E       D+ E     +   P + QLPH RFNA TTV++DT +I+GG WE+ 
Sbjct: 405 SDSEIEKEL---HRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYG 461

Query: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXXP 532
           + D++IDSFYSIDLN+ DG+  ++E+L+EIE+ K  G  +                    
Sbjct: 462 ERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETL 521

Query: 533 -----TNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLE 587
                                         IPDPRPWLPHPKAFE+LR FYIR G +FL+
Sbjct: 522 DEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQ 581

Query: 588 WAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTA 647
           WAISNN+ AKGKHLK++SF+L QDRWWERR+Q++IEEDKL+E+G   +IIERD+ S  T 
Sbjct: 582 WAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDS-SHSTK 640

Query: 648 RR 649
           RR
Sbjct: 641 RR 642

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/599 (50%), Positives = 397/599 (66%), Gaps = 15/599 (2%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNAS--KPELLLFGGERTNNETNMTKFYNDL 113
           NFK EQE FEK+ VE V  P  R N C+  N +  K EL++FGGE T  ET  T FYNDL
Sbjct: 53  NFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDL 112

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
            VY+   + WK++TSQNSPMPRSSAA+ SH +GV ++ GGEFSSPKQNTFYHY+D+WL D
Sbjct: 113 FVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFD 172

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            +++EW+K++ KNGPSARSGHR+  WKN+ IL GGF+DL   T+Y ND+W+F++ ++KW 
Sbjct: 173 CSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232

Query: 234 KWET-TNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
           + E   N   PD RSGHS I + EG ++YGGY KVKA   K L KGK L+DCW LKM  +
Sbjct: 233 QVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKA--GKGLQKGKILSDCWYLKMKSD 290

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352
           +  I+WERR K+G QPSPRVGCSM +H   RG+LFGGVYD EETEE L SI+YN+LY+Y 
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQ 349

Query: 353 IESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412
           IE+NRWY + LR   +              ++ ++KEL+D+LN+IL++ +L+D E +  S
Sbjct: 350 IENNRWYAMSLRPQRKKKNFVQSKS-----NRNKDKELEDILNQILDKANLRDAEDDDES 404

Query: 413 GSNTPH-EETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEF 471
                   +       DD+E ++K   +   ++ LPH RFNA T V++DT +I+GG  E 
Sbjct: 405 KVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEI 464

Query: 472 KDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSXXXXXXXXXXXXXXXXXX 531
            + DY IDSFYSID+NKLDG+  Y+E L+E+E  ++LG+ Q                   
Sbjct: 465 GEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGE-QDSDDEFGDEDDDDEDDGEE 523

Query: 532 PTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEWAIS 591
                                     IPD RPWLPHPKAFE+LR FY+R GP FLE AIS
Sbjct: 524 EIVDSKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAIS 583

Query: 592 NNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARRR 650
           +N+ +KGKHLK KSFELCQDRWWERR+Q++IEEDKL+ELG   D+IE+D  +  T RRR
Sbjct: 584 SNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD--TSKTQRRR 640

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/623 (50%), Positives = 411/623 (65%), Gaps = 24/623 (3%)

Query: 31  DQKRVKKFGXXXXXXXXXXXXXXXQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--S 88
           D+KR KK G                NFK EQE F++V+V  V  P+ R N+C+V N    
Sbjct: 57  DKKRSKKLGSEDDDDLDIDEVLA--NFKKEQELFQEVLVTPVERPSQRINSCMVANPIHG 114

Query: 89  KPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVT 148
           K ELL+FGGE TN+  ++T FYN+L  Y+  ++QW+K TS+NSPMPRSSAA  +H SGV 
Sbjct: 115 KRELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVA 174

Query: 149 ILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGG 208
           ++ GGEFSSPKQNTFYHY+DTWLLD TT+EW+K++ KNGPSARSGHR+T WKN+FIL GG
Sbjct: 175 LIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGG 234

Query: 209 FKDLNQGTSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKV 267
           F+DL   T+Y ND+W+F++  +KW + E   N   PD RSGHS I + +G +++GGYCKV
Sbjct: 235 FRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKV 294

Query: 268 KAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILF 327
           KA   K L KGKTLTDCW LKM  +V+ I+WERR K+G QPSPRVGCSM +H   RG+LF
Sbjct: 295 KA--GKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLF 351

Query: 328 GGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQE 387
           GGVYD EETEE L+S ++NDL+SY +E+NRWY +K+R   +              ++ ++
Sbjct: 352 GGVYDFEETEEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRN------NRNKD 405

Query: 388 KELQDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLP 447
           +EL+++LN IL+Q +L      +    +  +E     +  D+ E  E  R     + QLP
Sbjct: 406 EELENILNDILQQANL------ADDTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLP 459

Query: 448 HERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKR 507
           H RFNA T V++D  +I+GG+WEF + D++IDSFYSIDLNKLDG+  Y+ENL E+E+ K 
Sbjct: 460 HPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKA 519

Query: 508 LGDVQSXXXXXXXXXXXXXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPH 567
           LG+                      T                        IPD RPWLPH
Sbjct: 520 LGEDDEEEFDDDEDDDDDDEEEE--TADQKLVAEDEEEEEEEEEEEDEPEIPDLRPWLPH 577

Query: 568 PKAFESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKL 627
           PK FE+LR FYIR G +FL+WAISNN+ AKGKHLK++SF+LCQDRWWERR+QI+IEEDKL
Sbjct: 578 PKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKL 637

Query: 628 QELGVGGDIIERDAQSPPTARRR 650
           +ELG   +++ERD     T +RR
Sbjct: 638 EELGGVENVVERDPAQ--TMKRR 658

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/601 (47%), Positives = 384/601 (63%), Gaps = 13/601 (2%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           +F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T+ ET +T FYNDL
Sbjct: 57  SFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + Y+ +NN WKK+ SQN+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 174 NTTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVD 229
              R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++  
Sbjct: 177 CVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIST 236

Query: 230 FKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289
           +KWTK ET +K  PD RSGH +I ++   I+ GGYCK+ AKNNK+L KGK L D W L +
Sbjct: 237 YKWTKLETNSK--PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294

Query: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349
           + +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YNDLY
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354

Query: 350 SYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETN 409
            +++E N+W  L+++   Q              +K+QEKELQDLLN IL +++L D++ +
Sbjct: 355 MFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDD 414

Query: 410 SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMW 469
           +   S T    +  D E ++++ +   + ++   NQLPH RFNA T V+ D+ +IY G+W
Sbjct: 415 NDDNSTT-GPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVW 473

Query: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD-VQSXXXXXXXXXXXXXXX 528
           E  + DY I+SFYSIDLNKLDG+  Y+E+L  IEE KRLGD                   
Sbjct: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDD 533

Query: 529 XXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPKFLEW 588
                +                       IPD R WLPHPK FE+LR FY+REG  FL W
Sbjct: 534 GEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 593

Query: 589 AISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTAR 648
           +ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERD  + P+ R
Sbjct: 594 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDTTTKPSKR 650

Query: 649 R 649
           R
Sbjct: 651 R 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/608 (46%), Positives = 385/608 (63%), Gaps = 24/608 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           +F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T+ ET +T FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + Y+ +NN WKK+ SQN+P+PRSS A+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 174 NTTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVD 229
              ++++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ +
Sbjct: 177 CHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISN 236

Query: 230 FKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289
           +KWTK ET  K  PD RSGH ++ ++   I+ GGYCK  AKNNK+L KGK L D W L +
Sbjct: 237 YKWTKLETNTK--PDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294

Query: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349
           + +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L SI+YNDLY
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354

Query: 350 SYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDL------ 403
            +++E N+W  L+++                  +K+QEKELQDLLN IL +++L      
Sbjct: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDD 414

Query: 404 KDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFY 463
            D+ T + +G+N+ ++E   + + D   +E     N+   NQLPH RFNA T V++D+ +
Sbjct: 415 NDDSTATTTGANSSNDEGDDEDDSDFENQE-----NITISNQLPHPRFNAATCVVDDSLF 469

Query: 464 IYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD--VQSXXXXXXXX 521
           IY G+WE  + DY I+SFYSIDLNKLDG+  Y+E+L  +EE KRLGD             
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 522 XXXXXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIRE 581
                     P +                       IPD R WLPHPK FE+LR FY+RE
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 582 GPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDA 641
           G  FL W+ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERDA
Sbjct: 590 GANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDA 646

Query: 642 QSPPTARR 649
            + P+ RR
Sbjct: 647 TAKPSKRR 654

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/605 (46%), Positives = 384/605 (63%), Gaps = 21/605 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           +F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T++ET +T FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDL 116

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + Y+ +NN WKK+ SQN+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 174 NTTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVD 229
              R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ +
Sbjct: 177 CVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISN 236

Query: 230 FKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289
           +KW+K ET +K  PD RSGH +I ++   I+ GGYCK  AKNNK+L KGK L D W L +
Sbjct: 237 YKWSKIETNSK--PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294

Query: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349
           + +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YNDLY
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354

Query: 350 SYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDLKDEETN 409
            +++E N+W  L+++   Q              +K+QEKELQDLLN IL +++L D++  
Sbjct: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDE 414

Query: 410 ----SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIY 465
               + +GSN+   +   + + D + +E+     +   NQLPH RFNA T V+ D+ +IY
Sbjct: 415 NDDYTATGSNSIDGDEDEEDDSDLDNQED-----ITISNQLPHPRFNAATCVVGDSLFIY 469

Query: 466 GGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD-VQSXXXXXXXXXXX 524
            G+WE  + DY I+SFYSIDLNKLDG+  Y+E L  IEE KRLGD               
Sbjct: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEED 529

Query: 525 XXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPK 584
                    +                       IPD R WLPHPK FE+LR FY+REG  
Sbjct: 530 DEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589

Query: 585 FLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSP 644
           FL W+ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERD  + 
Sbjct: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDVTTK 646

Query: 645 PTARR 649
           P+ RR
Sbjct: 647 PSKRR 651

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/605 (46%), Positives = 384/605 (63%), Gaps = 20/605 (3%)

Query: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113
           +F  +Q + E V +  V   + R +  +  N   +K EL +FGGE T+ ET +T FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDL 116

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173
           + Y+ +NN WKK+ S+N+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D
Sbjct: 117 YSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 174 NTTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVD 229
              R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ +
Sbjct: 177 CAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISN 236

Query: 230 FKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289
           +KWTK ET  K  P+ RSGH +I ++   I+ GGYCK+ AKNNK+L KGK L D W L +
Sbjct: 237 YKWTKLETNTK--PEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294

Query: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349
           + +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YNDLY
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354

Query: 350 SYNIESNRWYPLKLRKVTQXXXXXXXXXXXXTVSKEQEKELQDLLNKILEQNDL--KDEE 407
            +++E N+W  L+++   Q              +K+QEKELQDLLN IL +++L   D++
Sbjct: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDDD 414

Query: 408 TNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGG 467
            N+ +GSN+   +   + +  D +  E    N+   NQLPH RFNA T V++D+ +IY G
Sbjct: 415 DNTTTGSNSIDGDDEGEDDDSDLDNPE----NITISNQLPHPRFNAATCVVDDSLFIYSG 470

Query: 468 MWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGD---VQSXXXXXXXXXXX 524
           +WE  + DY I+SFYSIDLNKLDG+  Y+E+L  IEE KRLGD    +            
Sbjct: 471 VWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDD 530

Query: 525 XXXXXXXPTNXXXXXXXXXXXXXXXXXXXXXXXIPDPRPWLPHPKAFESLREFYIREGPK 584
                    +                       IPD R WLPHPK FE+LR FY+REG  
Sbjct: 531 GEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 590

Query: 585 FLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSP 644
           FL W+ISNNK  KGKHLK KSFE+C+DRWWERRDQ+ +EE++L++    G IIERD  + 
Sbjct: 591 FLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDT---GGIIERDTTTK 647

Query: 645 PTARR 649
            + RR
Sbjct: 648 ISKRR 652

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 30/198 (15%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVY------NPQNNQWKKFTSQN-SPM 133
           + + T   K +L LFGG+  +N      ++NDL +Y      NP + +W+   S+  +P 
Sbjct: 292 SVIATTPKKAKLYLFGGQLDDN------YFNDLAMYDLSDFRNPHS-RWQFLKSKAFTPP 344

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK-NGPSARS 192
           P ++  M ++   + + FGG      QN  Y Y           EW  L+ + + P    
Sbjct: 345 PLTNHTMVAYDYKLWV-FGGSSRGELQNQLYVYIPDL------NEWRCLETEGDKPQPIQ 397

Query: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW- 251
            H  T +KN   +FGG    N+   Y N ++  N+   KW + +T++ N+P PRSG S  
Sbjct: 398 EHSATIYKNLMCVFGG---KNKDDEYQNTMYFLNLQTLKWYRLDTSHCNEPLPRSGQSMS 454

Query: 252 IGSNEGPIVYGG----YC 265
           +  N+  ++ GG    YC
Sbjct: 455 LMQNDKILIMGGDKNDYC 472

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 111/260 (42%), Gaps = 50/260 (19%)

Query: 120 NNQWKKFTSQ------NSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL 171
           N+    FT+Q      N+P PR   +A +C +     ++FGG+            +D +L
Sbjct: 210 NSDSTNFTTQVIDLTVNTPPPRVGHAATLCGN---ALVIFGGDTHKLNSEGLLD-DDLYL 265

Query: 172 LDNTTREWS-KLDFKNGPSARSGHRI-----TTWKNYFILFGGFKDLNQGTSYFNDVWLF 225
            +  +  W+        P  R GH++     T  K    LFGG  D N    YFND+ ++
Sbjct: 266 FNVDSHRWTIPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLDDN----YFNDLAMY 321

Query: 226 NVVDFK--WTKWE--TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTL 281
           ++ DF+   ++W+   +    P P + H+ +  +    V+GG  + + +N   ++     
Sbjct: 322 DLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGELQNQLYVY----- 376

Query: 282 TDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLS 341
                     ++NE  W     +G +P P    S  +++N   + FGG    +E      
Sbjct: 377 --------IPDLNE--WRCLETEGDKPQPIQEHSATIYKNLMCV-FGGKNKDDE------ 419

Query: 342 SIYYNDLYSYNIESNRWYPL 361
             Y N +Y  N+++ +WY L
Sbjct: 420 --YQNTMYFLNLQTLKWYRL 437

 Score = 34.7 bits (78), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 5/84 (5%)

Query: 275 LHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLE 334
           LH      D W+L  + +      +        P PRVG +  L  N   I  G  + L 
Sbjct: 195 LHGELVYGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLN 254

Query: 335 ETEEDLSSIYYNDLYSYNIESNRW 358
                   +  +DLY +N++S+RW
Sbjct: 255 S-----EGLLDDDLYLFNVDSHRW 273

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 100/208 (48%), Gaps = 32/208 (15%)

Query: 72  VPHPTP-----RNNACLVTNASK---PELLLFGGERTNNETNMTKFYNDLHVYNPQ---- 119
           +PHP       R    +   ASK    EL LFGG+   +ET    ++NDL V++      
Sbjct: 186 IPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQI--DET----YFNDLAVFDLSSFRR 239

Query: 120 -NNQWKKFTSQNS-PMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTR 177
            N+ W+     ++ P P ++  M +  + + + FGGE  +PK  +    NDT+  D    
Sbjct: 240 PNSHWEFLEPISALPPPLTNHTMVTFDNKLWV-FGGE--TPKTIS----NDTYCYDPIQN 292

Query: 178 EWSKLDFKN-GPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWE 236
            WSK++     P     H    +K+   +FGG KD++   +Y NDV+  N++  KW K  
Sbjct: 293 AWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-KDIHN--TYSNDVYFLNLLSLKWFKLP 349

Query: 237 TTNKNQPDPRSGHSW-IGSNEGPIVYGG 263
              +  P  RSGHS  + +NE  ++ GG
Sbjct: 350 CVKEGIPQERSGHSLTLMNNEKLVIMGG 377

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 104/245 (42%), Gaps = 44/245 (17%)

Query: 129 QNSPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS-KLDFK 185
            N+P PR   ++ MC +     ++FGG+     +N     +D +L +  + +W+      
Sbjct: 136 HNTPPPRVGHASTMCGN---AYVVFGGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIG 191

Query: 186 NGPSARSGHRITTWKNY-----FILFGGFKDLNQGTSYFNDVWLFNVVDFKW--TKWETT 238
           + P  R GH+I+   +        LFGG  D     +YFND+ +F++  F+   + WE  
Sbjct: 192 SRPLGRYGHKISIIASKQMHTELYLFGGQID----ETYFNDLAVFDLSSFRRPNSHWEFL 247

Query: 239 N--KNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
                 P P + H+ +  +    V+GG       N           D +     QN    
Sbjct: 248 EPISALPPPLTNHTMVTFDNKLWVFGGETPKTISN-----------DTYCYDPIQNA--- 293

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
            W +    G++P P    +  ++++   + FGG        +D+ + Y ND+Y  N+ S 
Sbjct: 294 -WSKVETTGEKPPPVQEHASVVYKHLMCV-FGG--------KDIHNTYSNDVYFLNLLSL 343

Query: 357 RWYPL 361
           +W+ L
Sbjct: 344 KWFKL 348

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 83/203 (40%), Gaps = 29/203 (14%)

Query: 69  VELVPHPTP----RNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWK 124
           V+ VP   P    +N+  +VT    P       +  N     T   + L   N +   W 
Sbjct: 21  VQTVPRAMPLMDKQNSTRIVTPTLPP------NQHRNISGASTNLPSPLERKNSRRYIWN 74

Query: 125 KFTSQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD---NTTREW 179
           +   ++SP PR   S++  +       + GG +          Y D W +    N T   
Sbjct: 75  RIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYDQSV------YGDVWEITANANGTSFT 128

Query: 180 SK---LDFKNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWTKW 235
           SK   +D  N P  R GH  T   N +++FGG    LN+     +D++LFN+  +KWT  
Sbjct: 129 SKRIQIDH-NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWTIP 187

Query: 236 ETTNKNQPDPRSGH--SWIGSNE 256
                ++P  R GH  S I S +
Sbjct: 188 HPIG-SRPLGRYGHKISIIASKQ 209

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 48/121 (39%), Gaps = 17/121 (14%)

Query: 240 KNQPDPRSGHS--WIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIK 297
           K+ P PR  HS  +I +N+  I   G           L+      D W +  + N     
Sbjct: 79  KDSPFPRYRHSSSFITTNDNRIFVTG----------GLYDQSVYGDVWEITANANGTSFT 128

Query: 298 WERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNR 357
            +R       P PRVG +  +  N   +  G  + L +     + +  +DLY +NI S +
Sbjct: 129 SKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNK-----NRLLDDDLYLFNINSYK 183

Query: 358 W 358
           W
Sbjct: 184 W 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 88/186 (47%), Gaps = 14/186 (7%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNS-PMPRSSAA 139
           + +  N  + +L LFGG+      N    + DL  +  +N+ W+      + P P ++  
Sbjct: 201 SIIAYNPMQTKLYLFGGQLDKTYFNDLAMF-DLSSFRRRNSHWEFLEPATTVPPPLANHT 259

Query: 140 MCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNG-PSARSGHRITT 198
           M ++ + + + FGGE  +PK  +    N+T+  D    +WSK++     P     H    
Sbjct: 260 MVTYGNKLWV-FGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQEHASVV 312

Query: 199 WKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-IGSNEG 257
           +K+   +FGG    N   +Y NDV+  +++ FKW K     +  P  RSGHS  +  NE 
Sbjct: 313 YKHIMCVFGGKYTHN---AYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHSLTLMKNEK 369

Query: 258 PIVYGG 263
            ++ GG
Sbjct: 370 ILIMGG 375

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 79/189 (41%), Gaps = 33/189 (17%)

Query: 179 WSKLDFKNGPSARSGHR---ITTWKNYFILFGGFKDLNQGTSYFNDVWLF--NVVDFKWT 233
           W+++  K+ P  R  H    I + +N   + GG    NQ  S + DVW    N     +T
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGL--YNQ--SVYGDVWQITANADGTSFT 126

Query: 234 -KWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292
            K    ++N P PR GH+        +V+GG       +   L++ K L D   L    N
Sbjct: 127 PKAIQIDRNTPPPRVGHASTLCGNAYVVFGG-------DTHKLNEDKLLDDDIYLF---N 176

Query: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNN----RGILFGGVYDLEETEEDLSSIYYNDL 348
           VN  KW      G +P  R G  +++   N    +  LFGG  D           Y+NDL
Sbjct: 177 VNSYKWTIPQPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQLD---------KTYFNDL 227

Query: 349 YSYNIESNR 357
             +++ S R
Sbjct: 228 AMFDLSSFR 236

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 19/137 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL----DNT 175
           W +   ++SP PR   SS+ + S ++ + +  GG ++         Y D W +    D T
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVT-GGLYNQSV------YGDVWQITANADGT 123

Query: 176 --TREWSKLDFKNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW 232
             T +  ++D +N P  R GH  T   N +++FGG    LN+     +D++LFNV  +KW
Sbjct: 124 SFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 233 TKWETTNKNQPDPRSGH 249
           T  +    ++P  R GH
Sbjct: 183 TIPQPIG-SRPLGRYGH 198

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 102/245 (41%), Gaps = 44/245 (17%)

Query: 129 QNSPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS-KLDFK 185
           +N+P PR   ++ +C +     ++FGG+     ++     +D +L +  + +W+      
Sbjct: 134 RNTPPPRVGHASTLCGN---AYVVFGGDTHKLNEDKLLD-DDIYLFNVNSYKWTIPQPIG 189

Query: 186 NGPSARSGHRITT-----WKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKW--TKWE-- 236
           + P  R GH+I+       +    LFGG  D     +YFND+ +F++  F+   + WE  
Sbjct: 190 SRPLGRYGHKISIIAYNPMQTKLYLFGGQLD----KTYFNDLAMFDLSSFRRRNSHWEFL 245

Query: 237 TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
                 P P + H+ +       V+GG       N          T C+     QN    
Sbjct: 246 EPATTVPPPLANHTMVTYGNKLWVFGGETPKTVSNE---------TYCY--DPIQN---- 290

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
            W +    G+ P P    +  ++++   + FGG Y          + Y ND+Y  ++ S 
Sbjct: 291 DWSKIETTGEIPPPVQEHASVVYKHIMCV-FGGKYT--------HNAYSNDVYFLDLLSF 341

Query: 357 RWYPL 361
           +WY L
Sbjct: 342 KWYKL 346

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 87/186 (46%), Gaps = 14/186 (7%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQN-SPMPRSSAA 139
           + +  N  + +L LFGG+      N    + DL  +   N+ W      +  P P ++  
Sbjct: 203 SIIANNPMQTKLFLFGGQIDETYFNDLAMF-DLSSFRRPNSHWVFLKPVSIVPPPLTNHT 261

Query: 140 MCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN-GPSARSGHRITT 198
           M +  + + + FGG+  +P  NT    N+T+  D    +WSK+      P A   H    
Sbjct: 262 MVTFDNKLWV-FGGK--TP--NTLS--NETFCYDPVQNDWSKIQTTGERPPAVQEHASVV 314

Query: 199 WKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-IGSNEG 257
           +K+   +FGG KD+    +Y NDV+  N++ FKW K     +  P  RSGHS  +  N+ 
Sbjct: 315 YKHLMCIFGG-KDIQN--AYSNDVYFLNLITFKWYKLPRIKEGLPKERSGHSLTLIKNDK 371

Query: 258 PIVYGG 263
            ++ GG
Sbjct: 372 LVIMGG 377

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 103/246 (41%), Gaps = 46/246 (18%)

Query: 129 QNSPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS-KLDFK 185
           QN+P PR   ++ +C +     ++FGG+      N     +D +L +  + +W+      
Sbjct: 136 QNTPPPRVGHASTICGN---AYVVFGGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 186 NGPSARSGHRITTWKN-----YFILFGGFKDLNQGTSYFNDVWLFNVVDFK-----WTKW 235
             P  R GH+I+   N        LFGG  D     +YFND+ +F++  F+     W   
Sbjct: 192 TRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFNDLAMFDLSSFRRPNSHWVFL 247

Query: 236 ETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNE 295
           +  +   P P + H+ +  +    V+GG       N          T C+     QN   
Sbjct: 248 KPVSI-VPPPLTNHTMVTFDNKLWVFGGKTPNTLSNE---------TFCY--DPVQN--- 292

Query: 296 IKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIES 355
             W +    G++P P V    ++   +   +FGG        +D+ + Y ND+Y  N+ +
Sbjct: 293 -DWSKIQTTGERP-PAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNLIT 342

Query: 356 NRWYPL 361
            +WY L
Sbjct: 343 FKWYKL 348

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 66/144 (45%), Gaps = 19/144 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL----LDNT 175
           W +   +NSP PR   S++ + ++ + + +  G        +    Y DTW     LD T
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG-------LHDHLVYGDTWQITGNLDGT 125

Query: 176 TREWSKLDF-KNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +     +   +N P  R GH  T   N +++FGG    LN      +D++LFN+  +KWT
Sbjct: 126 SFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWT 185

Query: 234 KWETTNKNQPDPRSGH--SWIGSN 255
             +     +P  R GH  S I +N
Sbjct: 186 IPQPVG-TRPLGRYGHKISIIANN 208

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 92/191 (48%), Gaps = 24/191 (12%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQNS-PMP 134
           + + +N  + +L LFGG+   +ET    ++NDL V++       N+ W+        P P
Sbjct: 203 SIIASNPMQTKLYLFGGQV--DET----YFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPP 256

Query: 135 RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN-GPSARSG 193
            ++  M ++ + + + FGGE  +PK  +    NDT+  D    EWSK+      P     
Sbjct: 257 LTNHTMVAYDNKLWV-FGGE--TPKTIS----NDTYRYDPAQSEWSKVKTTGEKPPPIQE 309

Query: 194 HRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-I 252
           H    +K+   + GG KD +   +Y NDV+  N++  KW K     +  P  RSGHS  +
Sbjct: 310 HASVVYKHLMCVLGG-KDTHN--AYSNDVYFLNLLSLKWYKLPRMKEGIPQERSGHSLTL 366

Query: 253 GSNEGPIVYGG 263
             NE  ++ GG
Sbjct: 367 MKNEKLLIMGG 377

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 109/257 (42%), Gaps = 48/257 (18%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL----DNT 175
           W +   +NSP PR   SS+ + ++ + + +  G    S        Y D W +    D T
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 176 TREWSKLDF-KNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +    ++D  +N P  R GH  T   N +++FGG    LN+     +D++LFN+  +KWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 234 KWETTNKNQPDPRSGH--SWIGSNEGPI-----VYGGYCKVKAKNNKSLHKGKTLTDCWI 286
             +   + +P  R GH  S I SN  P+     ++GG       N           D  +
Sbjct: 186 IPQPIGR-RPLGRYGHKISIIASN--PMQTKLYLFGGQVDETYFN-----------DLVV 231

Query: 287 LKMSQ-NVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYY 345
             +S        WE     G  P P    +M  + +N+  +FGG     ET + +S    
Sbjct: 232 FDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAY-DNKLWVFGG-----ETPKTIS---- 281

Query: 346 NDLYSYNIESNRWYPLK 362
           ND Y Y+   + W  +K
Sbjct: 282 NDTYRYDPAQSEWSKVK 298

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 105/245 (42%), Gaps = 44/245 (17%)

Query: 129 QNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS-KLDFK 185
           QN+P PR   ++ +C +     ++FGG+     +N     +D +L +  + +W+      
Sbjct: 136 QNTPPPRVGHASTICGN---AYVVFGGDTHKLNKNGLLD-DDLYLFNINSYKWTIPQPIG 191

Query: 186 NGPSARSGHRITT-----WKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKW--TKWETT 238
             P  R GH+I+       +    LFGG  D     +YFND+ +F++  F+   + WE  
Sbjct: 192 RRPLGRYGHKISIIASNPMQTKLYLFGGQVD----ETYFNDLVVFDLSSFRRPNSHWEFL 247

Query: 239 NK--NQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
               + P P + H+ +  +    V+GG       N           D +    +Q+    
Sbjct: 248 EPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTISN-----------DTYRYDPAQS---- 292

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
           +W +    G++P P    +  ++++   +L G         +D  + Y ND+Y  N+ S 
Sbjct: 293 EWSKVKTTGEKPPPIQEHASVVYKHLMCVLGG---------KDTHNAYSNDVYFLNLLSL 343

Query: 357 RWYPL 361
           +WY L
Sbjct: 344 KWYKL 348

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 106/244 (43%), Gaps = 46/244 (18%)

Query: 129 QNSPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLD-FK 185
           +N+P PR   +A +C +     I+FGG+     +      +D +L +  + +W+  +   
Sbjct: 202 ENTPPPRVGHAATLCGN---AFIVFGGDTHKVNKEGLMD-DDIYLFNINSYKWTIPNPIG 257

Query: 186 NGPSARSGHRI-----TTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW--TKWET 237
             P  R GH+I     +T K    LFGG F D     +YFND+ +F++  F+   + WE 
Sbjct: 258 PRPLGRYGHKICILATSTVKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEF 312

Query: 238 TNKN--QPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNE 295
                  P P + H+ +       +YGG  +    N+             I K S N N 
Sbjct: 313 IKSKGFMPPPLTNHTMVTYGSDLWIYGGDTQQGLIND-------------IFKFSPNTN- 358

Query: 296 IKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIES 355
             W +    G +P P    +  +++N   ++ G         +D + +Y N +Y +N +S
Sbjct: 359 -TWTKVETTGTKPPPMQEHAAVVYKNIMCVVGG---------KDENDMYLNSVYLFNFDS 408

Query: 356 NRWY 359
           ++WY
Sbjct: 409 SKWY 412

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 91/202 (45%), Gaps = 27/202 (13%)

Query: 73  PHPTPR--NNAC-LVTNASKPELLLFGGERTNNETNMTKFYNDLHVYN-----PQNNQWK 124
           P P  R  +  C L T+  K +L LFGG+  +       ++NDL V++      Q++ W+
Sbjct: 258 PRPLGRYGHKICILATSTVKTKLYLFGGQFDDT------YFNDLAVFDLSSFRRQDSHWE 311

Query: 125 KFTSQN-SPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLD 183
              S+   P P ++  M ++ S + I +GG+    +Q      ND +     T  W+K++
Sbjct: 312 FIKSKGFMPPPLTNHTMVTYGSDLWI-YGGD---TQQGLI---NDIFKFSPNTNTWTKVE 364

Query: 184 FKNG-PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQ 242
                P     H    +KN   + GG KD N    Y N V+LFN    KW  +       
Sbjct: 365 TTGTKPPPMQEHAAVVYKNIMCVVGG-KDEND--MYLNSVYLFNFDSSKWYTFPDFKSGI 421

Query: 243 PDPRSGHSW-IGSNEGPIVYGG 263
              RSGHS  + +N+  ++ GG
Sbjct: 422 IQGRSGHSVTLLNNDKLLIMGG 443

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 67/148 (45%), Gaps = 18/148 (12%)

Query: 112 DLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQS--GVTILFGGEFSSPKQNTFYHYNDT 169
           D H  +P    W +   QNSP PR      S+ S  G   + GG            Y DT
Sbjct: 150 DYHKLHP-TTIWNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDT 202

Query: 170 WLLD------NTTREWSKLDF-KNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFND 221
           W+L       +TT     +D  +N P  R GH  T   N F++FGG    +N+  S  +D
Sbjct: 203 WILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDD 262

Query: 222 VWLFNVVDFKWTKWETTNKNQPDPRSGH 249
           ++LFN+  +KWT  +   + +P  R GH
Sbjct: 263 IYLFNINSYKWTIPKPVGQ-RPLGRYGH 289

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 32/198 (16%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQNS--PM 133
           + + T+  K +L LFGG+  +       ++NDL V++       ++ W+ F    S  P 
Sbjct: 292 SIIATSQMKTKLYLFGGQFDDT------YFNDLVVFDLSSFRRPDSHWE-FIRPKSFIPP 344

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKL-------DFKN 186
           P ++  MCS+   + + FGG+      N  + Y      D    +W  +       D  N
Sbjct: 345 PLTNHTMCSYDHKLWV-FGGDTLQGLTNQVFMY------DPVDNDWCVVETFANNNDVSN 397

Query: 187 GPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPR 246
            P     H    +K+   + GG KD  +  +Y NDV+  N+   KW K     +  P  R
Sbjct: 398 IPPPIQEHAAVLYKDLMCVIGG-KD--ESDNYLNDVYFLNLKTLKWFKLPFYKEGVPQGR 454

Query: 247 SGHSW-IGSNEGPIVYGG 263
           SGHS  +  N+  ++ GG
Sbjct: 455 SGHSVTLLKNDKILIMGG 472

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 107/251 (42%), Gaps = 40/251 (15%)

Query: 128 SQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS-KLDF 184
           S+N+P PR   +A +C +     ++FGG+     ++     +D +L +  + +W+     
Sbjct: 224 SENTPPPRVGHAATLCGN---AFVIFGGDTHKVNKDGSMD-DDIYLFNINSYKWTIPKPV 279

Query: 185 KNGPSARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW--TKWE 236
              P  R GH+I+       K    LFGG F D     +YFND+ +F++  F+   + WE
Sbjct: 280 GQRPLGRYGHKISIIATSQMKTKLYLFGGQFDD-----TYFNDLVVFDLSSFRRPDSHWE 334

Query: 237 TTNKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVN 294
                   P P + H+    +    V+GG   ++   N+         D  +++   N N
Sbjct: 335 FIRPKSFIPPPLTNHTMCSYDHKLWVFGGDT-LQGLTNQVFMYDPVDNDWCVVETFANNN 393

Query: 295 EIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIE 354
           ++           P P    +  L+++   ++ G         +D S  Y ND+Y  N++
Sbjct: 394 DV--------SNIPPPIQEHAAVLYKDLMCVIGG---------KDESDNYLNDVYFLNLK 436

Query: 355 SNRWYPLKLRK 365
           + +W+ L   K
Sbjct: 437 TLKWFKLPFYK 447

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 126/300 (42%), Gaps = 63/300 (21%)

Query: 68  VVELVPHPTPRNNACLVTNASKPELLLFGGE--RTNNETNMTKFYNDLHVYNPQNNQWKK 125
           + E  P P   + A L  NA     ++FGG+  + N+E  M    +DL+++N  + +W  
Sbjct: 155 ISEFTPPPRVGHAATLCGNA----FVIFGGDTHKVNSEGLMD---DDLYLFNINSFKW-- 205

Query: 126 FTSQNSPMPRSSAAMCSHQSGVTI-----------LFGGEFSSPKQNTFYHYNDTWLLDN 174
                 P P     +  +   ++I           LFGG+F     +TF++    + L +
Sbjct: 206 ----TIPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQFD----DTFFNDLAVYDLSS 257

Query: 175 TTREWSKLDFKNG----PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230
             R  S  +F       P   + H + ++ +   +FGG  D  QG    N V++++++  
Sbjct: 258 FRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--DTMQG--LINKVFVYDIMSN 313

Query: 231 KWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290
            W+  ETT   +P P   H+ +      I     C V  K+ + ++    L   + L   
Sbjct: 314 DWSLVETTGA-RPPPLQEHAAL------IYKDLMCVVGGKDEQDIY----LNSIYFL--- 359

Query: 291 QNVNEIKWER-RAKKGQQPSPRVGCSMALHRNNRGILFG---------GVYDLEETEEDL 340
            N+   +W +    K   P  R G S+ L +NN+ ++ G         G YDL  +E D+
Sbjct: 360 -NLKSCRWFKFPVFKAGIPQGRSGHSITLLKNNKILIMGGDKFDYACQGEYDLSTSETDM 418

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 128/348 (36%), Gaps = 80/348 (22%)

Query: 73  PHPTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSP 132
           PH  PR         + P       ++ N     T        Y P    W +   Q+SP
Sbjct: 53  PHSEPRQQQQFRVYPTPP-----SSQQRNVSGASTSLVQPQREYTP----WNRVKLQDSP 103

Query: 133 MPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTTREWSK-LDFK 185
            PR    +++  S  + + ++ G    S        Y DTW++   D+ T+  SK +D  
Sbjct: 104 FPRYRHVASSYVSDDNRIYVIGGLHDESV-------YGDTWIINVDDSGTQFSSKTVDIS 156

Query: 186 N-GPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQP 243
              P  R GH  T   N F++FGG    +N      +D++LFN+  FKWT        +P
Sbjct: 157 EFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWTIPHPVGP-RP 215

Query: 244 DPRSGH--SWIGSNEGPI---VYGGYCKVKAKNNKSLH---------------KGKTLT- 282
             R GH  S I +N+      ++GG       N+ +++               K KT   
Sbjct: 216 LGRYGHKISIIATNQMKTKLYLFGGQFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVP 275

Query: 283 -------------DCWIL---KMSQNVNEI--------KWERRAKKGQQPSPRVGCSMAL 318
                          WI     M   +N++         W      G +P P    +  +
Sbjct: 276 PPLANHTMVSYDHKLWIFGGDTMQGLINKVFVYDIMSNDWSLVETTGARPPPLQEHAALI 335

Query: 319 HRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKV 366
           +++   ++ G         +D   IY N +Y  N++S RW+   + K 
Sbjct: 336 YKDLMCVVGG---------KDEQDIYLNSIYFLNLKSCRWFKFPVFKA 374

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 88/193 (45%), Gaps = 31/193 (16%)

Query: 72  VPHPT-PR-------NNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ---- 119
           +PHP  PR         + + T+  K +L +FGG+  +       ++NDL VY+      
Sbjct: 186 IPHPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQFDDT------YFNDLCVYDLSSFRR 239

Query: 120 -NNQWKKFTSQN-SPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTR 177
            ++ W+    Q+  P P ++  M S+   + I FGG+ +   Q      N+ ++ D T  
Sbjct: 240 PDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWI-FGGDTA---QGLI---NEVFMYDPTVN 292

Query: 178 EWSKLDFKNG-PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWE 236
           +W+ ++     P A   H    +K+   + GG KD  +  SY NDV+  N+  FKW K  
Sbjct: 293 DWTVVETTGSKPPAIQEHAAVVYKDLMCVTGG-KD--EQDSYSNDVYFLNLKSFKWFKLP 349

Query: 237 TTNKNQPDPRSGH 249
                 P  RSGH
Sbjct: 350 FFKNGVPQGRSGH 362

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 78/164 (47%), Gaps = 28/164 (17%)

Query: 115 VYNPQNNQWKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWL 171
           VY+P    W +    +SP PR    ++A  S Q+ V ++ G    S        Y DTW+
Sbjct: 69  VYSP----WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV-------YGDTWI 117

Query: 172 LD---NTTREWSK-LDFKNG-PSARSGHRITTWKNYFILFGG--FKDLNQGTSYFNDVWL 224
           L    N TR  SK +D  +  P  R GH  T   N F++FGG   K  N+G    +DV+L
Sbjct: 118 LTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGL-MDDDVYL 176

Query: 225 FNVVDFKWTKWETTNKNQPDPRSGH--SWIGSNEGPI---VYGG 263
           FN+  +KWT        +P  R GH  S I +++      V+GG
Sbjct: 177 FNINSYKWTIPHPVGP-RPLGRYGHKISVIATSQMKTKLYVFGG 219

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 96/212 (45%), Gaps = 27/212 (12%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQNS--PM 133
           + + T  SK  L LFGG+  +       ++NDL V++       +++W+ F    S  P 
Sbjct: 264 SIIATANSKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWE-FVKPKSFVPP 316

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSG 193
           P ++  M S+ + + + FGG+      N  + Y D  + D TT E S  +  N       
Sbjct: 317 PLTNHTMVSYDNKLWV-FGGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQE 374

Query: 194 HRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-I 252
           H    +K+   +FGG KD  +  +Y N V+  N+   KW K        P  RSGHS  +
Sbjct: 375 HAAIVYKDLMCIFGG-KD--EQDTYLNGVYFLNLRTLKWYKLPIFAPGIPQGRSGHSITL 431

Query: 253 GSNEGPIVYGG----YCKVKAKNNKSLHKGKT 280
             N+  ++ GG    Y +V   +N  LH  +T
Sbjct: 432 LKNDKLLIMGGDKFDYARV---DNFDLHTSET 460

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 114/275 (41%), Gaps = 51/275 (18%)

Query: 109 FYNDLHVYNPQNNQWKKFTSQ------NSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQ 160
            Y D  +   +NN   +F SQ      N+P PR   +A +C +     I+FGG+     +
Sbjct: 172 VYGDTWILTSENNA-SRFISQTVDISDNTPPPRVGHAATLCGN---AFIIFGGDTHKVNK 227

Query: 161 NTFYHYNDTWLLDNTTREWSKLD-FKNGPSARSGHRITTW-----KNYFILFGG-FKDLN 213
           +     +D +L +  + +W+  +     P  R GH+I+       K    LFGG F D  
Sbjct: 228 DGLMD-DDLYLFNINSHKWTIPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQFDD-- 284

Query: 214 QGTSYFNDVWLFNVVDFKW--TKWETTNKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKA 269
              +YFND+ +F++  F+   ++WE        P P + H+ +  +    V+GG   ++ 
Sbjct: 285 ---AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGGDT-LQG 340

Query: 270 KNNKSLHKGKTLTD-CWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFG 328
             N+       + D   I   S N N I            +P +    A+   +   +FG
Sbjct: 341 LTNRVFMYDPMINDWTTIETSSDNPNNI------------APPMQEHAAIVYKDLMCIFG 388

Query: 329 GVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKL 363
           G        +D    Y N +Y  N+ + +WY L +
Sbjct: 389 G--------KDEQDTYLNGVYFLNLRTLKWYKLPI 415

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 57/120 (47%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +    NSP PR    ++A  +    + ++ G    S        Y DTW+L   +N +
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSENNAS 186

Query: 177 REWSK-LDFK-NGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           R  S+ +D   N P  R GH  T   N FI+FGG    +N+     +D++LFN+   KWT
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 50/121 (41%), Gaps = 19/121 (15%)

Query: 241 NQPDPRSGH---SWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIK 297
           N P PR  H   ++   ++   V GG           LH      D WIL    N +   
Sbjct: 141 NSPFPRYRHVASAYATEDDKIYVIGG-----------LHDQSVYGDTWILTSENNASRFI 189

Query: 298 WERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNR 357
            +        P PRVG +  L   N  I+FGG  D  +  +D   +  +DLY +NI S++
Sbjct: 190 SQTVDISDNTPPPRVGHAATLC-GNAFIIFGG--DTHKVNKD--GLMDDDLYLFNINSHK 244

Query: 358 W 358
           W
Sbjct: 245 W 245

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +   QNSP PR    +++ CS  + + ++ G    S        Y DTW++   DN T
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWIISTNDNGT 193

Query: 177 REWSKLD--FKNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +  SK     +  P  R GH  T   N F+LFGG    +N      +D++LFNV  +KWT
Sbjct: 194 QFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKWT 253

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 91/210 (43%), Gaps = 36/210 (17%)

Query: 72  VPHPT-PR-------NNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ---- 119
           +PHP  PR         + +  N  K +L LFGG+  +       ++NDL V++      
Sbjct: 254 IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFDDT------YFNDLAVFDLSSFRR 307

Query: 120 -NNQWKKFTSQN-SPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHY---NDTWLLDN 174
            ++ W+       SP P ++  M S+ + + + FGG+      N  + Y   N+ W +  
Sbjct: 308 PDSHWEFLKPTTFSPPPLTNHTMISYDNHLWV-FGGDTLQGLINQVFKYDVANNDWSIAE 366

Query: 175 TTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTK 234
           TT           P     H    +K+  ++ GG KD  +  +Y N V+  N+   +W K
Sbjct: 367 TT--------GTKPPPMQEHAAVVYKHVMVVVGG-KD--EHDTYLNSVYFLNLKTHEWFK 415

Query: 235 WETTNKNQPDPRSGHSW-IGSNEGPIVYGG 263
             T     P  RSGHS  + +N+  ++ GG
Sbjct: 416 LPTFKAGIPQGRSGHSLTLLNNDKLLIMGG 445

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 100/253 (39%), Gaps = 48/253 (18%)

Query: 128 SQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK 185
           S+ +P PR   +A +C +     +LFGG+            +D +L +  + +W+ +   
Sbjct: 203 SETTPPPRVGHAATLCGN---AFVLFGGDTHKVNSEGLMD-DDLYLFNVNSYKWT-IPHP 257

Query: 186 NGPS--ARSGHRITTW-----KNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW--TKW 235
            GP    R GH+I+       K    LFGG F D     +YFND+ +F++  F+   + W
Sbjct: 258 IGPRPLGRYGHKISIMAANQMKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRPDSHW 312

Query: 236 ETTNKN--QPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNV 293
           E        P P + H+ I  +    V+GG                TL          +V
Sbjct: 313 EFLKPTTFSPPPLTNHTMISYDNHLWVFGG---------------DTLQGLINQVFKYDV 357

Query: 294 NEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNI 353
               W      G +P P +    A+   +  ++ GG        +D    Y N +Y  N+
Sbjct: 358 ANNDWSIAETTGTKPPP-MQEHAAVVYKHVMVVVGG--------KDEHDTYLNSVYFLNL 408

Query: 354 ESNRWYPLKLRKV 366
           +++ W+ L   K 
Sbjct: 409 KTHEWFKLPTFKA 421

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 8/95 (8%)

Query: 275 LHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLE 334
           LH      D WI+  + N  + + +        P PRVG +  L   N  +LFGG     
Sbjct: 174 LHDQSVYGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLC-GNAFVLFGGDTHKV 232

Query: 335 ETEEDLSSIYYNDLYSYNIESNRW---YPLKLRKV 366
            +E     +  +DLY +N+ S +W   +P+  R +
Sbjct: 233 NSE----GLMDDDLYLFNVNSYKWTIPHPIGPRPL 263

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +    NSP PR    ++A  S Q+ V ++ G    S        Y DTW++   DN +
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 177 REWSK-LDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +  SK +D  +  P  R GH  T   N F++FGG    +N      +DV+LFN+  +KWT
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 86/192 (44%), Gaps = 26/192 (13%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQNS--PM 133
           + + T+  + +L +FGG+  +       ++NDL V++       ++ W+ F   N+  P 
Sbjct: 208 SIIATSQMRTKLYVFGGQFDDT------YFNDLTVFDLSSFRRPDSHWQ-FIKPNTFTPP 260

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK-NGPSARS 192
           P ++  M S+   + + FGG+  +P+       ND ++ D    +W  +    + P    
Sbjct: 261 PLTNHTMISYDYKLWV-FGGD--TPQG----LINDVFMFDPQINDWKVMQTTGDKPPPLQ 313

Query: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW- 251
            H    + +   + GG KD  +   Y N V+  N++  KW K  +     P  RSGHS  
Sbjct: 314 EHAAVLYGDLMCVVGG-KD--EQDVYSNSVFFLNLISLKWFKLPSYRSGIPQGRSGHSLT 370

Query: 252 IGSNEGPIVYGG 263
           +  N   ++ GG
Sbjct: 371 LLPNHKLLIMGG 382

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 127/314 (40%), Gaps = 62/314 (19%)

Query: 69  VELVPHPTPRNNACLVTNASKP-ELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFT 127
           V+L   P PR        AS+  ++ + GG    +       Y D  + +  +N   KF+
Sbjct: 81  VKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS------VYGDTWIISAHDN-GSKFS 133

Query: 128 SQN------SPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREW 179
           S+       +P PR   ++ +C +     ++FGG+      +     +D +L +  + +W
Sbjct: 134 SKTVDITDTTPPPRVGHASTLCGN---AFVIFGGDTHKVNSDGLMD-DDVYLFNINSYKW 189

Query: 180 SKLDFKNGPS--ARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFK 231
           + +    GP    R GH+I+       +    +FGG F D     +YFND+ +F++  F+
Sbjct: 190 T-IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFDD-----TYFNDLTVFDLSSFR 243

Query: 232 W--TKWETTNKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWIL 287
              + W+    N   P P + H+ I  +    V+GG       N+             + 
Sbjct: 244 RPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGGDTPQGLIND-------------VF 290

Query: 288 KMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYND 347
                +N+  W+     G +P P    +  L+ +   ++ G         +D   +Y N 
Sbjct: 291 MFDPQIND--WKVMQTTGDKPPPLQEHAAVLYGDLMCVVGG---------KDEQDVYSNS 339

Query: 348 LYSYNIESNRWYPL 361
           ++  N+ S +W+ L
Sbjct: 340 VFFLNLISLKWFKL 353

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 24/191 (12%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQN-SPMP 134
           + + T+  K +L +FGG+  +       ++NDL VY+       ++ W+     +  P P
Sbjct: 288 SIIATSQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPP 341

Query: 135 RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN-GPSARSG 193
            ++  M S+   + + FGG+      N  + Y      D TT +WS +D     P     
Sbjct: 342 LTNHTMVSYDYKLWV-FGGDTPQGLINELFMY------DPTTNDWSVVDTTGVKPPPLQE 394

Query: 194 HRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-I 252
           H    +K+   + GG  D +   +Y  +V+  N+  F+W K        P PRSGHS  +
Sbjct: 395 HAALLYKDLMCIVGGKDDQD---NYSQEVYFLNLKSFRWFKLPHFRSLVPSPRSGHSVTL 451

Query: 253 GSNEGPIVYGG 263
            SN+  ++ GG
Sbjct: 452 LSNKKLLIMGG 462

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 114/275 (41%), Gaps = 44/275 (16%)

Query: 68  VVELVPHPTPRNNACLVTNASKPELLLFGGE--RTNNETNMTKFYNDLHVYNPQNNQWKK 125
           + E  P P   + + L  NA     ++FGG+  +TN E  M    +D+++ N  +++W  
Sbjct: 219 ITETTPPPRVGHASTLCGNA----FVIFGGDTHKTNAEGLMD---DDVYLLNINSHKWT- 270

Query: 126 FTSQNSPMP------RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREW 179
                 P P      + S    S       +FGG+F     +T+++    + L +  R  
Sbjct: 271 IPRPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFD----DTYFNDLAVYDLSSFRRPD 326

Query: 180 SKLDFKNG----PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKW 235
           S   F       P   + H + ++     +FGG  D  QG    N++++++     W+  
Sbjct: 327 SHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG--DTPQG--LINELFMYDPTTNDWSVV 382

Query: 236 ETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNE 295
           +TT   +P P   H+ +      +     C V  K+++  +      + + L    N+  
Sbjct: 383 DTTGV-KPPPLQEHAAL------LYKDLMCIVGGKDDQDNYS----QEVYFL----NLKS 427

Query: 296 IKWERRAK-KGQQPSPRVGCSMALHRNNRGILFGG 329
            +W +    +   PSPR G S+ L  N + ++ GG
Sbjct: 428 FRWFKLPHFRSLVPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 14/119 (11%)

Query: 123 WKKFTSQNSPMPRSSAAMCSHQSGVTILF--GGEFSSPKQNTFYHYNDTWLL---DNTTR 177
           W +     SP PR      S+ S    +F  GG            Y DTW++   +N  +
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIKSHENGNK 211

Query: 178 EWSKLD--FKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYF-NDVWLFNVVDFKWT 233
             SK     +  P  R GH  T   N F++FGG            +DV+L N+   KWT
Sbjct: 212 FTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLNINSHKWT 270

 Score = 38.9 bits (89), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 275 LHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLE 334
           LH      D WI+K  +N N+   +        P PRVG +  L   N  ++FGG  D  
Sbjct: 191 LHDQSVYGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLC-GNAFVIFGG--DTH 247

Query: 335 ETEEDLSSIYYNDLYSYNIESNRW 358
           +T  +   +  +D+Y  NI S++W
Sbjct: 248 KTNAE--GLMDDDVYLLNINSHKW 269

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 71/157 (45%), Gaps = 26/157 (16%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W++    NSP PR    ++A  S Q+ V ++ G    S        Y DTW++   +N  
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 177 REWSK-LDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           R  SK ++  +  P  R GH  T   N F++FGG    +N      +DV+LFN+  +KWT
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 234 KWETTNKNQPDP--RSGHSWIGSNEGPI-----VYGG 263
                N   P P  R GH        P+     V+GG
Sbjct: 189 ---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGG 222

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 101/245 (41%), Gaps = 46/245 (18%)

Query: 128 SQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLD-F 184
           S  +P PR   ++ +C +     ++FGG+      +     +D +L +  + +W+  +  
Sbjct: 138 SDATPPPRVGHASTLCGN---AFVIFGGDTHKVNSDGLMD-DDVYLFNINSYKWTIPNPV 193

Query: 185 KNGPSARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW--TKWE 236
              P  R GH+I+       K    +FGG F D     +YFND+ +F++  F+   + W+
Sbjct: 194 GPRPLGRYGHKISIIAMSPMKTKLYVFGGQFDD-----TYFNDLAVFDLSSFRRPDSSWQ 248

Query: 237 --TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVN 294
             T N   P P + H+ I  +    V+GG                 + D ++     N  
Sbjct: 249 FITPNSFTPPPLTNHAMISYDYKLWVFGGDTP-----------QGLIDDVFVFDPQVN-- 295

Query: 295 EIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIE 354
              W+     GQ+P P    +  L+ +   I+ G         +D   +Y N +Y  N+ 
Sbjct: 296 --DWKFIQTTGQKPPPLQEHASVLYGDLMCIVGG---------KDEQDVYSNGVYFLNLI 344

Query: 355 SNRWY 359
           S +W+
Sbjct: 345 SLKWF 349

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 26/192 (13%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQNS--PM 133
           + +  +  K +L +FGG+  +       ++NDL V++       ++ W+ F + NS  P 
Sbjct: 206 SIIAMSPMKTKLYVFGGQFDDT------YFNDLAVFDLSSFRRPDSSWQ-FITPNSFTPP 258

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN-GPSARS 192
           P ++ AM S+   + + FGG+  +P+       +D ++ D    +W  +      P    
Sbjct: 259 PLTNHAMISYDYKLWV-FGGD--TPQG----LIDDVFVFDPQVNDWKFIQTTGQKPPPLQ 311

Query: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW- 251
            H    + +   + GG KD  +   Y N V+  N++  KW K+       P  RSGHS  
Sbjct: 312 EHASVLYGDLMCIVGG-KD--EQDVYSNGVYFLNLISLKWFKFPFFRAGIPQGRSGHSLT 368

Query: 252 IGSNEGPIVYGG 263
           +  N   ++ GG
Sbjct: 369 LLPNHKLLIMGG 380

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 92/242 (38%), Gaps = 43/242 (17%)

Query: 127 TSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN 186
           T QN P P + + + + Q  V +    + S+  Q+T        L       W+++  K 
Sbjct: 49  TKQNYPKPAADSGLLAAQQRVMVSPVEQRSTSTQST--------LQQQVFTPWNRIRLKQ 100

Query: 187 GPSARSGHRITTWKN---YFILFGGFKDLNQGTSYFNDVWLF----NVVDFKWTKWETTN 239
            P  R  H  +++        + GG  D     S + D W+     N   FK       +
Sbjct: 101 SPFPRYRHVASSYATDSGELFVIGGLHD----QSVYGDTWIIKSLDNATSFKSITVPIAD 156

Query: 240 KNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWE 299
              P PR GH+        +++GG        +K    G    D ++     N+N  KW 
Sbjct: 157 ATPP-PRVGHASTLCGNAFVIFGG------DTHKVNDAGLMDDDIYLF----NINSHKWT 205

Query: 300 RRAKKGQQPSPRVGCSMALHRNN----RGILFGGVYDLEETEEDLSSIYYNDLYSYNIES 355
               +G +P  R G  +++   N    +  +FGG +D           Y+NDL  +++ S
Sbjct: 206 IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFD---------DTYFNDLAEFDLSS 256

Query: 356 NR 357
            R
Sbjct: 257 FR 258

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 68/163 (41%), Gaps = 24/163 (14%)

Query: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQ--SGVTILFGGEFSSPKQNTFYHYNDTWL 171
            V+ P    W +   + SP PR      S+   SG   + GG            Y DTW+
Sbjct: 88  QVFTP----WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWI 137

Query: 172 ---LDNTT--REWSKLDFKNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLF 225
              LDN T  +  +       P  R GH  T   N F++FGG    +N      +D++LF
Sbjct: 138 IKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLF 197

Query: 226 NVVDFKWTKWETTNKNQPDPRSGH--SWIGSNEGPI---VYGG 263
           N+   KWT   T    +P  R GH  S I +N+      V+GG
Sbjct: 198 NINSHKWT-IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGG 239

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 16/187 (8%)

Query: 81  ACLVTNASKPELLLFGGERTNNETN-MTKFYNDLHVYNPQNNQWKKFTSQN-SPMPRSSA 138
           + +  N  K +L +FGG+  +   N + +F  DL  +   ++ W+        P P ++ 
Sbjct: 223 SIIAANQMKTKLYVFGGQFDDTYFNDLAEF--DLSSFRRSDSHWEFIKPATFMPPPLANH 280

Query: 139 AMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK-NGPSARSGHRIT 197
            M S    + + FGG+  +P+  T    N+ ++ D    +W  +    N P     H   
Sbjct: 281 TMISFDHKLWV-FGGD--TPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAI 333

Query: 198 TWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-IGSNE 256
            +++   +FGG KD     +Y N V+  N    KW K  T N   P  RSGHS  + SN 
Sbjct: 334 IYRDLMCVFGG-KDAQD--NYSNAVYFLNFRSLKWFKLPTFNNMIPRARSGHSLTLLSNN 390

Query: 257 GPIVYGG 263
             ++ GG
Sbjct: 391 KLLIMGG 397

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 116/273 (42%), Gaps = 40/273 (14%)

Query: 68  VVELVPHPTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFT 127
           + +  P P   + + L  NA     ++FGG+ T+   +     +D++++N  +++W   T
Sbjct: 154 IADATPPPRVGHASTLCGNA----FVIFGGD-THKVNDAGLMDDDIYLFNINSHKWTIPT 208

Query: 128 SQNSPMP------RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSK 181
            Q  P P      + S    +       +FGG+F     +T+++    + L +  R  S 
Sbjct: 209 PQG-PRPLGRYGHKISIIAANQMKTKLYVFGGQF----DDTYFNDLAEFDLSSFRRSDSH 263

Query: 182 LDFKNG----PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWET 237
            +F       P   + H + ++ +   +FGG  D  QG +  N+V++F+     W   +T
Sbjct: 264 WEFIKPATFMPPPLANHTMISFDHKLWVFGG--DTPQGLT--NEVFMFDPAANDWCVVQT 319

Query: 238 TNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIK 297
           T  N P P   H+ I   +   V+GG     A++N S          + L    N   +K
Sbjct: 320 TG-NIPPPLQEHAAIIYRDLMCVFGGK---DAQDNYS-------NAVYFL----NFRSLK 364

Query: 298 WERRAK-KGQQPSPRVGCSMALHRNNRGILFGG 329
           W +        P  R G S+ L  NN+ ++ GG
Sbjct: 365 WFKLPTFNNMIPRARSGHSLTLLSNNKLLIMGG 397

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 51/122 (41%), Gaps = 19/122 (15%)

Query: 240 KNQPDPRSGH--SWIGSNEGPI-VYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
           K  P PR  H  S   ++ G + V GG           LH      D WI+K   N    
Sbjct: 99  KQSPFPRYRHVASSYATDSGELFVIGG-----------LHDQSVYGDTWIIKSLDNATSF 147

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
           K          P PRVG +  L   N  ++FGG  D  +  +  + +  +D+Y +NI S+
Sbjct: 148 KSITVPIADATPPPRVGHASTLC-GNAFVIFGG--DTHKVND--AGLMDDDIYLFNINSH 202

Query: 357 RW 358
           +W
Sbjct: 203 KW 204

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 128/325 (39%), Gaps = 63/325 (19%)

Query: 59  LEQEQFE---KVVVELVPHPTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHV 115
           L+Q+ F    ++ ++  P P  R+ A      S  EL + GG    +       Y D  +
Sbjct: 85  LQQQVFTPWNRIRLKQSPFPRYRHVASSYATDSG-ELFVIGGLHDQS------VYGDTWI 137

Query: 116 YNPQNN--QWKKFT---SQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYND 168
               +N   +K  T   +  +P PR   ++ +C +     ++FGG+ +    +     +D
Sbjct: 138 IKSLDNATSFKSITVPIADATPPPRVGHASTLCGN---AFVIFGGD-THKVNDAGLMDDD 193

Query: 169 TWLLDNTTREWSKLDFKNGPS--ARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFN 220
            +L +  + +W+ +    GP    R GH+I+       K    +FGG F D     +YFN
Sbjct: 194 IYLFNINSHKWT-IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFDD-----TYFN 247

Query: 221 DVWLFNVVDFKWTK--WETTNKN--QPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLH 276
           D+  F++  F+ +   WE        P P + H+ I  +    V+GG       N     
Sbjct: 248 DLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGGDTPQGLTN----- 302

Query: 277 KGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEET 336
                 + ++   + N     W      G  P P    +  ++R+   + FGG       
Sbjct: 303 ------EVFMFDPAAN----DWCVVQTTGNIPPPLQEHAAIIYRDLMCV-FGG------- 344

Query: 337 EEDLSSIYYNDLYSYNIESNRWYPL 361
            +D    Y N +Y  N  S +W+ L
Sbjct: 345 -KDAQDNYSNAVYFLNFRSLKWFKL 368

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 65/156 (41%), Gaps = 17/156 (10%)

Query: 75  PTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKF-TSQNSPM 133
           P P  N  +++   K  L +FGG+     TN      ++ +++P  N W    T+ N P 
Sbjct: 274 PPPLANHTMISFDHK--LWVFGGDTPQGLTN------EVFMFDPAANDWCVVQTTGNIPP 325

Query: 134 PRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNG--PSAR 191
           P    A   ++  +  +FGG     K     + N  + L+  + +W KL   N   P AR
Sbjct: 326 PLQEHAAIIYRD-LMCVFGG-----KDAQDNYSNAVYFLNFRSLKWFKLPTFNNMIPRAR 379

Query: 192 SGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNV 227
           SGH +T   N  +L  G    +       DV   +V
Sbjct: 380 SGHSLTLLSNNKLLIMGGDKFDYAVGNSTDVRTSDV 415

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 88/202 (43%), Gaps = 32/202 (15%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQN-SPMP 134
           + + TN  K +L +FGG+  +       ++NDL VY+       ++ W+    +  SP P
Sbjct: 243 SIIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPP 296

Query: 135 RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYN---DTWLLDNTTREWSKLDFKNGPSAR 191
            ++  M S+ S + + FGG+      N  + Y+   + W +  TT E         P   
Sbjct: 297 ITNFTMISYDSKLWV-FGGDTLQGLVNDVFMYDPALNDWFIIETTGE--------KPPPV 347

Query: 192 SGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW 251
             H    + +   + GG KD  +  +Y N V+  N+   KW K        P  RSGHS 
Sbjct: 348 QEHATVVYNDLMCVVGG-KD--EHDAYLNSVYFLNLKSNKWFKLPVFTAGIPQGRSGHSL 404

Query: 252 -IGSNEGPIVYGG----YCKVK 268
            +  N+  ++ GG    Y +V+
Sbjct: 405 TLLKNDKILIMGGDKFDYARVE 426

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 117/295 (39%), Gaps = 71/295 (24%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +   Q+SP PR    S+A  + ++ + ++ G    S        Y DTW+L   DN T
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 R-EWSKLDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +   + +D     P  R GH      N F++FGG    +N+     +D++L N+  +KWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 234 KWETTNKNQPDPRSGH--SWIGSNEGPI---VYGGYCKVKAKNNKSLH------------ 276
                   +P  R GH  S I +N+      V+GG       N+ +++            
Sbjct: 226 VPAPVGP-RPLGRYGHKISIIATNQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHW 284

Query: 277 ---KGKTLT--------------DCWIL---KMSQNVNEI--------KWERRAKKGQQP 308
              K KT +                W+     +   VN++         W      G++P
Sbjct: 285 EFLKPKTFSPPPITNFTMISYDSKLWVFGGDTLQGLVNDVFMYDPALNDWFIIETTGEKP 344

Query: 309 SPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKL 363
            P    +  ++ N+   + GG        +D    Y N +Y  N++SN+W+ L +
Sbjct: 345 PPVQEHATVVY-NDLMCVVGG--------KDEHDAYLNSVYFLNLKSNKWFKLPV 390

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +   QNSP PR    ++A  + ++ + ++ G    S        Y DTW+L   DN T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 R-EWSKLDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           R   + +D     P  R GH      N F++FGG    +N+     +D++L N+  +KWT
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 88/202 (43%), Gaps = 32/202 (15%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQN-SPMP 134
           + + T   K +L +FGG+  +       ++NDL VY+       ++ W+    +  +P P
Sbjct: 243 SIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPP 296

Query: 135 RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYN---DTWLLDNTTREWSKLDFKNGPSAR 191
            ++  M S+ S + + FGG+      N  + Y+   + W + +TT E         P   
Sbjct: 297 ITNFTMISYDSKLWV-FGGDTLQGLVNDVFMYDPAINDWFIIDTTGE--------KPPPV 347

Query: 192 SGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW 251
             H    + +   + GG KD  +  +Y N V+  N+   KW K        P  RSGHS 
Sbjct: 348 QEHATVVYNDLMCVVGG-KD--EHDAYLNSVYFLNLKSRKWFKLPVFTAGIPQGRSGHSL 404

Query: 252 -IGSNEGPIVYGG----YCKVK 268
            +  N+  ++ GG    Y +V+
Sbjct: 405 TLLKNDKILIMGGDKFDYARVE 426

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 89/209 (42%), Gaps = 34/209 (16%)

Query: 72  VPHPT-PR-------NNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ---- 119
           +PHP  PR         + + T+  K +L +FGG+  +       ++NDL VY+      
Sbjct: 165 IPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRR 218

Query: 120 -NNQWKKFTSQNS--PMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTT 176
            ++ W  F    S  P P ++  M S+   + + FGG+      N  + Y      D   
Sbjct: 219 PDSHWV-FVKPASFVPPPLTNHTMVSYDYKLWV-FGGDTPQGLINELFVY------DPVV 270

Query: 177 REWSKLDFKNG-PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKW 235
            +WS ++     P     H    +++   + GG  D +   +Y  DV+  N+  F+W K 
Sbjct: 271 NDWSVVETTGAKPPPLQEHAAVLYRDLMCVVGGKDDQD---NYSQDVYFMNMKTFRWFKL 327

Query: 236 ETTNKNQPDPRSGHSW-IGSNEGPIVYGG 263
                  P PRSGHS  + +N   ++ GG
Sbjct: 328 PHFQDMVPSPRSGHSVTLLANRKLLIMGG 356

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 116/275 (42%), Gaps = 44/275 (16%)

Query: 68  VVELVPHPTPRNNACLVTNASKPELLLFGGE--RTNNETNMTKFYNDLHVYNPQNNQWKK 125
           + E  P P   + A L  NA     ++FGG+  +TNNE  M    +D+++ N  +++W  
Sbjct: 113 ITETTPPPRVGHAATLCGNA----FVIFGGDTHKTNNEGLMD---DDVYLLNVNSHKWT- 164

Query: 126 FTSQNSPMP------RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREW 179
                 P P      + S    S       +FGG+F     +T+++    + L +  R  
Sbjct: 165 IPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFD----DTYFNDLAVYDLSSFRRPD 220

Query: 180 SKLDFKNG----PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKW 235
           S   F       P   + H + ++     +FGG  D  QG    N++++++ V   W+  
Sbjct: 221 SHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG--DTPQG--LINELFVYDPVVNDWSVV 276

Query: 236 ETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNE 295
           ETT   +P P   H+ +      +     C V  K+++  +      D + +    N+  
Sbjct: 277 ETTGA-KPPPLQEHAAV------LYRDLMCVVGGKDDQDNYS----QDVYFM----NMKT 321

Query: 296 IKWERRAK-KGQQPSPRVGCSMALHRNNRGILFGG 329
            +W +    +   PSPR G S+ L  N + ++ GG
Sbjct: 322 FRWFKLPHFQDMVPSPRSGHSVTLLANRKLLIMGG 356

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 128/314 (40%), Gaps = 62/314 (19%)

Query: 69  VELVPHPTPRNNACLVTNASKP-ELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFT 127
           V+LV  P PR        AS   E+++ GG    +       Y D  +   Q+N  K+F+
Sbjct: 55  VKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQS------VYGDTWILRAQDN-GKQFS 107

Query: 128 S------QNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREW 179
           +      + +P PR   +A +C +     ++FGG+ +    N     +D +LL+  + +W
Sbjct: 108 ARTIEITETTPPPRVGHAATLCGN---AFVIFGGD-THKTNNEGLMDDDVYLLNVNSHKW 163

Query: 180 SKLDFKNGPS--ARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFK 231
           + +    GP    R GH+I+       K    +FGG F D     +YFND+ ++++  F+
Sbjct: 164 T-IPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDD-----TYFNDLAVYDLSSFR 217

Query: 232 W--TKWETTNKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWIL 287
              + W         P P + H+ +  +    V+GG       N              + 
Sbjct: 218 RPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGGDTPQGLINE-------------LF 264

Query: 288 KMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYND 347
                VN+  W      G +P P    +  L+R+   ++ G         +D    Y  D
Sbjct: 265 VYDPVVND--WSVVETTGAKPPPLQEHAAVLYRDLMCVVGG---------KDDQDNYSQD 313

Query: 348 LYSYNIESNRWYPL 361
           +Y  N+++ RW+ L
Sbjct: 314 VYFMNMKTFRWFKL 327

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPRSSAAMCSHQSGV--TILFGGEFSSPKQNTFYHYNDTWLL--DNTTRE 178
           W +     +P PR      ++ S     I+ GG            Y DTW+L   +  ++
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQ------SVYGDTWILRAQDNGKQ 105

Query: 179 WSKLDFK---NGPSARSGHRITTWKNYFILFGG--FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +S    +     P  R GH  T   N F++FGG   K  N+G    +DV+L NV   KWT
Sbjct: 106 FSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGL-MDDDVYLLNVNSHKWT 164

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 91/211 (43%), Gaps = 32/211 (15%)

Query: 72  VPHPT-PRNN-------ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ---- 119
           +PHP  PR         + +     + +L LFGG+  +N      ++NDL V++      
Sbjct: 246 IPHPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDDN------YFNDLVVFDLSSFRR 299

Query: 120 -NNQWKKFTSQNS--PMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYN---DTWLLD 173
            ++ W+ F    S  P P ++  M S+   + + FGG+      N  + Y+   + W + 
Sbjct: 300 DDSHWE-FIKPRSFIPPPITNHTMVSYDFKLWV-FGGDTLEGLLNQVFMYDPAVNDWCVV 357

Query: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
            TT +    D +N P     H    +K    + GG KD  +   Y NDV+  N+   KW 
Sbjct: 358 ETTCQDD--DLENMPPPMQEHATLIYKGLMCIVGG-KD--EQDHYLNDVYFLNLKSLKWF 412

Query: 234 KWETTNKNQPDPRSGHSW-IGSNEGPIVYGG 263
           +        P  RSGHS  +  N+  ++ GG
Sbjct: 413 RLPRFMDGIPQGRSGHSVTLLKNDKLLIMGG 443

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 56/122 (45%), Gaps = 18/122 (14%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD------ 173
           W +   QNSP PR    ++++ S  + V ++ G    S        Y DTW+L       
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 174 NTTREWSKLDF-KNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFK 231
           +T      +D  +  P  R GH  T   N F++FGG     N+     +D++LFN+  +K
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 232 WT 233
           WT
Sbjct: 244 WT 245

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 43/124 (34%), Gaps = 21/124 (16%)

Query: 240 KNQPDPRSGH---SWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
           +N P PR  H   S I       V GG           LH      D W+L         
Sbjct: 137 QNSPFPRYRHVASSVISDTNQVYVIGG-----------LHDQSVYGDTWVLTCEDPQTST 185

Query: 297 KWERRAKKGQQ--PSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIE 354
            +  R     +  P PRVG +  L  N   I  G  +   E  E       +D+Y +NI 
Sbjct: 186 MFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE-----MDDDIYLFNIN 240

Query: 355 SNRW 358
           S +W
Sbjct: 241 SYKW 244

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 15/183 (8%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNS--PMPRSSA 138
           + + T  +K +L LFGG+  +   N    + DL  +   + QW+ F    S  P P S+ 
Sbjct: 166 SIIATQPTKTKLFLFGGQFDDTYFNDLSMF-DLSTFRKPDAQWE-FIKPKSFFPPPVSNH 223

Query: 139 AMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK-NGPSARSGHRIT 197
            M S+ + + + FGGE      N  + Y      D    +WS ++   + P     H   
Sbjct: 224 TMISYDNKLWV-FGGETLQGLINEVFVY------DPIVNDWSVIETTGSSPPPIQEHAAV 276

Query: 198 TWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSWIGSNEG 257
            +KN   + GG KD     +Y N V+  N+   KW K    N      RSGH+    N+ 
Sbjct: 277 VYKNLMCVVGG-KD--SKDNYMNSVYFLNLNTLKWFKLPHINPGIMQGRSGHTATLLNDD 333

Query: 258 PIV 260
            I+
Sbjct: 334 SIL 336

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 128/312 (41%), Gaps = 61/312 (19%)

Query: 70  ELVPHPTPRNNACLVTNASKPE-LLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTS 128
           +L P P PR      ++ASK + L + GG R  +       Y D+   N +++  K F++
Sbjct: 41  KLNPSPFPRYRHVASSHASKDDTLFIIGGLREQS------VYGDVWSINHKDD--KSFSA 92

Query: 129 QN------SPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWS 180
            +      +P PR   ++ +C +     ILFGG+     ++     +D +L +  + +W+
Sbjct: 93  SSIEITPTTPPPRVGHASTICGN---ALILFGGDTHKVNEDGLMD-DDLYLFNLNSYKWT 148

Query: 181 KLD-FKNGPSARSGHRITTW-----KNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW- 232
             +     P  R GH+I+       K    LFGG F D     +YFND+ +F++  F+  
Sbjct: 149 IPEPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQFDD-----TYFNDLSMFDLSTFRKP 203

Query: 233 -TKWETTNKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289
             +WE        P P S H+ I  +    V+GG   ++   N+       + D      
Sbjct: 204 DAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGGET-LQGLINEVFVYDPIVND------ 256

Query: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349
                   W      G  P P    +  +++N   ++ G         +D    Y N +Y
Sbjct: 257 --------WSVIETTGSSPPPIQEHAAVVYKNLMCVVGG---------KDSKDNYMNSVY 299

Query: 350 SYNIESNRWYPL 361
             N+ + +W+ L
Sbjct: 300 FLNLNTLKWFKL 311

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 14/134 (10%)

Query: 123 WKKFTSQNSPMPRSSAAMCSHQSGVTILF--GGEFSSPKQNTFYHYNDTWLL---DNTTR 177
           W +F    SP PR      SH S    LF  GG     ++ + Y   D W +   D+ + 
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVY--GDVWSINHKDDKSF 90

Query: 178 EWSKLDFK-NGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWTKW 235
             S ++     P  R GH  T   N  ILFGG    +N+     +D++LFN+  +KWT  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 236 ETTNKNQPDPRSGH 249
           E     +P  R GH
Sbjct: 151 EPIGL-RPLGRYGH 163

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 100/259 (38%), Gaps = 36/259 (13%)

Query: 105 NMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILF--GGEFSSPKQNT 162
           N++     LH    +   W +    NSP PR      S++S    +F  GG         
Sbjct: 124 NVSGAVTTLHHNQKEYTPWNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV--- 180

Query: 163 FYHYNDTWLLDNT-------TREWSKLDFKNGPSARSGHRITTWKNYFILFGG-FKDLNQ 214
              Y DTW + +T       ++    LD    P  R GH  T   N F++FGG    +N+
Sbjct: 181 ---YGDTWSITSTNNGTQFISKALEILDL--SPPPRVGHASTLCGNAFVVFGGDTHKVNK 235

Query: 215 GTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKS 274
                +D++LFN+   KWT        +P  R GH         I+     K K      
Sbjct: 236 DGLMDDDIYLFNINSHKWTIPSPVGP-RPLGRYGHKI------SIIATSSSKTKLYLFGG 288

Query: 275 LHKGKTLTDCWILKMSQ-NVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDL 333
                   D  +  +S     +  WE    KG  P P    +M  + +N+  +FGG    
Sbjct: 289 QFDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTY-DNKLWVFGG---- 343

Query: 334 EETEEDLSSIYYNDLYSYN 352
            +T++ L     ND+Y+++
Sbjct: 344 -DTKDGL----INDIYAFD 357

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 12/186 (6%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQN-SPMPRSSAA 139
           + + T++SK +L LFGG+  +   N    + DL  +   ++ W+    +   P P ++  
Sbjct: 272 SIIATSSSKTKLYLFGGQFDDTYFNDIAVF-DLSSFRRADSHWEFIKPKGLIPPPMTNHT 330

Query: 140 MCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNG-PSARSGHRITT 198
           M ++ + + + FGG+      N  Y ++      ++   W+K+D     P     H    
Sbjct: 331 MVTYDNKLWV-FGGDTKDGLINDIYAFDPA----DSINTWTKIDVTGDIPCPVQEHSALI 385

Query: 199 WKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-IGSNEG 257
           + N   + GG KD N    Y N V  FN    KW K+          RSGHS  + +N  
Sbjct: 386 YDNLMCVIGG-KDEND--MYLNSVHFFNFDKLKWFKFPIFKSGIMQGRSGHSISLLNNNK 442

Query: 258 PIVYGG 263
            ++ GG
Sbjct: 443 ILIMGG 448

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 106/249 (42%), Gaps = 46/249 (18%)

Query: 131 SPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGP 188
           SP PR   ++ +C +     ++FGG+     ++     +D +L +  + +W+ +    GP
Sbjct: 207 SPPPRVGHASTLCGN---AFVVFGGDTHKVNKDGLMD-DDIYLFNINSHKWT-IPSPVGP 261

Query: 189 S--ARSGHRIT-----TWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKW--TKWETT 238
               R GH+I+     + K    LFGG F D     +YFND+ +F++  F+   + WE  
Sbjct: 262 RPLGRYGHKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFI 316

Query: 239 NKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
                 P P + H+ +  +    V+GG  K              + D +    + ++N  
Sbjct: 317 KPKGLIPPPMTNHTMVTYDNKLWVFGGDTK-----------DGLINDIYAFDPADSIN-- 363

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
            W +    G  P P V    AL  +N   + GG        +D + +Y N ++ +N +  
Sbjct: 364 TWTKIDVTGDIPCP-VQEHSALIYDNLMCVIGG--------KDENDMYLNSVHFFNFDKL 414

Query: 357 RWYPLKLRK 365
           +W+   + K
Sbjct: 415 KWFKFPIFK 423

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 53/130 (40%), Gaps = 21/130 (16%)

Query: 232 WTKWETTNKNQPDPRSGH---SWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILK 288
           W + + TN   P PR  H   S+   +    V GG           LH      D W + 
Sbjct: 142 WNRIKLTN--SPFPRYRHVASSYESVDNEIFVIGG-----------LHDQSVYGDTWSIT 188

Query: 289 MSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDL 348
            + N  +   +        P PRVG +  L   N  ++FGG  D  +  +D   +  +D+
Sbjct: 189 STNNGTQFISKALEILDLSPPPRVGHASTL-CGNAFVVFGG--DTHKVNKD--GLMDDDI 243

Query: 349 YSYNIESNRW 358
           Y +NI S++W
Sbjct: 244 YLFNINSHKW 253

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL----DNT 175
           W +   QNSP PR    ++A  + ++ + ++ G    S        Y DTW+L    D T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 176 TREWSKLDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
               + +D     P  R GH      N F++FGG    +N+     +D++L NV  +KWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 80/191 (41%), Gaps = 24/191 (12%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFTSQN-SPMP 134
           + + T   K +L +FGG+  +       ++NDL VY+       ++ W        +P P
Sbjct: 243 SIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPP 296

Query: 135 RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKN-GPSARSG 193
            ++  M S+ S + + FGG+            ND ++ D    +W  ++     P     
Sbjct: 297 MTNFTMISYDSKLWV-FGGD------TLQGLINDVFMYDPAKNDWFTIETSGEKPPPVQE 349

Query: 194 HRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW-I 252
           H    + +   + GG KD  +  +Y N V+  N+   KW K        P  RSGHS  +
Sbjct: 350 HATVVYNDLMCVVGG-KD--EHDAYLNTVYFLNLKTHKWFKLPIFAAGIPQGRSGHSLTL 406

Query: 253 GSNEGPIVYGG 263
             N+  ++ GG
Sbjct: 407 LKNDKVLIMGG 417

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 77/167 (46%), Gaps = 21/167 (12%)

Query: 92  LLLFGGERTNNETN-MTKFYNDLHVYNPQNNQWKKFTSQN-SPMPRSSAAMCSHQSGVTI 149
           L LFGG+      N + KF  DL  +   N+QW+    +   P P S+ +MC+ ++ + +
Sbjct: 166 LYLFGGQFDETYFNDLVKF--DLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFENKLYV 223

Query: 150 LFGGEFSSPKQNTF-YHYNDTWLLDNTTREWSKLDF-----KNGPSARSGHRITTWKNYF 203
            FGG+       T+    N+T++ D    EWS L+       N P     H    +K+  
Sbjct: 224 -FGGD-------TYQVLTNETFVYDPELNEWSILETFGQEDTNKPPPIQEHAGIIYKHLM 275

Query: 204 ILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHS 250
            + GG KD N   +Y N V+  N++  KW K    N      RSGHS
Sbjct: 276 CVVGG-KDSND--NYLNSVYFLNLISKKWFKLPEFNDTAMLGRSGHS 319

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 94/256 (36%), Gaps = 43/256 (16%)

Query: 123 WKKFTSQNSPMPRSSAAMCSHQSGVTILF--GGEFSSPKQNTFYHYNDTWLL-------D 173
           W K   + +P PR      S+      L+  GG F S        Y DTW L       +
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 174 NTTREW----SKLDFK-NGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYF-NDVWLFN 226
           N    W    + +D     P  R GH  T   N  I+FGG    +N       +D++  N
Sbjct: 76  NDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLN 135

Query: 227 VVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWI 286
           +   KWT   +    +P  R GH     N    ++GG       N+        L    +
Sbjct: 136 LDTTKWT-IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFND--------LVKFDL 186

Query: 287 LKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYN 346
           L   ++ N  +WE    KG  P P    SM     N+  +FGG         D   +  N
Sbjct: 187 LNF-KDANS-QWEFIKPKGFIPPPLSNFSMCTFE-NKLYVFGG---------DTYQVLTN 234

Query: 347 DLYSYNIESNRWYPLK 362
           + + Y+ E N W  L+
Sbjct: 235 ETFVYDPELNEWSILE 250

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 100/255 (39%), Gaps = 46/255 (18%)

Query: 120 NNQWKKFTSQNSPMPRSSAAMCSHQS--GVTILFGGEFSSPKQNTFYHYNDTWL---LDN 174
           N  W +   ++SP PR      S+ +      + GG      Q+ F    D W+   L+N
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHD---QSVF---GDVWIIKSLEN 247

Query: 175 TTREWSK-LDF-KNGPSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFK 231
            T+  S  +D  +N P  R GH  T   N F++FGG    +N+     +D++LFN+  +K
Sbjct: 248 GTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYK 307

Query: 232 WTKWETTNKNQPDP--RSGHSWIGSNEGPI-----VYGGYCKVKAKNNKSLHKGKTLTDC 284
           WT     N   P P  R GH        P+     ++GG       NN            
Sbjct: 308 WT---IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFNN-----------L 353

Query: 285 WILKMSQ-NVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSI 343
            +  +SQ    +  WE    K   P P    +M  ++N   I FGG         D    
Sbjct: 354 AVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWI-FGG---------DTLQG 403

Query: 344 YYNDLYSYNIESNRW 358
             N ++ Y+ E N W
Sbjct: 404 LINKIFMYDPEVNDW 418

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 62/146 (42%), Gaps = 24/146 (16%)

Query: 75  PTPRNNACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTS------ 128
           P P  N  +V+  +K  L +FGG+       +    N + +Y+P+ N W    +      
Sbjct: 378 PPPLTNHTMVSYQNK--LWIFGGD------TLQGLINKIFMYDPEVNDWTVVETFPANND 429

Query: 129 -QNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNG 187
            +N P P    A   +   + ++ GG     K     + N  + L   T EW KL F + 
Sbjct: 430 QENFPPPMQEHASVMY-GDLMVVMGG-----KDEQDNYLNTVYFLKINTLEWYKLPFLSV 483

Query: 188 --PSARSGHRITTWK-NYFILFGGFK 210
             P  RSGH IT  K N  ++ GG K
Sbjct: 484 GIPQGRSGHSITLLKGNKLLIMGGDK 509

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 76/178 (42%), Gaps = 19/178 (10%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQN-SPMPRSSAA 139
           + + T   K +L LFGG+  +   N    + DL  +   ++ W+    ++  P P ++  
Sbjct: 327 SIIATTPMKTKLYLFGGQFDDTYFNNLAVF-DLSQFRRPDSHWEFLKPKSFMPPPLTNHT 385

Query: 140 MCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKL-------DFKNGPSARS 192
           M S+Q+ + I FGG+      N  + Y      D    +W+ +       D +N P    
Sbjct: 386 MVSYQNKLWI-FGGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPPMQ 438

Query: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHS 250
            H    + +  ++ GG KD  +  +Y N V+   +   +W K    +   P  RSGHS
Sbjct: 439 EHASVMYGDLMVVMGG-KD--EQDNYLNTVYFLKINTLEWYKLPFLSVGIPQGRSGHS 493

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 118/277 (42%), Gaps = 48/277 (17%)

Query: 68  VVELVPHPTPRNNACLVTNASKPELLLFGGE--RTNNETNMTKFYNDLHVYNPQNNQWKK 125
           + E  P P   + + L  NA     ++FGG+  +TN +  M    +D++++N  + +W  
Sbjct: 135 ITEYTPPPRVGHASTLCGNA----FVIFGGDTHKTNKDGLMD---DDIYLFNINSYKWT- 186

Query: 126 FTSQNSPMP------RSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTT--- 176
                 P P      + S    S       +FGG+F         ++ND  + D ++   
Sbjct: 187 IPQPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDD------SYFNDLCVYDLSSFRK 240

Query: 177 --REWSKLDFKN-GPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233
               W  L  K+  P   + H + ++     +FGG  D  QG    N +++F+ V   W 
Sbjct: 241 PESHWEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG--DTQQG--LINQLFMFDPVINDWR 296

Query: 234 KWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNV 293
             ETT + +P P   H+ +  N+   + GG      K+ + ++    L   + L    N+
Sbjct: 297 VVETTGE-KPPPVQEHAAVMFNDLMCIMGG------KDEQDVY----LNSVYFL----NL 341

Query: 294 NEIKWER-RAKKGQQPSPRVGCSMALHRNNRGILFGG 329
             +KW +    K   P  R G S+ L +NNR ++ GG
Sbjct: 342 KSLKWFKFNDYKLNIPQGRSGHSITLLKNNRLLIMGG 378

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 102/243 (41%), Gaps = 48/243 (19%)

Query: 131 SPMPRS--SAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGP 188
           +P PR   ++ +C +     ++FGG+     ++     +D +L +  + +W+ +    GP
Sbjct: 139 TPPPRVGHASTLCGN---AFVIFGGDTHKTNKDGLMD-DDIYLFNINSYKWT-IPQPVGP 193

Query: 189 S--ARSGHRITT-----WKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFK--WTKWETT 238
               R GH+I+       K    +FGG F D     SYFND+ ++++  F+   + WE  
Sbjct: 194 RPLGRYGHKISIIATSQMKTKLYVFGGQFDD-----SYFNDLCVYDLSSFRKPESHWEFL 248

Query: 239 NKNQ--PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEI 296
                 P P + H+ +  +    V+GG  +    N              +      +N+ 
Sbjct: 249 KPKSFIPPPLTNHTMVSYDYKLWVFGGDTQQGLIN-------------QLFMFDPVIND- 294

Query: 297 KWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESN 356
            W      G++P P V    A+  N+   + GG        +D   +Y N +Y  N++S 
Sbjct: 295 -WRVVETTGEKPPP-VQEHAAVMFNDLMCIMGG--------KDEQDVYLNSVYFLNLKSL 344

Query: 357 RWY 359
           +W+
Sbjct: 345 KWF 347

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 76/186 (40%), Gaps = 45/186 (24%)

Query: 111 NDLHVYNPQNNQWKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYN 167
           N+L+ Y P    W ++   NSP PR    ++++ S  + V ++ G    S        Y 
Sbjct: 47  NNLNEYTP----WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQSV-------YG 95

Query: 168 DTWLL-DNTTREWSKLDFKN-----------------------GPSARSGHRITTWKNYF 203
           DTW++ +NT    S                              P  R GH  T   N F
Sbjct: 96  DTWIISENTININSPATMHTPTSTTSTTSNISFSSKTVEITEYTPPPRVGHASTLCGNAF 155

Query: 204 ILFGG-FKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGH--SWIGSNEGPI- 259
           ++FGG     N+     +D++LFN+  +KWT  +     +P  R GH  S I +++    
Sbjct: 156 VIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGP-RPLGRYGHKISIIATSQMKTK 214

Query: 260 --VYGG 263
             V+GG
Sbjct: 215 LYVFGG 220

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 119/297 (40%), Gaps = 75/297 (25%)

Query: 123 WKKFTSQNSPMPR---SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLL---DNTT 176
           W +   QNSP PR    ++A  + ++ + ++ G    S        Y DTW+L   DN T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 177 R-EWSKLDFKNG-PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDVWLFNVVDFKWT 233
           +   + +D     P  R GH      N F++FGG    +N+     +D++L N+  +KWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 234 KWETTNKNQPDPRSGH--SWIGSNEGPI---VYGGYCKVKAKNNKSLHKGKTLTDCWILK 288
                   +P  R GH  S I + +      V+GG       N+ +++      D    +
Sbjct: 226 VPAPVGP-RPLGRYGHKISIIATTQMKTKLYVFGGQFDDTYFNDLAVY------DLSSFR 278

Query: 289 MSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGG-----------VYD----- 332
              +     WE    K   P P    +M +  +++  +FGG           +YD     
Sbjct: 279 RPDS----HWEFLKPKAFTPPPITNFTM-ISYDSKLWVFGGDTLQGLINDVFMYDPAIND 333

Query: 333 ---LEETEE------DLSSIYYNDL-----------------YSYNIESNRWYPLKL 363
              +E T E      + +S+ YNDL                 Y  N++S++W+ L +
Sbjct: 334 WFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDEHDAYLNSVYFLNLKSHKWFKLPV 390

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 40/206 (19%)

Query: 81  ACLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQW-----KKFTSQN 130
           + + T   K +L +FGG+  +       ++NDL VY+       ++ W     K FT   
Sbjct: 243 SIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKAFT--- 293

Query: 131 SPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYN---DTWLLDNTTREWSKLDFKNG 187
            P P ++  M S+ S + + FGG+      N  + Y+   + W +  TT E         
Sbjct: 294 -PPPITNFTMISYDSKLWV-FGGDTLQGLINDVFMYDPAINDWFIIETTGE--------K 343

Query: 188 PSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRS 247
           P     H    + +   + GG KD  +  +Y N V+  N+   KW K        P  RS
Sbjct: 344 PPPVQEHASVVYNDLMCVVGG-KD--EHDAYLNSVYFLNLKSHKWFKLPVFTAGIPQGRS 400

Query: 248 GHSW-IGSNEGPIVYGG----YCKVK 268
           GHS  +  ++  ++ GG    Y +V+
Sbjct: 401 GHSLTLLKDDKILIMGGDKFDYARVE 426

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 57/150 (38%), Gaps = 24/150 (16%)

Query: 118 PQNNQWKKFTSQNSPMPRSSAAMCSH--QSGVTILFGGEFSSPKQNTFYHYNDTWLLDNT 175
           P    W +    NSP PR      SH    G   + GG            Y DTW+L  T
Sbjct: 142 PDYTPWGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWIL--T 193

Query: 176 TREWSKLDFKNG------------PSARSGHRITTWKNYFILFGG-FKDLNQGTSYFNDV 222
             +  K    N             P  R GH  T   N F++FGG    +N      +D+
Sbjct: 194 ASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDL 253

Query: 223 WLFNVVDFKWTKWETTNKNQPDPRSGHSWI 252
           +L N+  +KWT  +   + +P  R GH  +
Sbjct: 254 YLLNINSYKWTIPKPVGQ-RPLGRYGHKIV 282

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 27/192 (14%)

Query: 82  CLVTNASKPELLLFGGERTNNETNMTKFYNDLHVYNPQ-----NNQWKKFT-SQNSPMPR 135
            +  +A + +L LFGG+  +       ++ DL V++       ++ W     S  +P P 
Sbjct: 281 IVTISAEQTKLYLFGGQFDDT------YFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPL 334

Query: 136 SSAAMCSHQSGVTILFGGEFSSPKQNTFYHY---NDTWLLDNTTREWSKLDFKNGPSARS 192
           ++  M ++Q  + +  G        N  Y Y   N++W +  TT +         P    
Sbjct: 335 TNHTMVTYQDKIWVFGGDTLEEGLINRVYLYSPTNNSWEIVETTGDI--------PPPMQ 386

Query: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHSW- 251
            H    +K+   + GG KD     +Y N ++  N+   KW K      N P  RSGHS  
Sbjct: 387 EHAAIVYKDLMCVVGG-KDAED--NYLNTLYFLNLQSLKWFKLPFYKNNIPQGRSGHSVT 443

Query: 252 IGSNEGPIVYGG 263
           +  N+  ++ GG
Sbjct: 444 LLKNDQILIMGG 455

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 110/260 (42%), Gaps = 48/260 (18%)

Query: 121 NQWKKFT---SQNSPMPR--SSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNT 175
           N +K  T   ++++P PR   ++ +C +     ++FGG+      +     +D +LL+  
Sbjct: 204 NSFKSTTIEITESTPPPRVGHASTLCGN---AFVVFGGDTHKVNSDGLMD-DDLYLLNIN 259

Query: 176 TREWS-KLDFKNGPSARSGHRITTW---KNYFILFGG-FKDLNQGTSYFNDVWLFNVVDF 230
           + +W+        P  R GH+I T    +    LFGG F D     +YF D+ +F++  F
Sbjct: 260 SYKWTIPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQFDD-----TYFGDLAVFDLSSF 314

Query: 231 K-----WTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCW 285
           +     W   + +  N P P + H+ +   +   V+GG          +L +G  +   +
Sbjct: 315 RRPDSHWVFLKPSGFNPP-PLTNHTMVTYQDKIWVFGG---------DTLEEG-LINRVY 363

Query: 286 ILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYY 345
           +   + N     WE     G  P P    +  ++++   ++ G         +D    Y 
Sbjct: 364 LYSPTNN----SWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG---------KDAEDNYL 410

Query: 346 NDLYSYNIESNRWYPLKLRK 365
           N LY  N++S +W+ L   K
Sbjct: 411 NTLYFLNLQSLKWFKLPFYK 430

>NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8.157
           YER132C
          Length = 1552

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 12/110 (10%)

Query: 139 AMCSHQSGVTILFGGEFSSPKQN-TFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRIT 197
           +MCS  S + I FGG   SP+ +      N+ W LD  T++W+ +      + R  H I 
Sbjct: 130 SMCSDGSNIYI-FGGLMVSPQNDYELIATNELWKLDLLTKKWTLMSKDPLIARRFDHSIF 188

Query: 198 TWK-------NYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNK 240
           T            ++ GG  +++Q  +Y +   ++N+   +W     TNK
Sbjct: 189 TLHTDEESKDTKLVVVGGLNNMDQPVNYID---IYNLSKNEWESLPNTNK 235

>KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8.157
           YGL197W
          Length = 1451

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 92/243 (37%), Gaps = 34/243 (13%)

Query: 139 AMCSHQSGVTILFGGEFSSPKQN-TFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHR-- 195
           +MC   S + I FGG   SP         N+ W LD TT+EWS L        R  HR  
Sbjct: 145 SMCYSNSSLYI-FGGLVVSPTSAYELVPTNELWRLDLTTKEWSLLSKNPKIKGRFNHRVH 203

Query: 196 -----ITTWKNYFILFGGFKDLNQGTSYFNDV-------WLFNVVDFKWTKWETTNKNQP 243
                +       ++ GG  D N+   Y  DV       W  + V            N+P
Sbjct: 204 VKNENVNIRDTKLVIVGGLDDSNRPI-YKVDVYNLTQNCWQDDAVPTDPLDIVANIDNEP 262

Query: 244 DPRSGHSWIGSNEGPIVYGGYCKVKA-----KNNKSLHKGKTLTDCWILKMSQNVNEIKW 298
              +    IGSN   +V     K+ A      NN+ L  G  +++    + SQ V+    
Sbjct: 263 VSLT----IGSNFSIMVENNEAKIPALAFYIPNNQVLSNGSDISEPENKRKSQKVD---- 314

Query: 299 ERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIY-YNDLYSYNIESNR 357
                K +  SP V   +  +     + F  + D +  +E  +  +   +++ YNI  + 
Sbjct: 315 ---CHKHEFDSPVVALPLLSNSKGMKMAFSTLQDPDILKEPFNLQFPSGEIFGYNIILSG 371

Query: 358 WYP 360
           +YP
Sbjct: 372 FYP 374

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 15/117 (12%)

Query: 139 AMCSHQSGVTILFGGEFSSP-KQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRI- 196
           AMC ++ G   +FGG   SP  +  F   ND W LD    +WS L    G   R  H + 
Sbjct: 164 AMCFNE-GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMH 222

Query: 197 ------TTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKW---TKWETTNKNQPD 244
                  T     ++ GG  ++++  +  +   +FN+   +W      +TT KN  D
Sbjct: 223 VLNSEDPTKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQWESNAVEKTTRKNSGD 276

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 83/209 (39%), Gaps = 34/209 (16%)

Query: 125 KFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKL-D 183
           +FTS    + R+  +   H  G  +  GG   +P +      +DT  +D     + +L +
Sbjct: 382 EFTSLEYDLKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQN 434

Query: 184 FKNGPSARSGHRITTWKN--YFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKN 241
               P AR+ H  T   +    ++ GG    N      ND W +N+   +W K       
Sbjct: 435 HSVLPPARACHTFTRLGDGETAMVIGG---RNAPHRAVNDCWFYNLNTNEWQK----GPE 487

Query: 242 QPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERR 301
            P+PR  HS + +++  ++  G              GKT    ++L    N++E      
Sbjct: 488 LPEPRFRHSCVATDKNTLLVCG--------------GKTDGQAFLLY--DNISETFKPCP 531

Query: 302 AKKGQQPSPRVGCSMAL-HRNNRGILFGG 329
                   P +  ++A   +NNRGI+ GG
Sbjct: 532 VDHPSLKIPLISAAVAFDEKNNRGIIMGG 560

>KAFR0B02180 Chr2 complement(425578..430209) [4632 bp, 1543 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1543

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 41/97 (42%), Gaps = 14/97 (14%)

Query: 150 LFGGEFSSPKQN-TFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNY------ 202
           +FGG   SPK +      N+ W LD  TR+WS L      + R  H I    +       
Sbjct: 147 VFGGLLVSPKNDYELVATNELWKLDMVTRKWSLLSSDPQITRRFNHTIHIQSSTEDSKDC 206

Query: 203 -FILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETT 238
             I+ GG  +L+Q       V   +V + K   WE+T
Sbjct: 207 KLIIVGGLNNLDQ------PVHHIDVFNIKKNFWEST 237

>KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1567

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 52/125 (41%), Gaps = 16/125 (12%)

Query: 139 AMCSHQSGVTILFGGEFSSPKQN-TFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRI- 196
           AMC     + I FGG   SP+        N+ W LD  T +W+ L      + R  H + 
Sbjct: 183 AMCYVDHSLFI-FGGLVVSPQNGYELVATNELWKLDLLTNKWTLLSRNPSIARRFNHTVH 241

Query: 197 ------TTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPDPRSGHS 250
                  T     I+ GG  +LN+     N + ++NV    W ++E T    PDP +  +
Sbjct: 242 VKNELRDTRDTKLIIVGGLNNLNEP---INTIDIYNVTQNCW-QFEVT---PPDPMNLSA 294

Query: 251 WIGSN 255
            I  N
Sbjct: 295 NIDGN 299

>KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8.157
           YGL197W
          Length = 1687

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 45/123 (36%), Gaps = 10/123 (8%)

Query: 126 FTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFK 185
           F + + PM        S+      +FGG   S         N+ W LD T R WS L   
Sbjct: 133 FKNPDVPMRERLFHTISYSHSAMYVFGGLIVSTNGYELIATNELWKLDLTNRVWSLLSED 192

Query: 186 NGPSARSGHRITTWKNY-------FILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETT 238
              + R  H       Y        ++ GG  +++Q  ++ +   +FN+    W      
Sbjct: 193 PQITRRFNHTTQVLNTYSEAHDTKLLIIGGLNNMDQSIAHID---VFNITKGYWETANLD 249

Query: 239 NKN 241
           +KN
Sbjct: 250 SKN 252

>Smik_10.315 Chr10 complement(501821..502873) [1053 bp, 350 aa] {ON}
           YJR043C (REAL)
          Length = 350

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 8/68 (11%)

Query: 385 EQEKELQDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTN----- 439
           E+E ++++L N +  ++DL DEE N  S SN P +  T DR++ +N+ E+ + T      
Sbjct: 204 EREAQMKEL-NNLFVEDDLDDEEPNEGSHSNLPEQTLTDDRKKSNNDLEDLLETTAEDSL 262

Query: 440 --LPKLNQ 445
             +PK++Q
Sbjct: 263 MEVPKIHQ 270

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
           {ON} weakly similar to uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1594

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 11/86 (12%)

Query: 137 SAAMCSHQSGVTILFGGEFSSPKQN-TFYHYNDTWLLDNTTREWSKLDFKNGPSARSGH- 194
           S + CS       +FGG   SP+        N+ W LD TTR+WS +      + R  H 
Sbjct: 138 SISFCS---SCLYIFGGLMVSPQNGYELIASNELWKLDLTTRKWSLISRDPQIARRFAHT 194

Query: 195 ------RITTWKNYFILFGGFKDLNQ 214
                  I T     ++ GG  +++Q
Sbjct: 195 MHTKNENIETRDTKLVIVGGLNNMDQ 220

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 203 FILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWETTNKNQPD---------PRSGHSWIG 253
            I+ GG    + G+  + D+W F++ D +W++    +++ PD         P  GHS   
Sbjct: 611 VIIHGG----SDGSRVYGDMWWFDLADERWSRIALYSRD-PDSGERRPIGLPAVGHSIFH 665

Query: 254 SNEGPIVYGG 263
           S +  ++YGG
Sbjct: 666 SRDEFLLYGG 675

>CAGL0B01485g Chr2 (132868..134892) [2025 bp, 674 aa] {ON} similar
           to uniprot|Q08282 Saccharomyces cerevisiae YOL141w PPM2
          Length = 674

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 93  LLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFG 152
           +L GG +  ++      +ND+ ++  Q   W+K  + + P+ R + +  S+     +LFG
Sbjct: 439 ILIGGRKAPHQP-----FNDVFIFEKQTASWEKVATLDYPIYRHATSSLSNDK--LLLFG 491

Query: 153 GEF 155
           G F
Sbjct: 492 GNF 494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,211,086
Number of extensions: 3550310
Number of successful extensions: 17129
Number of sequences better than 10.0: 177
Number of HSP's gapped: 17199
Number of HSP's successfully gapped: 269
Length of query: 650
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 534
Effective length of database: 40,180,143
Effective search space: 21456196362
Effective search space used: 21456196362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)