Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E027706.8ON50850826830.0
NDAI0G00860singletonON52352713121e-177
KAFR0B065106.8ON50851512881e-174
Skud_16.56.8ON51551912841e-173
Smik_6.4806.8ON51651912821e-172
TDEL0G046306.8ON50351512781e-172
YPL272C6.8ON51752012771e-172
Suva_16.336.8ON51852112521e-168
Kpol_1045.796.8ON50852812051e-161
CAGL0A01089g6.8ON53554512011e-160
SAKL0E00792g6.8ON51152011091e-146
TPHA0J002606.8ON51552111031e-145
TPHA0M001806.8ON50351410691e-141
NCAS0D021806.8ON5155239551e-123
TBLA0A072206.8ON5095248861e-113
KLTH0C11572g6.8ON5185247352e-90
Ecym_30116.8ON5095216905e-84
Kwal_56.223416.8ON5195186446e-77
ACR018C6.8ON4784875691e-66
Kpol_1032.1singletonON2462483538e-38
Kpol_191.16.8ON1391371567e-12
KLTH0C02178g5.119ON464152910.017
TBLA0C045103.497ON130779920.017
CAGL0K00737g5.119ON457119890.024
YOR377W (ATF1)na 1ON52596830.14
Kwal_27.98985.119ON46057830.15
Skud_15.544na 1ON52496790.43
CAGL0F03261g5.369ON10196701.2
Suva_8.434na 1ON52597751.4
Smik_15.559na 1ON52496751.5
Suva_6.1037.185ON1035216751.6
SAKL0F07414g7.192ON33773722.7
NCAS0F010507.172ON74535714.1
KNAG0G007005.119ON45680704.9
AGR172W8.425ON105769706.6
TBLA0F028707.503ON73780697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02770
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...  1038   0.0  
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              509   e-177
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   500   e-174
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   499   e-173
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   498   e-172
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   496   e-172
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   496   e-172
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   486   e-168
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   468   e-161
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   467   e-160
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   431   e-146
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   429   e-145
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   416   e-141
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      372   e-123
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   345   e-113
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   287   2e-90
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   270   5e-84
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   252   6e-77
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   223   1e-66
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   140   8e-38
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    65   7e-12
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    40   0.017
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...    40   0.017
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    39   0.024
YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}  ATF1Alc...    37   0.14 
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    37   0.15 
Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377...    35   0.43 
CAGL0F03261g Chr6 complement(321019..321214,321323..321432) [306...    32   1.2  
Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W ...    33   1.4  
Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377...    33   1.5  
Suva_6.103 Chr6 (180099..183206) [3108 bp, 1035 aa] {ON} YFR030W...    33   1.6  
SAKL0F07414g Chr6 complement(567798..568811) [1014 bp, 337 aa] {...    32   2.7  
NCAS0F01050 Chr6 (205972..208209) [2238 bp, 745 aa] {ON} Anc_7.1...    32   4.1  
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    32   4.9  
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    32   6.6  
TBLA0F02870 Chr6 (689179..691392) [2214 bp, 737 aa] {ON} Anc_7.5...    31   7.7  

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/508 (100%), Positives = 508/508 (100%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLT 60
           MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLT
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLT 60

Query: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120
           KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR
Sbjct: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120

Query: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180
           HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ
Sbjct: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180

Query: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240
           KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK
Sbjct: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240

Query: 241 PIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK 300
           PIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK
Sbjct: 241 PIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK 300

Query: 301 SFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDK 360
           SFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDK
Sbjct: 301 SFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDK 360

Query: 361 SKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRRMKFDDK 420
           SKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRRMKFDDK
Sbjct: 361 SKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRRMKFDDK 420

Query: 421 NTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSEELMSLSYTYCEENG 480
           NTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSEELMSLSYTYCEENG
Sbjct: 421 NTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSEELMSLSYTYCEENG 480

Query: 481 LNICIHYPENYKMESFVECFQSFLEEGN 508
           LNICIHYPENYKMESFVECFQSFLEEGN
Sbjct: 481 LNICIHYPENYKMESFVECFQSFLEEGN 508

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  509 bits (1312), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 268/527 (50%), Positives = 362/527 (68%), Gaps = 28/527 (5%)

Query: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSD----EEATLLTVKDSRLCLGL 58
           S+RALSSFEKK+L Q++D  +NG ++ A Y +     SD    + ATLL  KD RL +G+
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGI 61

Query: 59  LTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYL 118
           +T+ LE LIKKHIEL+ TINE +EF++L KIK  DVIS I FD++KDE+INC  GAPPYL
Sbjct: 62  VTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYL 121

Query: 119 LRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVN--LLS 176
           LRHIFN ++F     KPLWKLY++D+++  FHG D LFD+FS ANFH+L   E+N   L+
Sbjct: 122 LRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLT 179

Query: 177 SRPQKW--KKLDYVFKFGPDSMSEV---KQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231
           +   K   K LD VFK      + V   ++ P+SI+DNPKL++P + PDLFNLQT+SFFK
Sbjct: 180 NTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFFK 239

Query: 232 SIYVNTVKKPIEFL------TNTDV-SFLSLNSNMKYNDILDINSKLCGNTVFGCVSNER 284
           +IY NT+KKPI+        T  D+ S L       Y D+L I S LCG TVFG VS  R
Sbjct: 240 TIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPTR 299

Query: 285 FKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYY 344
           + YL  ++ Q+ +CL+SFI GI M+CLKP +KN SG + FSIP++LR+++D  ++FGL+Y
Sbjct: 300 YNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLFY 359

Query: 345 KDIRVECPLSLIDDDKSK-DCMKGASVSEE---DFDEKLMEYQFKNITGFVRNHLEQRLT 400
           KD++++CPLSLIDD   K +  K +S+ +E   +F+EKL+EYQFK +T F+ N + +RL 
Sbjct: 360 KDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVILERLK 419

Query: 401 RFSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPN-SFMIRACNL 459
            + K  FNDDDI+RMKFD    LG    N   IQI DT+ I + E    N +F +   N 
Sbjct: 420 IWEKFNFNDDDIKRMKFDHDEVLG---QNSKIIQINDTTEIMLGENDNNNKAFTLTNPNF 476

Query: 460 TKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506
           T++L+  E MS+S+  CEE GLN+CIHYP+ Y ME+FVECFQ+F+EE
Sbjct: 477 TRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 241/515 (46%), Positives = 361/515 (70%), Gaps = 20/515 (3%)

Query: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62
           ++R LSS+E+K+L +++   +NG  F A YS   E W D+  TLLT+KDSR  + +LTKA
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASSEEWGDD-TTLLTLKDSRPTIAILTKA 60

Query: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122
           ++ LI +H+ELF TINE +EFE+LK IK  D+++ ++FDS+KDEKINC  G PPYLLRHI
Sbjct: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120

Query: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182
           F+++RFVPGS KPLW L+++D+SL  FHGQD LFD+FS ANFH+LLLKE N++++ P   
Sbjct: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180

Query: 183 KKLDYVFKFGPDSMSEVK--QLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240
            + D +F    +S+ ++   +L KSIYDNP++++P  +PDLFNLQTQSFFKS++ +TVKK
Sbjct: 181 SESDIIFSL-ENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKK 239

Query: 241 PIEFL--------TNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTII 292
           PI +L          +D +   + +  KY DI D N+ L   TVFG ++ +R++YLN++I
Sbjct: 240 PIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLI 299

Query: 293 NQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPR-DFGLYYKDIRVEC 351
             + +C KSF+VGI MLCLKP ++N  G++ FSI ++LR F+ E   +FGL+YKD+ ++ 
Sbjct: 300 TNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDV 359

Query: 352 PLSLIDDDKSK-DCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDD 410
           PLSLIDD+       +  S ++ D  EK++E+QFK +T  V++ +E+R+++FS  GFNDD
Sbjct: 360 PLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDD 419

Query: 411 DIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSEELMS 470
           DIR+MK+      G  + +   I+++DTS +++        +++   N TKSL   +  S
Sbjct: 420 DIRQMKY------GKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRKNDFFS 473

Query: 471 LSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
           +SYT C+ +GLN+C+ +P++  ME+FVECFQSF+E
Sbjct: 474 VSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  499 bits (1284), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 259/519 (49%), Positives = 353/519 (68%), Gaps = 18/519 (3%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK-----EGWSDEEATLLT---VKDS 52
           M++ R LSSFEKKLL QS++  +NGT F + YS          W+ +E TL T     DS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60

Query: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112
           RL L  +   L+ LIK    LF T+NE++EFE LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231
           +N +S       ++  +F     ++S +   PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 181 LNNISLEAHSDDRV--LFDISDVNISNL-NFPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237

Query: 232 SIYVNTVKKPIEFLTNTDVSFLSLNSNM--KYNDILDINSKLCGNTVFGCVSNERFKYLN 289
           SI+ NT+K+P  +LTN      S ++    KYNDIL+ +S LCG TVFG V+N+RF YL 
Sbjct: 238 SIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLK 297

Query: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349
           +I+NQE +CL+SFI GIAM+CLKP+VK+ +G + FSIP+DLR  +D     GL++K++R+
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRI 357

Query: 350 ECPLSLIDDDKSKDCMKGASVSEED---FDEKLMEYQFKNITGFVRNHLEQRLTRFSKTG 406
           ECPLSLIDD+ S D        +ED   F+EKLMEYQF  +T  V + +  +L  + K G
Sbjct: 358 ECPLSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNG 417

Query: 407 FNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSE 466
           FNDDDIRRMK+D+ +    +S     IQI D S I+++   +  +F I +   T S+N  
Sbjct: 418 FNDDDIRRMKYDNDDCHIQNSKTK-LIQINDVSDISLSMNNDEKAFKIISSGFTSSINRP 476

Query: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
            LMSLSYTYCEE GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 477 TLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  498 bits (1282), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 260/519 (50%), Positives = 359/519 (69%), Gaps = 17/519 (3%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF--KEG---WSDEEATLLT---VKDS 52
           M++ R LSSFEKKLL QS++  +NGT F + YS    KE    W  +E TL T     DS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112
           RL L L+   L+ LIK    LF TINE++EFE L+++KTSD+++ I+F++ KD+++NC  
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171
           G PP YLLRH FN  RF+PGS +PLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231
           +N +SS      ++  +F     S+S++   PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 181 LNNISSVTHYEDRI--LFDINNVSISDL-NFPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237

Query: 232 SIYVNTVKKPIEFLTN-TDVSFLSLNSNMK-YNDILDINSKLCGNTVFGCVSNERFKYLN 289
           SI+ NT+K+P  +LTN T +S  +  + +K YNDIL+ +S LCG TVFG VSN+RF YL 
Sbjct: 238 SIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLK 297

Query: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ FSIP+DLR  +      GL++K++R+
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRI 357

Query: 350 ECPLSLIDDDKSKDCMKGASVSEEDFDE---KLMEYQFKNITGFVRNHLEQRLTRFSKTG 406
            CPLSLIDD+ S +     S   E+ +E   KLMEYQF N+T  V + +  +L  + K G
Sbjct: 358 ACPLSLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNG 417

Query: 407 FNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSE 466
           FNDDDIRRMK+D+ +     ++    +QI D S I+++   +  SF I +   T S+N  
Sbjct: 418 FNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRP 477

Query: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
            L+SLSYTYC+E GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 478 TLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  496 bits (1278), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 258/515 (50%), Positives = 344/515 (66%), Gaps = 23/515 (4%)

Query: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62
           S R+L  FEKK+L QS++G +NG  FGA YST  E WSD+ ATLLT KDSRL L LL++ 
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEEWSDD-ATLLTYKDSRLNLSLLSRT 60

Query: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122
           L  +I  H+ELF TINE+ EF  +K+IK  +VI+ + F S+KDE +NC+ GAPPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182
           FN   F PGSG  LW++Y++D++L  FHG D LFD+FS ANFH++ L+ +N +S   +  
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSIS---KSG 177

Query: 183 KKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKKPI 242
            KL  +FK      + +   PKSIYDN KL +P    DLFNLQTQSFFKS+Y N VKKP+
Sbjct: 178 SKLSTIFKL---EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPL 234

Query: 243 EFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKSF 302
           +++ +     L      +Y DIL  ++ LCG T+FG +  +R + L+ I  Q+ +CLKSF
Sbjct: 235 DYINSNPPQQLK-EYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293

Query: 303 IVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDKSK 362
           + GI MLCLKP+VKN +G++TF +PVDLRS ++   +FG++YKDIRVECPLSLIDD    
Sbjct: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353

Query: 363 DCM-------KGASVSEED--FDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIR 413
                         + E+D  + E+L+EYQFK +T  V   L QR+  + K GFNDDDI+
Sbjct: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413

Query: 414 RMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGE-PNSFMIRACNLTKSLNSEELMSLS 472
           RMKF   +T    + N   IQI D S I V+   +    F +R  N+T+SL   +LMSLS
Sbjct: 414 RMKFGSDDT----ATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLS 469

Query: 473 YTYCEENGLNICIHYPENYKMESFVECFQSFLEEG 507
           YT+ E+ GL+ICIHYP+ Y MESFVECFQSF+E+ 
Sbjct: 470 YTHSEK-GLDICIHYPDGYNMESFVECFQSFIEDA 503

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  496 bits (1277), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 261/520 (50%), Positives = 356/520 (68%), Gaps = 18/520 (3%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF-----KEGWSDEEATLLT---VKDS 52
           M++ R LSSFEKK+L QS++  +NGT F + YS          W  +E TL T     DS
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112
           RL L L+   L+ LIK    LF T+NE++EFE LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231
           +N +S+      ++  +F     ++SE+K  PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 181 LNEISTVTHSEDRI--LFDVNDINLSELK-FPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237

Query: 232 SIYVNTVKKPIEFLTNTDV--SFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLN 289
           SIY NT+K+P  +LTN     S +S     KYNDIL+ ++ LCG TVFG V+N+RF YL 
Sbjct: 238 SIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLK 297

Query: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ F+IP++LR+ +      GL++K++RV
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRV 357

Query: 350 ECPLSLIDDDKSKDCMKGASVSEEDFDE----KLMEYQFKNITGFVRNHLEQRLTRFSKT 405
           ECPLSLIDD+ S +     S   ED D+    +LMEYQF  +T  V   +  +L  + K 
Sbjct: 358 ECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKN 417

Query: 406 GFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNS 465
           GFNDDDIRRMK+D+ +     ++    IQI D S I+++  G+  SF I +   T S+N 
Sbjct: 418 GFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINR 477

Query: 466 EELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
             LMSLSYTYCEE GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 478 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  486 bits (1252), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 257/521 (49%), Positives = 355/521 (68%), Gaps = 19/521 (3%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK-----EGWSDEEATLLT---VKDS 52
           M++ R LSSFEKKLL QS++  +NGT F + YS          W  +E TL T     DS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112
           RL L L+   L+ LIK    LF T+NE +E+  LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231
           +N ++S  +   ++  +F     + +E+   PKSIYD+ KL +P + P + + QTQSFFK
Sbjct: 181 LNSITSVSRSDDRV--LFDINDVNFAEL-SFPKSIYDSAKLRLPAMTPQILHKQTQSFFK 237

Query: 232 SIYVNTVKKPIEFLTN-TDVSFLSLNSNMK-YNDILDINSKLCGNTVFGCVSNERFKYLN 289
           SI+ NT+K+P  +LTN T  S  +  S +K YNDIL+ NS LCG TVFG V+N+RF YL 
Sbjct: 238 SIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLK 297

Query: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ FSIP+DLR  ++     GL++K++R+
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRI 357

Query: 350 ECPLSLIDDDKSKD-----CMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404
           ECPLSLIDD+ S +          +   ++F+EKLMEYQF  +T  V N++  +L  + +
Sbjct: 358 ECPLSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWER 417

Query: 405 TGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLN 464
            GFNDDDIRRMK+D+ +     ++    IQI D S I+++   +  SF I +   T S+N
Sbjct: 418 NGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSIN 477

Query: 465 SEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
              LMSLSYTYCE+ GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 478 RPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  468 bits (1205), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/528 (47%), Positives = 347/528 (65%), Gaps = 44/528 (8%)

Query: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEY-STFKEGWSDEEATLLTVKDSRLCLGLL 59
           M+S R L ++EKKL+ Q++ G  NG  F A+Y S  ++G +D+ ATLLT  +  L    L
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDD-ATLLTNSEPLLLDSRL 59

Query: 60  TKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLL 119
             AL+ ++ KH EL  T+NE+ EFE +K+IKTSD+I++++FDS KDE +NC LGAPPYLL
Sbjct: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119

Query: 120 RHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRP 179
           RHIFN ++F PGSGKPLW+L ++DDSL  FHGQD LFD+F+ ANFH+L L+ +N  S   
Sbjct: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLN--SMDD 177

Query: 180 QKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVK 239
           +    L+Y++++     +     P++IY+NPKL IP    DL NLQTQSFFKS YVN +K
Sbjct: 178 EHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237

Query: 240 KPIEFLTNTDVSFLSLNSN-MKY-----NDILDINSKLCGNTVFGCVSNERFKYLNTIIN 293
           KP++ +T         NS  MKY      D ++  S LCG TVFG ++ +RF+YLN+I  
Sbjct: 238 KPLDIIT--------FNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIAR 289

Query: 294 QEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPL 353
            E +C++SFI GIA+LCLK M+K+ +G++TFSIPV+LR  ++ P DFGL+YK I VECPL
Sbjct: 290 HENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPL 349

Query: 354 SLIDDDKSKDC-------MKGASVSEED--FDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404
           SLIDD    +             V E D  F+EK +EYQFK I+  V   +++R+  + +
Sbjct: 350 SLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRR 409

Query: 405 TGFNDDDIRRMKF--DDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRA----CN 458
            GFNDDDI++MKF  DDK      ++N   IQI D     V+EF   +S   +      N
Sbjct: 410 NGFNDDDIKKMKFTSDDK------ASNTKIIQIND-----VSEFKINSSKSSKVSIKELN 458

Query: 459 LTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506
            T S+++ + MSLSYTYC+E G NICIHYP+ Y ME FVE FQSF+ +
Sbjct: 459 FTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  467 bits (1201), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 258/545 (47%), Positives = 360/545 (66%), Gaps = 56/545 (10%)

Query: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEY------STFKEGWSDEEATLLTVK-DSR---- 53
           R+LSS+E+KLL + ++  KNGT FGA Y      +  +  W D+  TL   + +SR    
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 54  ----LCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKIN 109
               L L L+T+AL++LI+K+ E++ T+N+  EF  LK+I+T DVIS + FD+ KDEK+N
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 110 CQLGAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLL 168
           C  G PP YL+RHI  +D F PGS KPLW LYL+D+S   FH QD LFD+FS ANFH+L 
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 169 LKEVNLLSSRPQKW--KKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQT 226
           LKE+ +   RPQ+   K L+Y+FK    S      +PKSIYDN KL++P   P+L NLQT
Sbjct: 183 LKEL-IAVCRPQQSYEKPLEYLFKLQ-KSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240

Query: 227 QSFFKSIYVNTVKKPIEFL-------------TNTDVSFLSLNSNM------KYNDILDI 267
           QSFFKSI+ N VKKP++F+             ++   + +S   N       +Y +IL  
Sbjct: 241 QSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTS 300

Query: 268 NSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIP 327
            +  CG+T+FG VSNERF YLN+++  E +CL+SFI  I MLCLKPMVK+ +GT+ FS+P
Sbjct: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360

Query: 328 VDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDKSKDC-MKGASVSEEDFDEKLMEYQFKN 386
           ++LR  ++E RDFGL YKDIRVECPLS+IDD   K C + G + S+ +++EKL+E QF+ 
Sbjct: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDD---KQCSVPGLNESDPEYNEKLLEIQFQQ 417

Query: 387 ITGFVRNHLEQRLTRFSKTGFNDDDIRRMKF---DDKNTLGGSSNNGTFIQIYDTSLINV 443
           I  +V   +EQR++ + K G+ND+D++RMKF   D+K      + N   I+I D S ++ 
Sbjct: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEK-----FAPNTRLIKINDVSEVSF 472

Query: 444 --NEFGEPNSFMIRACNLTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQ 501
             N+   P+   I++   T SL+   LMSLSYT+CEE+GLNICIHYP+ Y ME+FV+CF+
Sbjct: 473 DDNDIRFPH---IKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFE 529

Query: 502 SFLEE 506
           SF+EE
Sbjct: 530 SFMEE 534

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  431 bits (1109), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 237/520 (45%), Positives = 328/520 (63%), Gaps = 34/520 (6%)

Query: 3   SVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF---KEGWSDEEATLLTVKDSRLCLGLL 59
           S R+LSS EKKL  Q+++  +NG  F A YST    +E WSD  ATLLTVKD RL   L+
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDN-ATLLTVKDQRLSNSLV 64

Query: 60  TKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLL 119
           ++AL+ +I  ++EL+ TIN+  EF+ +K I   DV+  ++FDS+KDE +NC  G PPYLL
Sbjct: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124

Query: 120 RHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRP 179
           RHIF+ ++F     KPLW++ ++D+++  FHG D LFD+F+ ANFH+L  + +N L   P
Sbjct: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL---P 181

Query: 180 QKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVK 239
           +    L+ +FK    + S+    PKSIY+N KL +P +  DLF LQTQSFFKS+Y  T+K
Sbjct: 182 KDGPTLECLFK----NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIK 237

Query: 240 KPIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCL 299
           KP++F+     S L    +  Y DIL   + LCG TVFG +S ER   L  I+ QE +CL
Sbjct: 238 KPLDFINTNPNSGLKYYQSC-YTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICL 296

Query: 300 KSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDD 359
            SF+  IA+LCLKP+V N   +VTFSIPVDLRS + +   FGL YK++ VECPL+LIDD 
Sbjct: 297 SSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK 356

Query: 360 --KSKDCMKGASV-------SEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDD 410
             +  +   G  +        + +++E L+EYQF+     V N L+QR   + ++GFNDD
Sbjct: 357 VFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416

Query: 411 DIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEF----GEPNSFMIRACNLTKSLNSE 466
           DI+RMKF       G +  G   +I + +  NV EF     +  +F I+    TKS N E
Sbjct: 417 DIKRMKF-------GKTEQGKSKRIIEVN--NVTEFQFHVDDNATFNIKDVCFTKSQNLE 467

Query: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506
             MSLS  + E +GLN+CIHYP+ Y M+ FVECFQSF+EE
Sbjct: 468 TFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEE 507

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  429 bits (1103), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/521 (44%), Positives = 328/521 (62%), Gaps = 27/521 (5%)

Query: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWS--DEEATLLTVKDSRLCLGLLTKA 62
           R L+S+E+ +L++S +   NGT F A+Y+  +   +  D+ ATLLT  +          A
Sbjct: 4   RPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFINA 63

Query: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122
           L  +I ++ EL+ TIN + EFE + +IKT DVIS+I+F+S KDE +NC+ GAPPYLLRHI
Sbjct: 64  LATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRHI 123

Query: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182
           FN D+FVPGSGKPLW LY++DDS+  FHGQD LFD++S A+FHR   K    L       
Sbjct: 124 FNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHR---KFFAALEGATPTS 180

Query: 183 KKLDYVFKFGPDSMSEVK-QLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKKP 241
           +KL  +F+    S S +    PKSIYD+P L +P    DL +LQT+ F KS+   T+ KP
Sbjct: 181 EKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKP 240

Query: 242 IEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKS 301
           +  +   D    S  +N    DIL+  S LCG TVFG +SNERF YL +I  +E +C KS
Sbjct: 241 LNIIMFNDEPMKSF-TNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKS 299

Query: 302 FIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDD-- 359
            + GI MLCLKP++K+ S  +TFSI ++LR  ++E  +FGL+YK++R+E PLS IDD+  
Sbjct: 300 LVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVF 359

Query: 360 KSKDCMKGASVSEE-------DFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDI 412
           K K    G   S         +++E+L+ YQF  I  F+  +L+QR+  + + GFNDDDI
Sbjct: 360 KLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDI 419

Query: 413 RRMKF--DDKNTLGGSSNNGTFIQIYDTSLIN---VNEFGEPNSFMIRACNLTKSLNSEE 467
           + MKF   DKNT      +   IQI D S ++   +N+ GE NS  ++  + T SL  ++
Sbjct: 420 KMMKFGSKDKNT------SAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQ 473

Query: 468 LMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEEGN 508
            MSLSYT+C+  G NICIH+PE Y +E FVE FQ+F++ G+
Sbjct: 474 FMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFIDGGD 514

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/514 (44%), Positives = 330/514 (64%), Gaps = 28/514 (5%)

Query: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEG--WSDEEATLLTVKD-SRLCL-GLLT 60
           RAL  +EKK+L Q+++G +NG  F ++ +  K+   ++D+ ATL T +  + + L  +L 
Sbjct: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVLC 63

Query: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120
            AL+N+I  H+EL+ TIN++  F  + +I+T+DVI TI +D  KD+ +  +      LLR
Sbjct: 64  AALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLLR 122

Query: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180
           HIFN   F P +GKPLW+  + +DS   FHG D LFD+FSTANF + LLKE+N + +  Q
Sbjct: 123 HIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSNQ 182

Query: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240
           K K +  +FKF  D+   +   P+SIY+NPKL++P L  DL NLQTQSFFK+IY NT+KK
Sbjct: 183 KLKTVKTLFKF--DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKK 240

Query: 241 PIEFLTNTDVSFLSLNSNM------KYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQ 294
           PI+ +T+ +    S N+N       +  DIL   + LCG TV G +S ER+++L  ++ Q
Sbjct: 241 PIDLITSAN----SNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQ 296

Query: 295 EGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLS 354
           E + L+SFI  I M+CLKP+VKN  G++ FSIPV+LRS + +  DFGL+YK+I+VECPL 
Sbjct: 297 ENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLE 356

Query: 355 LIDDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRR 414
           LI+D+K         V     +  L+E QF+ I+  V + + QR+  + K GFNDDDI+R
Sbjct: 357 LINDEK---YYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDDDIKR 413

Query: 415 MKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPN---SFMIRACNLTKSLNSEELMSL 471
           MKF +    G +      IQI D + I+  +FG  N   SF +   N TKSL+  E MSL
Sbjct: 414 MKFSNDEKTGIAP----IIQINDVTEISF-DFGNDNISYSFSVNNLNFTKSLSCNEFMSL 468

Query: 472 SYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
            Y++  + GLNICIHYP+ Y ME+FVECFQSF+E
Sbjct: 469 FYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  372 bits (955), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/523 (41%), Positives = 316/523 (60%), Gaps = 32/523 (6%)

Query: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYS---TFKEGWSDEEATLLTVKDSRLCLGLLTK 61
           R LS +E KLL Q++ G +NG  F A+Y          S +E+TL+++KD RL L ++T+
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 62  ALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRH 121
            L+ LI KHIEL+  I+E   + ++ +I+  DVI  I FDS KDE+INC LG PPYLLRH
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 122 IFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVN-----LLS 176
           IFN   F  G  KPLWKLY++D++   FHG D LFD FS A FH+  L EVN     ++S
Sbjct: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183

Query: 177 SRPQKWKKLDYVFKF--GPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIY 234
           S+ +  K LDY+F+     D +    ++P+SIYD        L   +FN QT+SFFKS+Y
Sbjct: 184 SKQK--KPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLY 241

Query: 235 VNTVKKPIEFLTNTDVSFLSLNS-----NMKYNDILDINSKLCGNTVFGCVSNERFKYLN 289
           +N VKKPIEF+TNT     +           Y + + I+  LCGNT+FG +S+ RF  L 
Sbjct: 242 LNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELT 301

Query: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349
               +E + LKS I G+ M+ LKP + + S  + FSI V+LR  V + + FGLYY+DI +
Sbjct: 302 EKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIII 361

Query: 350 ECPLSLIDDDK-----SKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404
           ECPLSLIDD        +D + G +  E +  EK+ E QFK++T +++N + +++  +  
Sbjct: 362 ECPLSLIDDRAIQFSGYRDHV-GITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYWK- 419

Query: 405 TGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNE-FGEPNSFMIRACNLTKSL 463
               D+DI+ M    K       +    IQI D + I++NE   + + + +++ ++  SL
Sbjct: 420 ---TDNDIKMM----KMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSL 472

Query: 464 NSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506
           + +E+ S+SYT+CE +GL I IH P+   MESFVE FQ+FL+E
Sbjct: 473 SKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 311/524 (59%), Gaps = 49/524 (9%)

Query: 4   VRALSSFEKKLLLQSVDG-LKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62
           +R LSS EK+ L  S++   ++G+    ++ +     SD+ ATLL+ KD  L + L+++A
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDD-ATLLSSKDKPLTISLVSRA 70

Query: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122
           L+ LI  HIE+F TIN+  EF++L KI TSDV+ +I F++ KDE +NC  GAPPYL+ +I
Sbjct: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130

Query: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182
           F+   F P S KPLW+L++++ SL  F+G D LFD+F+ ANF +LL + +N   S P + 
Sbjct: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIIN---SLPYEN 187

Query: 183 KKL--DYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240
           K++  D +FK            PKSIYDNP L++P   P+LFNLQTQSFFKSIY+NT KK
Sbjct: 188 KEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247

Query: 241 PIEFLTNTDVS--FLSLNSNMK--YNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEG 296
             ++L  T  +   L+ N N+   YN+IL +NS +    V G VS ER+  L  +I+ E 
Sbjct: 248 SFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEK 307

Query: 297 LCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFV---------------DEPRDFG 341
           + LKSF   I ++CLK M+    G++ F IP +LRS                 D   + G
Sbjct: 308 IDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELG 367

Query: 342 LYYKDIRVECPLSLIDDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTR 401
           + YKDI VE PL LI               E+  +E ++E QFK +  ++   +++R+  
Sbjct: 368 IIYKDIYVEVPLKLI---------------EKIGNEDVVEEQFKIVCNYINESIQKRIKA 412

Query: 402 FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTK 461
           + K GFNDDDI+RMKF       G    G  I++ D + ++++   + + F I   +LT+
Sbjct: 413 WEKNGFNDDDIKRMKF-------GYEQVGNIIEVNDLTSLDLS-CSKDSLFHIEDLSLTR 464

Query: 462 SLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
           +L   +++SLS+     NGLN+CI+Y   YKM+ F++CFQSF+E
Sbjct: 465 NLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  287 bits (735), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 277/524 (52%), Gaps = 32/524 (6%)

Query: 1   MSSV----RALSSFEKKLLLQSVDGLKNGTTFGAEY-STFKEGWSDEEATLLTVKDSRLC 55
           MSSV    R L+  EK +L ++  G+KNG  F A Y   F      +  TL +  + RL 
Sbjct: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60

Query: 56  LGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAP 115
             ++ KAL  +IK+H EL   ++   EFE + KI   DV+  I+FD + DE++NC  G P
Sbjct: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120

Query: 116 PYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLL 175
           PYLLRHIF+   F  G  +PLW+L+++D ++  FHG D LFD F+ ANFH+L L+ +N L
Sbjct: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180

Query: 176 SSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYV 235
           S      +    VFK G      +  LP++++   +    +   D F  Q+Q+  +S+Y 
Sbjct: 181 SESCTSPRP---VFKGG----KILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYN 233

Query: 236 NTVKKPIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQE 295
             +KKP+ F+ +  +   S   +    + L+  + LCG  VFG +S  RFK L  I+N  
Sbjct: 234 LAIKKPLRFIESGRIEH-STEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDH 292

Query: 296 GLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSL 355
            + +K+FI+   + CL+P++ +    +TFS+P++LR  +      G+Y++++ +ECPL  
Sbjct: 293 KISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGT 352

Query: 356 IDDDKSKDCMKGASVSEEDF--------------DEKLMEYQFKNITGFVRNHLEQRLTR 401
               ++ +C  G+ VS  +               D+   E  F+     V N L++ L  
Sbjct: 353 A--GRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQD 410

Query: 402 FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTK 461
                F D D+  MK + +     +++    I+I D S I+++    P+ +++     TK
Sbjct: 411 LETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLSNVN-PSQYVVEDICATK 467

Query: 462 SLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
           S  +   MS+SY++    GLN+ IHY E+ +M  FVE F++FLE
Sbjct: 468 SRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  270 bits (690), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 283/521 (54%), Gaps = 37/521 (7%)

Query: 2   SSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK---EGWSDEEATLLTVKDSRLCLGL 58
           SS+R LSS EK    +     +NG  F   YS+ K   E WSD+  TL  ++DSRL  G 
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDD-ITLSNLRDSRLFDGQ 64

Query: 59  LTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYL 118
           ++ ALE +IK+++EL +TI +  +F   + I+  DV+  I+F ++KDE I CQ G PPY+
Sbjct: 65  ISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYI 124

Query: 119 LRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSR 178
           LR+I  +++F    G+PLW+L ++D ++   H  + +FD+F+ ANFH   LK    LS  
Sbjct: 125 LRNILENNKF--EFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFH---LKFQKALSQF 179

Query: 179 PQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTV 238
           P+    LD +F +  + +    QL K+ +D     I         LQ  S  K  Y  TV
Sbjct: 180 PKDTHALDILFVYEGNEL----QLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTV 234

Query: 239 KKPI-----EFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIIN 293
           KK +      F+ N  ++    + +  +  + + N+ LCG TV G ++ ER   L  + +
Sbjct: 235 KKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLELTS 293

Query: 294 QEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPL 353
            E +C+ S +  I +L LKP+++  +G++TF +P+D+R  + E  D G+ Y ++ VECPL
Sbjct: 294 SENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPL 352

Query: 354 SLIDDDKSKDCMKGASV--------SEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKT 405
           S I+D   +  +   ++        +  D+ E L+EYQFK +T  V N L+++   + K 
Sbjct: 353 SFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKR 412

Query: 406 GFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNS 465
            F+   ++  K    N +      G FI+I   +L+++ E  +   F  +  N T SL S
Sbjct: 413 RFDMSSLKGKKLRRSNKII----RGKFIEI---NLVDMGE-AQDGQFHTKNVNFTSSLGS 464

Query: 466 EELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506
           + L+S+S       G+NI +HYPE+  M++FVECFQ  LE+
Sbjct: 465 KCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  252 bits (644), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 279/518 (53%), Gaps = 31/518 (5%)

Query: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGL----LT 60
           R L++ EK ++ ++  G+KNG  F    ST+ EG  + + T  +V   ++  GL    + 
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFS---STYFEGPDNVDNTSPSVSCMKMGKGLPDAIMW 65

Query: 61  KALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120
           +AL  +IK++ EL  +IN+  +FE +  I   DV+  I+FD+  DEK++C  G PPYLLR
Sbjct: 66  QALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLR 125

Query: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180
           HIF+   F  G  KPLW+++++D S+  FHG D LFD F+ A FH+L L+ +N  S R  
Sbjct: 126 HIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN--SFRNV 183

Query: 181 KWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240
           K +K D +FK   D +     L +S+     + + +   D     +Q+  K++Y   +KK
Sbjct: 184 KGQKSDLIFKTREDLIP----LCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKK 239

Query: 241 PIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK 300
           P+ F+ +  +    + ++  Y D+      LCG  VFG V+ ER + L  ++N+  +  +
Sbjct: 240 PLRFIESGRLEHSGIPASNPY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFR 298

Query: 301 SFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDK 360
           SFI+ + M CL P+++     + FS+P++LR  +    D G++  ++  ECPL LI  D 
Sbjct: 299 SFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDI 358

Query: 361 ---------SKDCMKGASVSE---EDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFN 408
                    +++ ++G+++++    + D+   +  F+ I   V   LE    R  K+  +
Sbjct: 359 EPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSS 418

Query: 409 DDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNS-FMIRACNLTKSLNSEE 467
            +D+  +K + +     +S+    ++I D  L+ V+   + +S + I     T S  S+ 
Sbjct: 419 GEDL--IKAEREARYFAASSRSKIVEIND--LLEVDLSSKIHSRYKIGDVCSTSSRKSDT 474

Query: 468 LMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505
            MS+SY   E +GLN+ IHY E + ME FVE F+ FL+
Sbjct: 475 FMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  223 bits (569), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/487 (31%), Positives = 250/487 (51%), Gaps = 51/487 (10%)

Query: 36  KEGWSDEEATLLTVKDSRLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVI 95
           +E WSD  +TL++ +   L    ++ AL ++I++++E+ +T+ +  +F  + +I+  DV+
Sbjct: 25  QETWSDS-STLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVV 83

Query: 96  STIQFDSFKDEKINCQLGAPPYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCL 155
             I+F ++KDE I C  G PPY+ RHI N  +F   +GKPLW++Y+ D S+  FH  + L
Sbjct: 84  RVIEFQTYKDEAIACHDGIPPYVARHILNKSKF--EAGKPLWEVYIADGSMVIFHCHNVL 141

Query: 156 FDVFSTANFHRLLLKEVNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIP 215
           FD+F+  NFH +  ++      + +   +  +V++ GP       QLP    D     +P
Sbjct: 142 FDLFAAGNFH-VRFQQALQRCEKNEPHNETLFVYEGGP------LQLP---IDPDACSLP 191

Query: 216 TLN-PDLFNLQTQSFFKSIYVNTVKKPIEFLTNTDVSFLSLN-SNMKYNDILDINSK--L 271
            ++ P   +    SF K++      KP   L +     L LN S++     L    K  L
Sbjct: 192 GVDVPYPASSPFVSFVKNV-CRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESL 250

Query: 272 CGNTVFGCVSNERFKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLR 331
            G TV G +++++   L  +I++E +C++SF+  I +L LKP+++N  G++ FSIP+DLR
Sbjct: 251 YGTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLR 310

Query: 332 SFVDEPRDFGLYYKDIRVECPLSLIDD--------DKSKDCMKGASVSEEDFDEKLMEYQ 383
           +   +   FG   K I V+CPL+LIDD          SK        +   F E L+EYQ
Sbjct: 311 TESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQ 370

Query: 384 FKNITGFVRNHLEQRLTR--FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLI 441
           FK +T  V   L  + +     K  ++   +R+ K  +                     I
Sbjct: 371 FKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIE---------------------I 409

Query: 442 NVNEFGEPNS--FMIRACNLTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVEC 499
           NV + G   S  F I+  N T SL SE  MSLS       G+N+C+HY E   M+ FV+C
Sbjct: 410 NVVDMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDC 469

Query: 500 FQSFLEE 506
           FQ+FL+E
Sbjct: 470 FQTFLDE 476

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  140 bits (353), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 129/248 (52%), Gaps = 29/248 (11%)

Query: 268 NSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIP 327
           +S +    +FG ++ ERF  L  +I +  +CL+S I GI MLC KP ++N  G + FSI 
Sbjct: 17  DSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIG 76

Query: 328 VDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDKSKDCMKGASVSEEDFDEKLMEYQFKNI 387
           VD++  VD+   FG+  K+I V+CPL LIDD   KD     + SE   +  ++E QF+ +
Sbjct: 77  VDMKPIVDDSSQFGILKKNIIVDCPLKLIDDKHYKD-----TDSESIKNGDILEIQFRKV 131

Query: 388 TGFVRNHLEQRLTRFSKTGFNDDDIRRMKFDDKNT-LGGSSNNGTFIQIYDTSLINVNEF 446
           T FV   L  +L   +K            F   N     SS N    QI D+ +I +N+ 
Sbjct: 132 TDFVTEELSNKLQSMAK-----------HFKRNNCPFNFSSINS---QISDSKVIQINDL 177

Query: 447 GE---------PNSFMIRACNLTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFV 497
            +         PN +      +T+ L+  E MSLSY     + ++I IHY E   M+SFV
Sbjct: 178 TDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFV 237

Query: 498 ECFQSFLE 505
           ECF++F+E
Sbjct: 238 ECFRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 64.7 bits (156), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 73/137 (53%), Gaps = 2/137 (1%)

Query: 4   VRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKAL 63
           +R L+  EK  L Q+ +G  NG  F  + S   E    ++ATL T  +S     LL K+L
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKSL 61

Query: 64  ENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPY-LLRHI 122
           + LI K+ EL  T++E   F  L ++KT+DV+  I +   K + IN  L  P   L+  I
Sbjct: 62  KLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFD-INEGLSGPSSSLINSI 120

Query: 123 FNHDRFVPGSGKPLWKL 139
           + H  F PGSGKP  KL
Sbjct: 121 YYHSNFQPGSGKPYGKL 137

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 19/152 (12%)

Query: 59  LTKALENLIKKHIELF---LTINEQFEFEVLKK-IKTSDVISTIQFDSFKDEKINCQLGA 114
           + +A+  ++ ++ +L+   +T N     E L+  +  SDV+   + +S  +E  N     
Sbjct: 38  IVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN----- 92

Query: 115 PPYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCL-FDVFSTANFHRLLLKEVN 173
                  IF    FV G+ KPLWK+ +L D   F    D L  D  S   F    ++ +N
Sbjct: 93  ------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSLN 146

Query: 174 LLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKS 205
             +S        + VFK  P+ ++ V Q P S
Sbjct: 147 --ASHADSTFPDEVVFKPSPN-IAHVPQHPYS 175

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1307

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 5/79 (6%)

Query: 357 DDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLT-----RFSKTGFNDDD 411
           DD+ S D +K   + +E  +   +    +N    +RN+LEQ+L      R     F+DD+
Sbjct: 663 DDETSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDE 722

Query: 412 IRRMKFDDKNTLGGSSNNG 430
           I+     DKN +G SS+NG
Sbjct: 723 IKDTSISDKNYMGNSSSNG 741

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 16/119 (13%)

Query: 62  ALENLIKKHIELFLTI----NEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPY 117
           AL  ++  H +L+       NE     + + IK  DV+  + +D++ +E+IN        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 118 LLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCL-FDVFSTANFHRLLLKEVNLL 175
               +F    F  G  KPLWK+ ++  +       D L FD  +T  F   LLK +  L
Sbjct: 95  ----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEEL 149

>YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}
           ATF1Alcohol acetyltransferase with potential roles in
           lipid and sterol metabolism; responsible for the major
           part of volatile acetate ester production during
           fermentation
          Length = 525

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 15/96 (15%)

Query: 131 GSGKPLWKLYLLDDSLA------FFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKWKK 184
           G   P W+L  L +          F    C+ D  S+ +F   L  E+N + + P   KK
Sbjct: 163 GPTGPSWRLICLPEEHTEKWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPP---KK 219

Query: 185 LDYVFKFGPDSMSEVKQLPKSI-----YDNPKLYIP 215
           LDY+FK+  D    +++LP+ I     +  P L+IP
Sbjct: 220 LDYIFKYEED-YQLLRKLPEPIEKVIDFRPPYLFIP 254

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 122 IFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQD-CLFDVFSTANFHRLLLKEVNLLSS 177
           IF    F  GSGKPLWK+ +L+D        D  + D  ST  F +  L  +N  +S
Sbjct: 94  IFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNATAS 150

>Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 15/96 (15%)

Query: 131 GSGKPLWKLYLLDDSLA------FFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKWKK 184
           G   P W+L  L +          F    C+ D  S+ +F   L  E+N + + P   KK
Sbjct: 162 GPTSPNWRLICLPEEHTDKWKKFIFVSNHCMSDGRSSIHFFHDLKAELNDIKTPP---KK 218

Query: 185 LDYVFKFGPDSMSEVKQLPKSI-----YDNPKLYIP 215
           LDY+FK+  D    +++LP+ I     +  P L+IP
Sbjct: 219 LDYLFKYEND-YQLLRKLPEPIEKVIDFRPPYLFIP 253

>CAGL0F03261g Chr6 complement(321019..321214,321323..321432) [306
           bp, 101 aa] {ON} similar to uniprot|P89114 Saccharomyces
           cerevisiae YHR079ca SAE3
          Length = 101

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 14/96 (14%)

Query: 214 IPTLNPDLFNLQTQ---------SFFKSIYVNTVKKPIEFLTNTDVSFLSLNSNMKYNDI 264
           I  L   L  LQ Q           FKS Y N+V K  +  +   +    + S   YN++
Sbjct: 9   IRELKAHLVELQLQRKYLDEKFIQLFKSAYQNSVDKEPDMESPVKIIAKHIKSLKTYNEL 68

Query: 265 LDINSKLCGNTVFGCVSNERFKYLNTIINQEGLCLK 300
            D+  KL       CV++E+   +  I  + G+ +K
Sbjct: 69  RDVGLKLA-----QCVADEKNVSIGQIFEEIGISMK 99

>Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W
           (REAL)
          Length = 525

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query: 131 GSGKPLWKLYLLDDSLA-------FFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKWK 183
           G   P W+L  L +           F    C+ D  ++ +F + L  E+N + + P   K
Sbjct: 162 GPTSPTWRLICLPEEGYTDKWKKFIFLSNHCMCDGRTSIHFFQDLRDELNNIKTPP---K 218

Query: 184 KLDYVFKFGPDSMSEVKQLPKSI-----YDNPKLYIP 215
           KLDY+F++  D    +++LP+ I     +  P ++IP
Sbjct: 219 KLDYIFQYEKD-YQLLRKLPEPIENMIDFRPPYMFIP 254

>Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 15/96 (15%)

Query: 131 GSGKPLWKLYLLDDSLA------FFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKWKK 184
           G   P W+L  L +          F    C+ D  S+ +F   L  E+N + + P   +K
Sbjct: 162 GPNGPNWRLICLPEEHTDRWKKFIFVSNHCMSDGRSSIHFFHDLRDELNRIKTPP---RK 218

Query: 185 LDYVFKFGPDSMSEVKQLPKSI-----YDNPKLYIP 215
            DY+F++  D    +++LP+ I     +  P L+IP
Sbjct: 219 TDYIFQYESD-YQLLRKLPEPIERVIDFRPPYLFIP 253

>Suva_6.103 Chr6 (180099..183206) [3108 bp, 1035 aa] {ON} YFR030W
           (REAL)
          Length = 1035

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 90/216 (41%), Gaps = 43/216 (19%)

Query: 4   VRALSSFEKKL--LLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTK 61
           V+ALS  + K   L    D L N  TF A++ T     S E+ T   +  ++L +     
Sbjct: 392 VKALSLEDGKYVSLRTKFDNLANAGTFQAQFVT-----SAEQVTTSNIDRTKLAI----- 441

Query: 62  ALENL-IKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLR 120
            +E++ + KH+++  T+ EQ    ++ +  T D    +  DS   E    +LG P   L 
Sbjct: 442 -VEDISLLKHLDVVATVEEQGSIALVSQTTTKD----LDLDSV--ESYVKKLGVPESFLI 494

Query: 121 HIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQ 180
            I           K   KL+++D   A     +    +F  A F +L    +++  S  +
Sbjct: 495 SI----------AKKNIKLFIID---AEAINDESKLSLFIQAVFWKLAFN-LDVAESTNR 540

Query: 181 KWKKLDYVFKFGPDSMSE---------VKQLPKSIY 207
            WK +D        S+SE         +K++P + Y
Sbjct: 541 IWKSIDANADISAASISEFITAALQDSIKEVPSTAY 576

>SAKL0F07414g Chr6 complement(567798..568811) [1014 bp, 337 aa] {ON}
           similar to uniprot|P40546 Saccharomyces cerevisiae
           YIL019W FAF1 Protein required for pre-rRNA processing
           and 40S ribosomal subunit assembly
          Length = 337

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 378 KLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYD 437
           K+ + QF+ I    +  +E+R+ +  KT   +   RR +    NT+G S+ NG  I   +
Sbjct: 252 KVRKGQFRKIDATYKKDIERRIGQSVKTRDQERTARRTRGLKVNTIGRSTRNGLVISKEE 311

Query: 438 TSLINVNEFGEPN 450
            + IN   F EP+
Sbjct: 312 INRING--FSEPH 322

>NCAS0F01050 Chr6 (205972..208209) [2238 bp, 745 aa] {ON} Anc_7.172
           YIR007W
          Length = 745

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 18/35 (51%)

Query: 106 EKINCQLGAPPYLLRHIFNHDRFVPGSGKPLWKLY 140
           +KIN   G   YL  H     RF  GSG PLW LY
Sbjct: 115 QKINILGGIYVYLDPHQDAWSRFTGGSGAPLWTLY 149

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 92  SDVISTIQFDSFKDEKINCQLGAPPYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHG 151
           +++   +++D F + K   Q  A   L   IF    F     KPLW++  +  S  F   
Sbjct: 68  ANITVPLRYDDFVEVKQWGQWDA--QLANEIFKEYNFQYTVEKPLWRILAMPKSSTFVLL 125

Query: 152 QD-CLFDVFSTANFHRLLLK 170
            D  LFD  ST N  R LL+
Sbjct: 126 VDHVLFDGMSTVNLWRCLLE 145

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%)

Query: 214 IPTLNPDLFNLQTQSFFKSIYVNTVKKPIEFLTNTDVSFLSLNSNMKYNDILDINSKLCG 273
           +PT N  L    T S   SI++    K  E  TNT +  ++    M   D+L I   L  
Sbjct: 501 LPTCNLWLTQSLTLSIMYSIFLEPWDKASEVQTNTLLKQVNAVCTMVRKDLLPIVGSLAH 560

Query: 274 NTVFGCVSN 282
           ++ FGC +N
Sbjct: 561 HSSFGCPAN 569

>TBLA0F02870 Chr6 (689179..691392) [2214 bp, 737 aa] {ON} Anc_7.503
           YER022W
          Length = 737

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 10/80 (12%)

Query: 374 DFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTGFNDDDIR--RMKFDDKNTLGGSSNNGT 431
           D D   ++++ KN+     N LEQ  +RF  TG ++DDI    ++ +D + L GS+ + T
Sbjct: 183 DTDAMDIDFEDKNVISG-NNKLEQNSSRFHPTGNDEDDISNTNVEEEDGSLLDGSNKDDT 241

Query: 432 -------FIQIYDTSLINVN 444
                  FI+I    L N+N
Sbjct: 242 IELTQERFIKIRKEMLENIN 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,748,030
Number of extensions: 2935021
Number of successful extensions: 8868
Number of sequences better than 10.0: 57
Number of HSP's gapped: 9078
Number of HSP's successfully gapped: 57
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)