Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E02760singletonON35835819320.0
NDAI0F00630singletonON11332967991e-96
NDAI0G04090singletonON14302968033e-96
CAGL0G07183g2singletonON15042627973e-95
NCAS0H03510singletonON12203167773e-93
TDEL0C06480singletonON13743315664e-64
Kpol_1031.4singletonON10633195627e-64
Kpol_1048.75singletonON12332555602e-63
YIL080WsingletonOFF15742405576e-63
Kwal_56.22673singletonOFF4782405232e-61
Ecym_5175singletonON14102535312e-59
NDAI0C01570singletonON12472555267e-59
NDAI0C03530singletonON12632555267e-59
NDAI0K00353singletonON12492555232e-58
TPHA0A04250singletonON7762155129e-58
Kpol_222.2singletonON7502304916e-55
KAFR0F01500singletonON7952284751e-52
NCAS0A05290singletonON9261394612e-50
Kwal_23.5250singletonON9021694261e-45
Kwal_26.8300singletonON9021694261e-45
KNAG0A06930singletonON3051704013e-45
TBLA0B06850singletonON4301673812e-41
AGL178WsingletonON6462533711e-38
TBLA0E02540singletonON3842333032e-30
KNAG0E03490singletonON836973014e-29
TBLA0F00655singletonON3482042758e-27
NDAI0I02500singletonON3861192602e-24
TBLA0D01485singletonON3981342567e-24
TBLA0H00730singletonON2851212305e-21
Kpol_1031.7singletonON16652712164e-18
Kpol_64.1singletonON4571852064e-17
Kpol_298.3singletonON16671842084e-17
Kpol_1036.100singletonON8331842066e-17
Kpol_1035.3singletonON11302732032e-16
NCAS0G02340singletonON1951651895e-16
NDAI0H02640singletonON1951091842e-15
TBLA0A00515singletonON3091581874e-15
Kpol_544.3singletonON4131841879e-15
Skud_7.230singletonON174821719e-14
Skud_11.26singletonON193821721e-13
TBLA0A00210singletonON219971544e-11
NDAI0A04060singletonON12031781453e-09
NDAI0G04700singletonON12551781444e-09
NDAI0G03370singletonON8521781444e-09
TBLA0C06360singletonON212711351e-08
NCAS0A05300singletonON2391211314e-08
Kpol_250.3singletonON219100987e-04
Skud_5.220singletonOFF283146950.002
KNAG0A06940singletonON8625810.019
Kpol_541.1singletonON375100870.027
TBLA0B06845singletonON29561850.043
Skud_15.220singletonON14046740.39
NCAS0D01880singletonON6244680.68
Ecym_55755.75ON1497164712.7
NDAI0K003508.848ON50499678.0
YPR115W (RGC1)3.438ON108366678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02760
         (358 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02760 Chr5 (551729..552805) [1077 bp, 358 aa] {ON}              748   0.0  
NDAI0F00630 Chr6 complement(150952..154353) [3402 bp, 1133 aa] {...   312   1e-96
NDAI0G04090 Chr7 complement(976848..981140) [4293 bp, 1430 aa] {...   313   3e-96
CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [45...   311   3e-95
NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON}             303   3e-93
TDEL0C06480 Chr3 (1185928..1186584,1186586..1190053) [4125 bp, 1...   222   4e-64
Kpol_1031.4 s1031 (9817..13008) [3192 bp, 1063 aa] {ON} (9817..1...   221   7e-64
Kpol_1048.75 s1048 (214263..217964) [3702 bp, 1233 aa] {ON} (214...   220   2e-63
YIL080W Chr9 (205635..206484,206486..210357) [4722 bp, 1574 aa] ...   219   6e-63
Kwal_56.22673 s56 complement(230238..231674) [1437 bp, 478 aa] {...   206   2e-61
Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar ...   209   2e-59
NDAI0C01570 Chr3 (334303..338046) [3744 bp, 1247 aa] {ON}             207   7e-59
NDAI0C03530 Chr3 (806284..810075) [3792 bp, 1263 aa] {ON}             207   7e-59
NDAI0K00353 Chr11 complement(70340..74089) [3750 bp, 1249 aa] {ON}    206   2e-58
TPHA0A04250 Chr1 (959017..959517,959519..961348) [2331 bp, 776 a...   201   9e-58
Kpol_222.2 s222 complement(1263..2024,2028..2141,2145..2762,2766...   193   6e-55
KAFR0F01500 Chr6 (294389..296776) [2388 bp, 795 aa] {ON}              187   1e-52
NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa] ...   182   2e-50
Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa] ...   168   1e-45
Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W...   168   1e-45
KNAG0A06930 Chr1 (1080433..1081350) [918 bp, 305 aa] {ON}             159   3e-45
TBLA0B06850 Chr2 (1616713..1618005) [1293 bp, 430 aa] {ON}            151   2e-41
AGL178W Chr7 (363877..365817) [1941 bp, 646 aa] {ON} Non-synteni...   147   1e-38
TBLA0E02540 Chr5 complement(638997..640151) [1155 bp, 384 aa] {O...   121   2e-30
KNAG0E03490 Chr5 (696203..698713) [2511 bp, 836 aa] {ON}  probab...   120   4e-29
TBLA0F00655 Chr6 (167741..168787) [1047 bp, 348 aa] {ON}              110   8e-27
NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON}              104   2e-24
TBLA0D01485 Chr4 (367365..368561) [1197 bp, 398 aa] {ON}              103   7e-24
TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON}      93   5e-21
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....    88   4e-18
Kpol_64.1 s64 complement(1..1371) [1371 bp, 457 aa] {ON} complem...    84   4e-17
Kpol_298.3 s298 (6306..11309) [5004 bp, 1667 aa] {ON} (6306..113...    85   4e-17
Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 83...    84   6e-17
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    83   2e-16
NCAS0G02340 Chr7 complement(415413..416000) [588 bp, 195 aa] {ON}      77   5e-16
NDAI0H02640 Chr8 (652273..652860) [588 bp, 195 aa] {ON}                75   2e-15
TBLA0A00515 Chr1 (100350..101279) [930 bp, 309 aa] {ON}                77   4e-15
Kpol_544.3 s544 complement(5270..6511) [1242 bp, 413 aa] {ON} co...    77   9e-15
Skud_7.230 Chr7 complement(405690..406214) [525 bp, 174 aa] {ON}...    70   9e-14
Skud_11.26 Chr11 (59574..60155) [582 bp, 193 aa] {ON}  (REPEAT)        71   1e-13
TBLA0A00210 Chr1 (31142..31801) [660 bp, 219 aa] {ON}                  64   4e-11
NDAI0A04060 Chr1 (914708..918319) [3612 bp, 1203 aa] {ON}              60   3e-09
NDAI0G04700 Chr7 complement(1121097..1124864) [3768 bp, 1255 aa]...    60   4e-09
NDAI0G03370 Chr7 complement(802196..804754) [2559 bp, 852 aa] {O...    60   4e-09
TBLA0C06360 Chr3 (1537418..1538056) [639 bp, 212 aa] {ON}              57   1e-08
NCAS0A05300 Chr1 complement(1050310..1051029) [720 bp, 239 aa] {...    55   4e-08
Kpol_250.3 s250 complement(6333..6992) [660 bp, 219 aa] {ON} com...    42   7e-04
Skud_5.220 Chr5 complement(348581..348730,348734..348841,348845....    41   0.002
KNAG0A06940 Chr1 (1081636..1081896) [261 bp, 86 aa] {ON}               36   0.019
Kpol_541.1 s541 (1906..2055,2059..2121,3029..3775,3779..3943) [1...    38   0.027
TBLA0B06845 Chr2 (1615825..1616712) [888 bp, 295 aa] {ON}              37   0.043
Skud_15.220 Chr15 (398128..398418,398422..398550) [420 bp, 140 a...    33   0.39 
NCAS0D01880 Chr4 complement(347496..347684) [189 bp, 62 aa] {ON}       31   0.68 
Ecym_5575 Chr5 complement(1179335..1183828) [4494 bp, 1497 aa] {...    32   2.7  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...    30   8.0  
YPR115W Chr16 (754877..758128) [3252 bp, 1083 aa] {ON}  RGC1Plec...    30   8.6  

>KNAG0E02760 Chr5 (551729..552805) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/358 (100%), Positives = 358/358 (100%)

Query: 1   MEQYLTDREAQLSLAMSWLKEAVSNIKNQVVASPSFNGPSNNAMTIIPPDKEVVSISIGT 60
           MEQYLTDREAQLSLAMSWLKEAVSNIKNQVVASPSFNGPSNNAMTIIPPDKEVVSISIGT
Sbjct: 1   MEQYLTDREAQLSLAMSWLKEAVSNIKNQVVASPSFNGPSNNAMTIIPPDKEVVSISIGT 60

Query: 61  VKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRT 120
           VKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRT
Sbjct: 61  VKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRT 120

Query: 121 TYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLF 180
           TYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLF
Sbjct: 121 TYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLF 180

Query: 181 VKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKD 240
           VKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKD
Sbjct: 181 VKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKD 240

Query: 241 QDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPS 300
           QDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPS
Sbjct: 241 QDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPS 300

Query: 301 KEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAITS 358
           KEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAITS
Sbjct: 301 KEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAITS 358

>NDAI0F00630 Chr6 complement(150952..154353) [3402 bp, 1133 aa] {ON}
           
          Length = 1133

 Score =  312 bits (799), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 208/296 (70%), Gaps = 8/296 (2%)

Query: 61  VKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRT 120
           V  + +R++  N++ E  ++ V  +T++S        TE    I  ++ +++   +P   
Sbjct: 127 VPWRTIRNDITNKNNEVTIY-VRISTSDSS-------TEPPSEITKEFGDILVEKIPAHD 178

Query: 121 TYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLF 180
            +T  I H I L  G +P   R YRM+ E+++ L  ++++L++D +  P+ SP+ APV++
Sbjct: 179 EHTKTIHHQITLKEGATPVFQRAYRMAEEERKALEDELKDLMKDNKTSPSDSPFAAPVIY 238

Query: 181 VKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKD 240
           VKKKDG+RRLCVDYR+LN  T+K+++P+PLID+LFDQL GA  FS LDL+SGYHQ+PI +
Sbjct: 239 VKKKDGSRRLCVDYRRLNEITVKAKYPIPLIDDLFDQLRGATIFSKLDLVSGYHQVPIAE 298

Query: 241 QDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPS 300
           +DR KTAF+T  GQ+ W VMPFGLT+AP+TFQ LMN VLRDY+ +F +VYLDDIL YS +
Sbjct: 299 EDRYKTAFITQRGQYQWNVMPFGLTNAPATFQRLMNHVLRDYIGEFCIVYLDDILNYSKT 358

Query: 301 KEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
            E+H +H+  +++ LRA HL AK+SKCSFF  Q+ FLGH+I+ TGIH D  K+  I
Sbjct: 359 NEEHIKHIRKIMEALRAHHLFAKKSKCSFFLHQVGFLGHVINATGIHSDPEKIECI 414

>NDAI0G04090 Chr7 complement(976848..981140) [4293 bp, 1430 aa] {ON}
           
          Length = 1430

 Score =  313 bits (803), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 206/296 (69%), Gaps = 9/296 (3%)

Query: 61  VKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRT 120
           V  + +R++  N++ E  L  + T+ +          TE    I  ++ +++   +P R 
Sbjct: 425 VPWRTIRNDITNKNNEVHLCWISTSDSS---------TEPPSEITKEFGDILVEKIPARD 475

Query: 121 TYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLF 180
            +T  I H I L  G +P   R YRM+ E+++ L  ++++L++D +I P+ SP+ APV++
Sbjct: 476 EHTKTIHHQITLKEGATPVFQRAYRMAEEERKALEDELKDLMKDNKISPSDSPFAAPVIY 535

Query: 181 VKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKD 240
           VKKKDG+RRLCVDYR+LN  T+K+R+P+PLID+LFDQL GA  FS LDL+SGYHQ+PI +
Sbjct: 536 VKKKDGSRRLCVDYRRLNEITVKARYPIPLIDDLFDQLRGATIFSKLDLVSGYHQVPIAE 595

Query: 241 QDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPS 300
            DR KTAF+T  GQ+ W VMPFGLT+AP+TFQ LMN +LR+Y+ KF +VYLDDIL+YS +
Sbjct: 596 GDRYKTAFITQRGQYQWNVMPFGLTNAPATFQRLMNHILREYIGKFCIVYLDDILIYSKT 655

Query: 301 KEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           +E+H +H++ ++  LR  HL AK SKCSFF  Q+ FLGH+I+ TGIH D  K+  I
Sbjct: 656 EEEHIKHITNIMQALREHHLFAKRSKCSFFLHQVGFLGHVINSTGIHSDPEKIVCI 711

>CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [4515
           bp, 1504 aa] {ON} encodes gag, pol, protease, reverse
           transcriptase,RNaseH and integrase of gb|AY673967
           Candida glabrata Tcg3 LTR retrotransposon (Ty3/gypsy
           superfamily)
          Length = 1504

 Score =  311 bits (797), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 193/262 (73%), Gaps = 1/262 (0%)

Query: 95  VTDTESVQTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQEL 154
           V+ TE  + ++ +Y ++I   LP  +T T  ++H I+L+PGT+P   R YR+S  K+ EL
Sbjct: 475 VSTTELPKELQDRYADLIVDDLPPTST-TTTVKHEIELVPGTAPIAKRAYRLSPVKRAEL 533

Query: 155 SKQIRELIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNL 214
            +QI+ELI   RI P+ SP+ APVLFVKKKDG+ RLCVDYR LN+ T+KS+FPLPLI+++
Sbjct: 534 EQQIKELISSGRISPSDSPFAAPVLFVKKKDGSSRLCVDYRGLNNATVKSKFPLPLIEDV 593

Query: 215 FDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQML 274
            D L GAK FS LDLISGYHQ+ + + DR KT+F+THEGQ+ W VMPFGLT+AP+TFQ L
Sbjct: 594 LDSLHGAKIFSKLDLISGYHQVSVNEPDRYKTSFITHEGQYQWNVMPFGLTNAPATFQRL 653

Query: 275 MNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQI 334
           MN VLR Y++KF VVYLDDIL+YS ++E+H  H+S VLD LR   L  K+SKC F   Q+
Sbjct: 654 MNAVLRPYISKFCVVYLDDILIYSKTREEHLHHISQVLDKLRKHSLYPKKSKCHFMLTQV 713

Query: 335 HFLGHMIDGTGIHMDNTKLTAI 356
            FLGH+I+  GI  D  K+ AI
Sbjct: 714 QFLGHVINANGISTDPEKINAI 735

>NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON} 
          Length = 1220

 Score =  303 bits (777), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 212/316 (67%), Gaps = 6/316 (1%)

Query: 43  AMTIIPPDKEVVSIS--IGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTES 100
           AM II    ++V+I   I  +   + R     ++TE  LF V    T  ++      +E 
Sbjct: 123 AMPIINRKVKLVTIDDQIKMISALKARRLLTKKTTEAHLFWVSAGGTIRKDV----SSEL 178

Query: 101 VQTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRE 160
            Q +  ++  VI   LP   T    I+H I+L+PG+SP   R YRMS  +++EL +Q++E
Sbjct: 179 TQQLLKKFGKVIVDELPNLPTPNRIIKHHIELLPGSSPVARRAYRMSFSERKELERQLQE 238

Query: 161 LIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAG 220
           L+   RI    SP+ APVLFV KKDG++RLC D+R LN  T+KS+FPLP ID+LFD L+G
Sbjct: 239 LLAAGRIEVGNSPFAAPVLFVIKKDGSKRLCCDFRGLNEVTVKSKFPLPRIDDLFDMLSG 298

Query: 221 AKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLR 280
           A  FS LDL+SGYHQ+ ++ +D+ KTAF+THEGQ+ W+VMPFGLT+APSTFQ LMN  L+
Sbjct: 299 ASVFSQLDLVSGYHQVEVEPKDQYKTAFVTHEGQYIWKVMPFGLTNAPSTFQRLMNETLK 358

Query: 281 DYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHM 340
            Y+ KFV+VYLDDIL++S  +++H  HL LVL+ L+   L AK+SKC F+  ++HFLGH 
Sbjct: 359 GYIGKFVIVYLDDILIFSKDQKEHTMHLGLVLNRLQKAQLYAKKSKCHFYLDKVHFLGHT 418

Query: 341 IDGTGIHMDNTKLTAI 356
           ID  GIH+D+ K+ A+
Sbjct: 419 IDKDGIHVDDKKVKAM 434

>TDEL0C06480 Chr3 (1185928..1186584,1186586..1190053) [4125 bp, 1374
           aa] {ON} 
          Length = 1374

 Score =  222 bits (566), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/331 (38%), Positives = 187/331 (56%), Gaps = 9/331 (2%)

Query: 27  KNQVVASPSFNGPSNNAMTIIPPDKEVVSISIGTVKTKELRDNRDNQSTECCLFLVHTAT 86
           K+Q +  P    P  N  + +P D          +KT++    +D++S    +  V    
Sbjct: 396 KSQKLGQPKL--PQLNHESSLPIDLIYTEDDRQVLKTRK----KDHRSLNGYIIRVEAID 449

Query: 87  TESENAHTVTDTESVQ-TIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYR 145
            ++ N H  +    +  +++A+Y++ + + LP       ++ H IDL          PYR
Sbjct: 450 AQTPNHHDASSFHRLPPSLQAKYRHTVRNDLPRTALEMKEVSHEIDLKADARIPCIPPYR 509

Query: 146 MSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSR 205
            + +++ ++   + +L+    I P+ SPY +PV+ VKKKDG+ RLCVDYR LN  TIK  
Sbjct: 510 RTPKEEDQIVTIVNDLLEKGFIEPSKSPYSSPVVLVKKKDGSFRLCVDYRVLNEATIKDP 569

Query: 206 FPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLT 265
           FPLP I+ L  ++  A  FS+LDL SGYHQIP+K +D  KTAF TH G++ +RVMPFGL 
Sbjct: 570 FPLPRIEVLLAKIGKASIFSTLDLHSGYHQIPVKPEDVPKTAFTTHNGKYQYRVMPFGLV 629

Query: 266 SAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKES 325
           +APSTF   M  + RD    FV+VYLDDILV S S++QH EHL+ VL  L+   L AKE 
Sbjct: 630 NAPSTFSRYMADIFRDL--PFVLVYLDDILVISTSEKQHIEHLNTVLGRLQEHQLIAKEK 687

Query: 326 KCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           KC F + ++ FLG+ I    I     K  AI
Sbjct: 688 KCQFLQTEVEFLGYHISEHCIRPIKGKCDAI 718

>Kpol_1031.4 s1031 (9817..13008) [3192 bp, 1063 aa] {ON}
           (9817..13008) [3192 nt, 1064 aa]
          Length = 1063

 Score =  221 bits (562), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 39  PSNNAMTIIPPDKEVVSISIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDT 98
           P    +TI  P K + +I       +++ D  + Q  +  +F+++T  ++  ++      
Sbjct: 22  PELMELTIKSPTKTIYNI------VRDIHDELEEQHDQ--IFVIYTIGSQENHSFE---- 69

Query: 99  ESVQTIKAQYKNVIASSLPLRTTYTG-KIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQ 157
           +  + ++++YK+ + + LP R       I H I+L  G     S+PYR++ + + E+   
Sbjct: 70  QIPEWLQSKYKDTVRNDLPPRELQGDTNIFHDIELKEGAQIPRSQPYRLTPKLQTEVDTI 129

Query: 158 IRELIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQ 217
           I++LI  + + P+ SP+ +P++ VKKKDG+ RLCVDYRKLN  T+K  FPLPLID+   +
Sbjct: 130 IKDLIDKKFVVPSKSPFSSPIVMVKKKDGSYRLCVDYRKLNKATVKDPFPLPLIDHALAK 189

Query: 218 LAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNG 277
           +  A  F++LDL SGYHQI +K+QDR KTAF+T  G++ + VMPFGL +APSTF   M  
Sbjct: 190 IGSATIFTTLDLHSGYHQISMKEQDRYKTAFVTPNGKYEYTVMPFGLVNAPSTFSRYMAD 249

Query: 278 VLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFL 337
           + RD   KFV VYLDDIL++S +   H  HL +V + L+ V L  K+ KC+F   ++ +L
Sbjct: 250 LFRDL--KFVNVYLDDILIFSTTLNDHWNHLDIVFNRLKNVGLIVKKKKCTFAAEEVEYL 307

Query: 338 GHMIDGTGIHMDNTKLTAI 356
           G+ +   GI     K  A+
Sbjct: 308 GYNVGVRGILPIQNKCQAV 326

>Kpol_1048.75 s1048 (214263..217964) [3702 bp, 1233 aa] {ON}
           (214263..217964) [3702 nt, 1234 aa]
          Length = 1233

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 165/255 (64%), Gaps = 3/255 (1%)

Query: 104 IKAQYKNVIASSLPLRTTYTGKIQ-HVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELI 162
           +  +YK+ +   LP R   +  I  H I+LI G     S+PYR++ + ++E++K + +LI
Sbjct: 234 LAEKYKDTVRDDLPARDKNSNPIVFHEIELISGMKTPKSQPYRVTPKVEEEINKIVTDLI 293

Query: 163 RDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAK 222
             + I  + SP+ +P++ VKKKDGT RLCVDYR LN  T+K  FPLP  ++   ++  A 
Sbjct: 294 DKQFIISSKSPFSSPIVMVKKKDGTYRLCVDYRTLNKATVKDPFPLPRTESALAKIGAAS 353

Query: 223 FFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDY 282
            F++LDL SGYHQIP+K +DR KTAF+T  G++ + VMPFGL +APSTF   M  + R+ 
Sbjct: 354 IFTTLDLHSGYHQIPMKREDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFSRYMADLFREM 413

Query: 283 LNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMID 342
             KFV VYLDDIL++S S+ +H +H+ LVL  L+   L  K+ KCSF ++++ +LG++I 
Sbjct: 414 --KFVNVYLDDILIFSSSETEHWKHIDLVLQKLKNEQLIVKKPKCSFAEKEVEYLGYIIS 471

Query: 343 GTGIHMDNTKLTAIT 357
              I    +K  AI+
Sbjct: 472 EHKIKPVQSKCEAIS 486

>YIL080W Chr9 (205635..206484,206486..210357) [4722 bp, 1574 aa]
           {OFF} TyB Gag-Pol protein; proteolytically processed to
           make the Gag, RT, PR, and IN proteins that are required
           for retrotransposition
          Length = 1574

 Score =  219 bits (557), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 157/240 (65%), Gaps = 4/240 (1%)

Query: 104 IKAQYKNVIASSLPLRTTYTGKI--QHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIREL 161
           ++ +Y+ +I + LP R      I  +H I++ PG      +PY ++ + +QE++K +++L
Sbjct: 586 LQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKL 645

Query: 162 IRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGA 221
           + ++ I P+ SP  +PV+ V KKDGT RLCVDYR LN  TI   FPLP IDNL  ++  A
Sbjct: 646 LDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNA 705

Query: 222 KFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRD 281
           + F++LDL SGYHQIP++ +DR KTAF+T  G++ + VMPFGL +APSTF   M    RD
Sbjct: 706 QIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRD 765

Query: 282 YLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
              +FV VYLDDIL++S S E+H +HL  VL+ L+  +L  K+ KC F   +  FLG+ I
Sbjct: 766 L--RFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSI 823

>Kwal_56.22673 s56 complement(230238..231674) [1437 bp, 478 aa]
           {OFF} YIL082W-A - Hypothetical ORF [contig 184] FULL
          Length = 478

 Score =  206 bits (523), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 156/240 (65%), Gaps = 2/240 (0%)

Query: 102 QTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIREL 161
           Q ++ +YK  + + L  +  +   I+H ID++P       +PYR++ +++Q     + EL
Sbjct: 218 QWLQTKYKGTVCNELKGKKEHKSSIEHTIDVLPEAILPRQQPYRLTPKQEQIAQSLVEEL 277

Query: 162 IRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGA 221
           +      P+ SP  +P++ VKKKDG+ R+CVDYRKLN  T+K  FPLP I+ L  ++  A
Sbjct: 278 LHKGFASPSKSPCSSPIVLVKKKDGSYRMCVDYRKLNKVTVKDPFPLPRIEVLLTKVGEA 337

Query: 222 KFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRD 281
           ++FS+LDL SGYHQIP++  DR KTAF+T  G++ +RVMPFGL +APSTF   M  + R 
Sbjct: 338 QWFSTLDLHSGYHQIPLRTTDRHKTAFVTPSGKYEYRVMPFGLVNAPSTFARYMADLFRA 397

Query: 282 YLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
               +V VYLDDIL++S S+ QH EHL  VL  L+  +L AK  KC F ++++ FLG++I
Sbjct: 398 L--PYVCVYLDDILIFSDSQNQHFEHLDEVLGRLKKENLIAKLKKCHFLQKRVEFLGYVI 455

>Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar to
           Saccharomyces cerevisiae YGR109W-B Retrotransposon TYA
           Gag and TYB Pol genes; transcribed/translated as one
           unit; polyprotein is processed to make a
           nucleocapsid-like protein (Gag), reverse transcriptase
           (RT), protease (PR), and integrase (IN); similar to
           retroviral genes [Saccharomyces cerevisiae S288c]
          Length = 1410

 Score =  209 bits (531), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 158/253 (62%), Gaps = 2/253 (0%)

Query: 104 IKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIR 163
           ++ +YK+ + + L         + H I+L+ GT     +PYR + ++K+   K + EL+ 
Sbjct: 606 LQEKYKDTVTNVLNSDNIVKRTVYHEIELVKGTRVPKLQPYRQTAKEKEITRKIVAELLE 665

Query: 164 DERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKF 223
              I P+ +P  +PV+ VKKKD + RLCVDYR+LN  T+   FPLP I+ +   +  AK 
Sbjct: 666 QGFIVPSKAPGSSPVVLVKKKDNSYRLCVDYRELNKITVSDPFPLPRIEEMLACIGDAKV 725

Query: 224 FSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYL 283
           FS+LDL SGYHQIP++ +DR KTAF+T EG++ + VMPFGL +APSTF   M+ + R   
Sbjct: 726 FSTLDLHSGYHQIPMRKEDRAKTAFVTSEGKYEYLVMPFGLMNAPSTFARYMSEIFRGL- 784

Query: 284 NKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDG 343
            +FV VYL D+LVYS ++++H  HL++VL  L+   L A++ KC F   ++ FLG+ +  
Sbjct: 785 -RFVAVYLGDLLVYSLNEQEHIYHLAVVLGKLKEHGLIAEKKKCRFHVNKVEFLGYEVSD 843

Query: 344 TGIHMDNTKLTAI 356
            GI   + K  AI
Sbjct: 844 KGIRPLSHKCEAI 856

>NDAI0C01570 Chr3 (334303..338046) [3744 bp, 1247 aa] {ON} 
          Length = 1247

 Score =  207 bits (526), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 156/255 (61%), Gaps = 2/255 (0%)

Query: 102 QTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIREL 161
           + ++ +Y+ ++ + LP R      + H I+L  G+      PYR++ +K++E+ + I++L
Sbjct: 264 EELQVKYRGIVRNDLPPRQRDHKHVSHSIELKEGSRLPRRSPYRLTPKKQKEVDEIIKDL 323

Query: 162 IRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGA 221
           +    I P+ S Y +P++ V K DG+ RLCVDYR+LN  T+K  FPLP +D L  ++  A
Sbjct: 324 LDKGFIVPSKSSYSSPIVLVTKHDGSYRLCVDYRELNKVTVKDPFPLPHVDELLGKVGSA 383

Query: 222 KFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRD 281
             F++LDL SGYHQIP+   D  KTAF+T  G++ + VMPFGL +APSTF   M  + RD
Sbjct: 384 SVFTTLDLHSGYHQIPMNPTDMDKTAFVTPTGKYEYTVMPFGLVNAPSTFARYMADLFRD 443

Query: 282 YLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
              +FV VYLDDIL++S   E H +H+ +VL  L    L AK+ KC F + ++ FLG++I
Sbjct: 444 L--EFVNVYLDDILIFSNDLESHWKHIDVVLSRLDQEKLIAKKKKCHFAQSEVQFLGYII 501

Query: 342 DGTGIHMDNTKLTAI 356
               I     K  AI
Sbjct: 502 GRNKIKPVQEKCEAI 516

>NDAI0C03530 Chr3 (806284..810075) [3792 bp, 1263 aa] {ON} 
          Length = 1263

 Score =  207 bits (526), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 156/255 (61%), Gaps = 2/255 (0%)

Query: 102 QTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIREL 161
           + ++ +Y+ ++ + LP R      + H I+L  G+      PYR++ +K++E+ + I++L
Sbjct: 264 EELQVKYRGIVRNDLPPRQRDHKHVSHSIELKEGSRLPRRSPYRLTPKKQKEVDEIIKDL 323

Query: 162 IRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGA 221
           +    I P+ S Y +P++ V K DG+ RLCVDYR+LN  T+K  FPLP +D L  ++  A
Sbjct: 324 LDKGFIVPSKSSYSSPIVLVTKHDGSYRLCVDYRELNKVTVKDPFPLPHVDELLGKVGSA 383

Query: 222 KFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRD 281
             F++LDL SGYHQIP+   D  KTAF+T  G++ + VMPFGL +APSTF   M  + RD
Sbjct: 384 SVFTTLDLHSGYHQIPMNPTDMDKTAFVTPTGKYEYTVMPFGLVNAPSTFARYMADLFRD 443

Query: 282 YLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
              +FV VYLDDIL++S   E H +H+ +VL  L    L AK+ KC F + ++ FLG++I
Sbjct: 444 L--EFVNVYLDDILIFSNDLESHWKHIDVVLSRLDQEKLIAKKKKCHFAQSEVQFLGYII 501

Query: 342 DGTGIHMDNTKLTAI 356
               I     K  AI
Sbjct: 502 GRNKIKPVQEKCEAI 516

>NDAI0K00353 Chr11 complement(70340..74089) [3750 bp, 1249 aa] {ON}
          Length = 1249

 Score =  206 bits (523), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/255 (40%), Positives = 156/255 (61%), Gaps = 2/255 (0%)

Query: 102 QTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIREL 161
           + ++ +Y+ ++ + LP R      + H I+L  G+      PYR++ +K++++ + I++L
Sbjct: 264 EELQVKYRGIVRNDLPPRQRDHKHVSHSIELKEGSRLPRRSPYRLTPKKQKDVDEIIKDL 323

Query: 162 IRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGA 221
           +    I P+ S Y +P++ V K DG+ RLCVDYR+LN  T+K  FPLP +D L  ++  A
Sbjct: 324 LDKGFIVPSKSSYSSPIVLVTKHDGSYRLCVDYRELNKVTVKDPFPLPHVDELLGKVGSA 383

Query: 222 KFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRD 281
             F++LDL SGYHQIP+   D  KTAF+T  G++ + VMPFGL +APSTF   M  + RD
Sbjct: 384 SVFTTLDLHSGYHQIPMNPTDMDKTAFVTPTGKYEYTVMPFGLVNAPSTFARYMADLFRD 443

Query: 282 YLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
              +FV VYLDDIL++S   E H +H+ +VL  L    L AK+ KC F + ++ FLG++I
Sbjct: 444 L--EFVNVYLDDILIFSNDLESHWKHIDVVLSRLDQEKLIAKKKKCHFAQSEVQFLGYII 501

Query: 342 DGTGIHMDNTKLTAI 356
               I     K  AI
Sbjct: 502 GRNKIKPVQEKCEAI 516

>TPHA0A04250 Chr1 (959017..959517,959519..961348) [2331 bp, 776 aa]
           {ON} 
          Length = 776

 Score =  201 bits (512), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 2/215 (0%)

Query: 142 RPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHT 201
           +PYR++   + EL+  I +L+  + I P+ SP  +P++ +KKKD T RLCVDYR LN  T
Sbjct: 471 QPYRLTPRLQMELNTIIDDLLEKKFILPSKSPCSSPIVLLKKKDDTYRLCVDYRALNKAT 530

Query: 202 IKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMP 261
           I   FPLP ID+L  ++  A  FS+LDL SGYHQIP+   D+ KTAF+T  G++ + VMP
Sbjct: 531 IADPFPLPRIDDLLSRIGDASVFSTLDLHSGYHQIPMNKDDQYKTAFVTPSGKYEYTVMP 590

Query: 262 FGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLT 321
           FGL +APSTF   M+ + R     FV VYLDDIL++S SKE H EHL  VL  L   +L 
Sbjct: 591 FGLVNAPSTFARHMSDLFRGL--TFVCVYLDDILIFSDSKETHWEHLDTVLGRLLKENLI 648

Query: 322 AKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
            K+ KC+F   ++ FLG+ I    I    TK  AI
Sbjct: 649 VKKKKCTFTSAEVEFLGYQIGANKITPIVTKCQAI 683

>Kpol_222.2 s222
           complement(1263..2024,2028..2141,2145..2762,2766..3524)
           [2253 bp, 750 aa] {ON}
           complement(1263..2024,2028..2141,2145..2762,2766..3524)
           [2253 nt, 751 aa]
          Length = 750

 Score =  193 bits (491), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 98/230 (42%), Positives = 144/230 (62%), Gaps = 2/230 (0%)

Query: 127 QHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKKDG 186
           +H I++IPG     +     +  +  + S+ I +LI+ E +  +  P+ +P++ VKKKDG
Sbjct: 3   EHEIEVIPGQRENATLTTGQTNSENGKRSRIIDDLIQKEFVELSKYPFSSPIVMVKKKDG 62

Query: 187 TRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKT 246
           T RLCVDYRKLN  T+K  FPLP I+    ++  +K F++LDL SGYHQIP+K +D+ KT
Sbjct: 63  TYRLCVDYRKLNKVTVKDPFPLPRIEQSLAKIGNSKVFTTLDLHSGYHQIPMKQKDQYKT 122

Query: 247 AFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAE 306
           AF+T  G++ ++VMPFGL +APSTF   M  + RD    F  VYLDDIL++S + E+H E
Sbjct: 123 AFVTPSGKYEYKVMPFGLVNAPSTFSRYMADLFRDM--SFANVYLDDILIHSATLEEHWE 180

Query: 307 HLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           H+  VL  L+   L AK+ KC F  +++ +LG+ I    I     K  +I
Sbjct: 181 HVDKVLKRLKEEGLIAKKKKCHFAAKEVEYLGYYISENQIRPLQGKCESI 230

>KAFR0F01500 Chr6 (294389..296776) [2388 bp, 795 aa] {ON} 
          Length = 795

 Score =  187 bits (475), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/228 (44%), Positives = 142/228 (62%), Gaps = 3/228 (1%)

Query: 115 SLPLRTTYTGKI-QHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSP 173
           + P RT+    I  H I++ P T     +PYR+  + ++EL+  I +L+    I  + S 
Sbjct: 8   ACPPRTSNHSNIPTHSIEIKPDTRLPQLQPYRVIPKMERELNDIIDDLLEKGFISLSRSS 67

Query: 174 YGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGY 233
             +PV+ V+KKDGT RLCVDYR LN  TI   FPLP ID+   ++  AK F++L+L S Y
Sbjct: 68  CSSPVVMVEKKDGTYRLCVDYRALNKATISDPFPLPRIDSPLSRVGNAKIFTTLELHSCY 127

Query: 234 HQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDD 293
           HQIP+ + D+ KTAF+T  G++ + VMPFGL +APSTF   M  + RD   KFV VYLDD
Sbjct: 128 HQIPMHEPDKFKTAFVTPNGKYEYNVMPFGLVNAPSTFARYMADLFRDL--KFVAVYLDD 185

Query: 294 ILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMI 341
           IL+ S + E+H +HL +VL  L    L AK+ KC F   ++ FLG+ I
Sbjct: 186 ILIISETAEEHWQHLDMVLGRLEQDGLIAKKKKCHFATTEVEFLGYNI 233

>NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa]
           {ON} 
          Length = 926

 Score =  182 bits (461), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 108/139 (77%)

Query: 218 LAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNG 277
           L+GA  FS LDL+SGYHQ+ ++ +D+ KTAF+THEGQ+ W+VMPFGLT+APSTFQ LMN 
Sbjct: 2   LSGASVFSQLDLVSGYHQVEVEPKDQYKTAFVTHEGQYIWKVMPFGLTNAPSTFQRLMNE 61

Query: 278 VLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFL 337
            L+ Y+ KFV+VYLDDIL++S  +++H  HL LVL+ L+   L AK+SKC F+  ++HFL
Sbjct: 62  TLKGYIGKFVIVYLDDILIFSKDQKEHTMHLGLVLNRLQKAQLYAKKSKCHFYLDKVHFL 121

Query: 338 GHMIDGTGIHMDNTKLTAI 356
           GH ID  GI +D+ K+ A+
Sbjct: 122 GHTIDKDGIRVDDKKVKAM 140

>Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa]
           {ON} YGR109W-B - TyB Gag-Pol protein [contig 8] FULL
          Length = 902

 Score =  168 bits (426), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 112/169 (66%), Gaps = 2/169 (1%)

Query: 190 LCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFL 249
           +CVDYRKLN  T+K  FPLP I+ L  ++  A++FS+LDL SGYHQIP++  DR KTAF+
Sbjct: 1   MCVDYRKLNKVTVKDPFPLPRIEVLLTKVGEAQWFSTLDLHSGYHQIPLRTTDRHKTAFV 60

Query: 250 THEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLS 309
           T  G++ +RVMPFGL +APSTF   M  + R     +V VYLDDIL++S S+ QH EHL 
Sbjct: 61  TPSGKYEYRVMPFGLVNAPSTFARYMADLFRAL--PYVCVYLDDILIFSDSQNQHFEHLD 118

Query: 310 LVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAITS 358
            VL  L+  +L AK  KC F ++++ FLG++I    I     K  AI S
Sbjct: 119 EVLGRLKKENLIAKLKKCHFLQKRVEFLGYVIGHNEIRPIQEKCQAIAS 167

>Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W-B
           - TyB Gag-Pol protein [contig 280] FULL
          Length = 902

 Score =  168 bits (426), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 112/169 (66%), Gaps = 2/169 (1%)

Query: 190 LCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFL 249
           +CVDYRKLN  T+K  FPLP I+ L  ++  A++FS+LDL SGYHQIP++  DR KTAF+
Sbjct: 1   MCVDYRKLNKVTVKDPFPLPRIEVLLTKVGEAQWFSTLDLHSGYHQIPLRTTDRHKTAFV 60

Query: 250 THEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLS 309
           T  G++ +RVMPFGL +APSTF   M  + R     +V VYLDDIL++S S+ QH EHL 
Sbjct: 61  TPSGKYEYRVMPFGLVNAPSTFARYMADLFRAL--PYVCVYLDDILIFSDSQNQHFEHLD 118

Query: 310 LVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAITS 358
            VL  L+  +L AK  KC F ++++ FLG++I    I     K  AI S
Sbjct: 119 EVLGRLKKENLIAKLKKCHFLQKRVEFLGYVIGHNEIRPIQEKCQAIAS 167

>KNAG0A06930 Chr1 (1080433..1081350) [918 bp, 305 aa] {ON} 
          Length = 305

 Score =  159 bits (401), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 108/170 (63%), Gaps = 4/170 (2%)

Query: 65  ELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRTTYTG 124
           E R +  N +TE  LF + +A  +      +      Q I  ++K V+  +LP + T   
Sbjct: 140 EARRDLQNPNTEVQLFWISSADPKGLPQSNI----ETQNILKEFKEVVVDTLPNKPTQQR 195

Query: 125 KIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKK 184
           + +H +DLIPG++P   RPYRM   +K+EL +Q+ +L+   R+  +TSP+ APVLFVKKK
Sbjct: 196 ETKHKVDLIPGSAPVARRPYRMGPAEKEELERQLHDLLEAGRVEESTSPFAAPVLFVKKK 255

Query: 185 DGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYH 234
           DGTRRLC ++R LN  TIKS+FP+P ID  FD L+ A  FS LDL+SGYH
Sbjct: 256 DGTRRLCCNFRGLNDITIKSKFPIPRIDECFDMLSDASVFSQLDLVSGYH 305

>TBLA0B06850 Chr2 (1616713..1618005) [1293 bp, 430 aa] {ON} 
          Length = 430

 Score =  151 bits (381), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 100/167 (59%), Gaps = 2/167 (1%)

Query: 190 LCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFL 249
           + VD R+LN  TIK  FP+P ID+LF ++     FS+LDL SGYHQIP+  +    T F 
Sbjct: 1   MVVDCRRLNKSTIKDPFPMPRIDDLFAKIGDCTIFSTLDLHSGYHQIPMNHKSEKLTGFT 60

Query: 250 THEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLS 309
           T  G + ++VMPFGL +AP+TF   M   L D  N  V VYLDD+L+ SPSKEQH   L 
Sbjct: 61  TPFGHYHYKVMPFGLCNAPATFSRYMQQSLGDIPN--VYVYLDDVLIASPSKEQHMNDLR 118

Query: 310 LVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           +VL  ++   L  K+ KC F +  + FLGH I   GI +   K  AI
Sbjct: 119 IVLQRIKDAKLVCKKKKCHFLQDTVEFLGHTISAKGISIIEEKTKAI 165

>AGL178W Chr7 (363877..365817) [1941 bp, 646 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR109W-B, YIL082W-A
           and YIL080W
          Length = 646

 Score =  147 bits (371), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 140/253 (55%), Gaps = 2/253 (0%)

Query: 104 IKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIR 163
           I+ +Y + +   LP        ++H I+    +    +R Y++    ++   + I++L+ 
Sbjct: 208 IQERYLDTVKDDLPAYEFNNCSVEHAIEFKEHSEEPRARAYKLKCRLEKVAVQLIQDLLD 267

Query: 164 DERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKF 223
              I P+ S   + +  VK+KD T  + +DYR++N+ T+K  FPLP +++L  ++  A  
Sbjct: 268 KGFIVPSKSTCTSQLTLVKEKDATYHIAIDYRRINNITVKDPFPLPTVESLLARVGTAGH 327

Query: 224 FSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYL 283
           F+ L+L +G  QIP++++DR KTAF+T  G F + VMP GL + P+TF   M  V+ D  
Sbjct: 328 FTILNLHNGQFQIPLREEDRYKTAFITTMGTFEFTVMPEGLLNGPNTFAKYMADVVGDL- 386

Query: 284 NKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDG 343
             FV VY+ DIL++S ++E+H  H+  VL  L    L ++ S   F + +  +LG++I  
Sbjct: 387 -PFVFVYMGDILIFSDTEEEHWTHIDAVLSRLSDRKLVSRRSDSHFNQEEFEYLGYVISR 445

Query: 344 TGIHMDNTKLTAI 356
             I     ++ +I
Sbjct: 446 NSIEPARDRIESI 458

>TBLA0E02540 Chr5 complement(638997..640151) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score =  121 bits (303), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 127/233 (54%), Gaps = 7/233 (3%)

Query: 52  EVVSISIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNV 111
           E +SI++  +    + D   ++  E  +F++   +T + ++ T+   +    I+  +   
Sbjct: 152 ESLSIAVDCLHEGTIPDYYGSELAE--VFVLTLDSTLASDSFTLFPAD----IRQDFATT 205

Query: 112 IASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTT 171
           +  +LP     T    H I L  G  P    PYR++ + ++E  + + +L++++ I  + 
Sbjct: 206 VTDTLPPNAG-TKSYSHEIILKEGGRPPRLAPYRLTPKLEKECRQIVEDLLKNQFISKSK 264

Query: 172 SPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLIS 231
           SP  +PVL VKKKDG+ R+ VD+R+LN  T+K  FPLP ID+L  +L     F++L L S
Sbjct: 265 SPCSSPVLLVKKKDGSFRMVVDFRELNKVTVKDPFPLPRIDDLLSKLGDCALFTTLYLHS 324

Query: 232 GYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLN 284
           GYHQIP+       T F T  G + ++VM FGL +AP+TF   M  +L +  N
Sbjct: 325 GYHQIPLDPDSEEMTGFTTPFGHYQYKVMKFGLCNAPATFSRYMQRLLGNIPN 377

>KNAG0E03490 Chr5 (696203..698713) [2511 bp, 836 aa] {ON}  probable
           pseudogene; Ty3-like gene with NNN added at twp places
           to avoid internal stop codons
          Length = 836

 Score =  120 bits (301), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 71/97 (73%)

Query: 260 MPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVH 319
           MPFGLT+AP+TFQ LMN VLRD+++KF V+YLDDIL+YS S E+H  HL  V D LR   
Sbjct: 1   MPFGLTNAPATFQRLMNHVLRDFIHKFCVLYLDDILIYSESIEEHEVHLRQVFDKLREHQ 60

Query: 320 LTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           L AK SKC  F ++I FLG++ID  GIH D  K++ I
Sbjct: 61  LHAKASKCQLFLKKIAFLGYVIDENGIHSDPEKVSCI 97

>TBLA0F00655 Chr6 (167741..168787) [1047 bp, 348 aa] {ON}
          Length = 348

 Score =  110 bits (275), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%), Gaps = 7/204 (3%)

Query: 52  EVVSISIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNV 111
           E +SI++  +    + D   ++  E  +F++   +T   ++ T+   +    I+  +   
Sbjct: 152 ESLSIAVDCLHEGTIPDYYGSELAE--VFVLTLDSTLVSDSFTLLPAD----IRQDFATT 205

Query: 112 IASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTT 171
           +  +LP     T    H I L  G  P    PYR++ + ++E  + + +L++++ I  + 
Sbjct: 206 VTDTLPPNAG-TKSYSHEIILKEGGRPPRLAPYRLTPKLEKECRQIVEDLLKNQFISESK 264

Query: 172 SPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLIS 231
           SPY +PVL VKKKDG+ R+ VD+R+LN  T+K  FPLP ID+L  +L     F++L L S
Sbjct: 265 SPYSSPVLLVKKKDGSFRMVVDFRELNKVTVKDPFPLPRIDDLLSKLGDCALFTTLYLHS 324

Query: 232 GYHQIPIKDQDRMKTAFLTHEGQF 255
           GYHQIP+       T F T  G +
Sbjct: 325 GYHQIPLDPDSEEMTGFTTPFGHY 348

>NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON} 
          Length = 386

 Score =  104 bits (260), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 77/119 (64%), Gaps = 2/119 (1%)

Query: 238 IKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVY 297
           ++++D+ KTAF+T +G++ + VMPFGL +APSTF   M+ + RD   K+V VYLDDIL++
Sbjct: 1   MREEDQFKTAFVTPDGKYEYTVMPFGLVNAPSTFARYMSDLFRDL--KYVCVYLDDILIF 58

Query: 298 SPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           S +KE+H +HL  VL  L+   L  K+ KC F    + FLG++I    I    TK  AI
Sbjct: 59  SRTKEEHWKHLDKVLYRLKKEELIVKKKKCLFAGDTVEFLGYIISPNKISPLVTKCQAI 117

>TBLA0D01485 Chr4 (367365..368561) [1197 bp, 398 aa] {ON}
          Length = 398

 Score =  103 bits (256), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 143 PYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTI 202
           PYR++    QE    + +L+    +  + SPY +PVL VKKK  T R+ VD+R+LN  T+
Sbjct: 264 PYRLTPLLTQECKSIVDDLLTKGILINSNSPYSSPVLLVKKKKDTYRMLVDFRQLNKRTV 323

Query: 203 KSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRV-MP 261
           +  F +P ID+LF ++     FS+LDL SGYHQIP   +      F T  G + ++V   
Sbjct: 324 EYPFTMPRIDDLFAKIGACIVFSTLDLRSGYHQIPTNPESERLIGFTTPCGHYHYKVPCL 383

Query: 262 FGLTSAPSTFQMLM 275
           FGL +AP+ F   M
Sbjct: 384 FGLCNAPAKFSRYM 397

>TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 93.2 bits (230), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 69/121 (57%), Gaps = 2/121 (1%)

Query: 238 IKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVY 297
           +K++D+ KTAF+T  G F ++VMPFGL +APSTF   M  + R   N  + VYLDD L++
Sbjct: 1   MKEEDQYKTAFVTPSGNFEYKVMPFGLVNAPSTFARYMADLFRGKPN--ICVYLDDNLIF 58

Query: 298 SPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAIT 357
           S S E+H +HL  VL  L   HL  K  K  F +  + FLG+ I    I     K  AI 
Sbjct: 59  SDSLEEHWKHLDDVLSILAKEHLFVKRKKFQFTQTPVEFLGYNISDNAIRPIQAKCQAIG 118

Query: 358 S 358
           S
Sbjct: 119 S 119

>Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON}
           (14919..19916) [4998 nt, 1666 aa]
          Length = 1665

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 123/271 (45%), Gaps = 16/271 (5%)

Query: 95  VTDTESVQTIKAQYKNVIASSLPLRTTYTGKIQH-VIDLIPGTSPTHSRP--YRMSGEKK 151
           +  TE  + ++ QY  V A +    T  T K +H  I  +   +  + +P  Y  +  ++
Sbjct: 698 IKQTEIKEQLRQQYPLVFAEA----TLNTKKTKHNYIAFVRLNNFPYHKPKAYFTNQLQR 753

Query: 152 QELSKQIRELIRDERIFPTTSP---YGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPL 208
           Q + + I + +    I P  +      +PV  +++     R+  D RK+N+H   +  P+
Sbjct: 754 QAIQQFITQSLESHMISPIATDELVALSPVFPIQQSKDKIRIITDLRKVNNHLQYTPRPI 813

Query: 209 PLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAP 268
           P I ++F  LA    FSSLD+   Y QIPIK     K   +T  G + +  +P+GL SAP
Sbjct: 814 PPIQHIFSNLANKTIFSSLDIRKAYQQIPIKGD---KLGLITEFGSYKFNRLPYGLASAP 870

Query: 269 STFQMLMNGVLRDY---LNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKES 325
             +   +  +L+      N  V  Y DD+++ S +   H   L  ++  L    L+    
Sbjct: 871 YWWGEFIQNLLKQLPTSKNTTVSYYYDDLVIASLTIADHYSTLQNIMRLLSDHGLSLSYE 930

Query: 326 KCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           K    + +IHFLG+ I    + +D  K   I
Sbjct: 931 KIHIAESKIHFLGYEISHNRLAIDKDKKNTI 961

>Kpol_64.1 s64 complement(1..1371) [1371 bp, 457 aa] {ON}
           complement(1..1371) [1371 nt, 457 aa]
          Length = 457

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 89/185 (48%), Gaps = 6/185 (3%)

Query: 176 APVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQ 235
           +PV  +++     R+  D RK+N+H + +  P+P I ++F  LA    FSSLD+   Y Q
Sbjct: 219 SPVFPIQQSKDKIRIITDLRKVNTHLLYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQ 278

Query: 236 IPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDY---LNKFVVVYLD 292
           IPI+     K   +T  G + +  +P+GL SAP  +   +  +L+      +  V  Y D
Sbjct: 279 IPIQGD---KLGLITELGSYKFNRLPYGLASAPYWWGEFIQNILKQLPQSKDTIVSYYYD 335

Query: 293 DILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTK 352
           D+++ S +  +H   L  ++  L    L+    K    + ++ FLG+ +    + +D  K
Sbjct: 336 DLIIASSTIAEHYTTLKHIMALLAENGLSLSYEKIHIAQPKVLFLGYEVSHNRLAIDKEK 395

Query: 353 LTAIT 357
              I 
Sbjct: 396 KNTIA 400

>Kpol_298.3 s298 (6306..11309) [5004 bp, 1667 aa] {ON} (6306..11309)
           [5004 nt, 1668 aa]
          Length = 1667

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 6/184 (3%)

Query: 176 APVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQ 235
           +PV  +++     R+  D RK+N+H + +  P+P I ++F  LA    FSSLD+   Y Q
Sbjct: 759 SPVFPIQQSKDKIRIITDLRKVNTHLLYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQ 818

Query: 236 IPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDY---LNKFVVVYLD 292
           IPI+     K   +T  G + +  +P+GL SAP  +   +  +L+      +  V  Y D
Sbjct: 819 IPIQGD---KLGLITELGSYKFNRLPYGLASAPYWWGEFIQNILKQLPQSKDTIVSYYYD 875

Query: 293 DILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTK 352
           D+++ S +  +H   L  ++  L    L+    K    + ++ FLG+ +    + +D  K
Sbjct: 876 DLIIASSTIAEHYTTLKHIMALLAENGLSLSYEKIHIAQPKVLFLGYEVSHNRLAIDKEK 935

Query: 353 LTAI 356
              I
Sbjct: 936 KNTI 939

>Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 833
           aa] {ON} (259603..261150,261154..262107) [2502 nt, 834
           aa]
          Length = 833

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 88/184 (47%), Gaps = 6/184 (3%)

Query: 176 APVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQ 235
           +PV  +++     R+  D RK+N H + +  P+P I ++F  LA    FSSLD+   Y Q
Sbjct: 286 SPVFPIQQTKDKIRVITDLRKVNKHLLYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQ 345

Query: 236 IPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLR---DYLNKFVVVYLD 292
           IPIK     K   +T  G + +  +P+GL S P  +   +  +L+      +  V  Y D
Sbjct: 346 IPIKGD---KLGLITELGSYKFNRLPYGLASGPYWWGEFIQNLLKLLPQSKDTTVAYYYD 402

Query: 293 DILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTK 352
           D+++ S + + H   L  ++  L    L+    K    + +I FLG+ I    + +D+ K
Sbjct: 403 DLIIASSTIDDHYSTLKHIMALLEQHGLSLSYEKIHVAESKILFLGYEISHNHLAIDSEK 462

Query: 353 LTAI 356
              I
Sbjct: 463 KATI 466

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 128/273 (46%), Gaps = 22/273 (8%)

Query: 95  VTDTESVQTIKAQYKNVIASSLPLRTTYTGKIQHVIDLI--PGTSPTHSRPYRMSGEKKQ 152
           ++ T  ++++K ++  V +S+  L   +   + HV +LI  P T+P   + Y  SG +++
Sbjct: 169 ISKTPFLKSLKTKFPTVFSSNFSL-DLHHDFLAHV-NLINFPYTTP---KAYFTSGLRRE 223

Query: 153 ELSKQIRELIRD---ERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLP 209
            + K + + + +   E + P      +PV  + +     R+  D RK+N     +  P+P
Sbjct: 224 AIKKYVNQSLENGLIEPLSPDELVAVSPVFALPQSSEKIRIITDLRKVNKCLQYTPRPIP 283

Query: 210 LIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPS 269
              ++  +L+    FS+ D+   Y Q+P+      K   +T  G + +  MP+GL SAP 
Sbjct: 284 TTQSILSELSHHTVFSAFDIRKAYQQLPLTGD---KLGIITEFGTYKFTRMPYGLASAPY 340

Query: 270 TFQMLMNGVLRDY---LNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVH---LTAK 323
            +   +  ++ D        +  Y DDILV S   + H EH  +VL    A+H   L+  
Sbjct: 341 WWGEFLQRIINDISIPTTTVIRYYYDDILVAS---QDHDEHYQVVLKLFEALHRHGLSIS 397

Query: 324 ESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           E K       + FLG+ I    + ++++K+  I
Sbjct: 398 EEKIQLASDTVIFLGYEISQNRVSLESSKIETI 430

>NCAS0G02340 Chr7 complement(415413..416000) [588 bp, 195 aa] {ON}
          Length = 195

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 6/165 (3%)

Query: 195 RKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQIPIKDQDRMKTAFLTHEGQ 254
           RK+N H I +  P+P   ++  +L+    FS++D+   Y Q+P+K     K   +T  G 
Sbjct: 14  RKVNKHLIYTPRPIPPTQSILSELSKKSLFSAIDISKAYQQLPLKGD---KIGIITEFGV 70

Query: 255 FAWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVV---YLDDILVYSPSKEQHAEHLSLV 311
           F +  +P+GL SAP  +   +  ++     K   V   Y DDI++ S    +H   +  +
Sbjct: 71  FRFTRLPYGLASAPYWWGEFIQTIINKVNVKSTSVIRYYYDDIVIASNDATEHFAVIHSL 130

Query: 312 LDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
            + L    LT  ESK    +  IHFLG+ I    + +D+ K+  I
Sbjct: 131 FEQLDLHGLTVSESKLQLSQTTIHFLGYNISKDRLAIDDEKIKTI 175

>NDAI0H02640 Chr8 (652273..652860) [588 bp, 195 aa] {ON} 
          Length = 195

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 102 QTIKAQYKNVIASSL-PLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRE 160
           + ++ ++K+ + + L  L T     +++ I +  G  P   + YR+S +  +  S  I E
Sbjct: 78  RKLQEKFKDTVKNDLGKLDTDREAIVEYEIYIKDGKRPPRQQAYRLSPKLGKVTSNLINE 137

Query: 161 LIRDERIFPTTSPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLP 209
           L+ +  I P+ SPY +P++ VKKKD + RLCVDYR LN  T+K  FPLP
Sbjct: 138 LLDNTFITPSKSPYSSPIVLVKKKDASYRLCVDYRALNKVTLKDPFPLP 186

>TBLA0A00515 Chr1 (100350..101279) [930 bp, 309 aa] {ON}
          Length = 309

 Score = 76.6 bits (187), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 86/158 (54%), Gaps = 7/158 (4%)

Query: 52  EVVSISIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNV 111
           E +SI++  +    + D   ++  E  +F++   +T + ++ T+   +    I+  +   
Sbjct: 152 ESLSIAVDCLHEGTIPDYYGSELAE--VFVLTLDSTLASDSFTLMPVD----IRQDFATT 205

Query: 112 IASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTT 171
           +  +LP     T    H I L  G  P    PYR++ + ++E  + + +L++++ I  + 
Sbjct: 206 VTDTLPPNAG-TKSYSHEIILKEGGRPPRLAPYRLTQKLEKECRQIVEDLLKNQFISESK 264

Query: 172 SPYGAPVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLP 209
           SPY +PVL VKKKDG+ R+ VD+R+LN  T+K  FPLP
Sbjct: 265 SPYSSPVLLVKKKDGSFRMVVDFRELNKVTVKDPFPLP 302

>Kpol_544.3 s544 complement(5270..6511) [1242 bp, 413 aa] {ON}
           complement(5270..6511) [1242 nt, 414 aa]
          Length = 413

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 6/184 (3%)

Query: 176 APVLFVKKKDGTRRLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISGYHQ 235
           +PV  +++     R+  D RK+N+H + +   +P I ++F  LA    FSSLD+   Y Q
Sbjct: 176 SPVFPIQQSKDKIRIITDLRKVNTHLLYTPRSIPPIQHIFGNLANKTIFSSLDIRKAYQQ 235

Query: 236 IPIKDQDRMKTAFLTHEGQFAWRVMPFGLTSAPSTFQMLMNGVLRDY---LNKFVVVYLD 292
           I IK     K   +T    + +  +P+GL SAP  +   +  +++      N  V  Y D
Sbjct: 236 ILIKGD---KLGLITELCSYKFNRLPYGLASAPYWWGEFIQNIIKKLPQSKNTTVSYYYD 292

Query: 293 DILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTK 352
           D+++ S +  +H   L  ++  L    L+    K    + +I+FLG+ +    + +D  K
Sbjct: 293 DLIIASSTIAEHYTTLKHIMALLTKNGLSLSYGKIHIAEPKINFLGYELSHNRLAIDKEK 352

Query: 353 LTAI 356
            T I
Sbjct: 353 KTTI 356

>Skud_7.230 Chr7 complement(405690..406214) [525 bp, 174 aa] {ON}
           YNL329C (REPEAT)
          Length = 174

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 275 MNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQI 334
           M  + RD    F VVYLDDIL++S +KE+H + L  +L HL+ V L AK+  C   +  +
Sbjct: 1   MVDLFRDL--DFAVVYLDDILIFSSTKEEHWQQLDKILSHLKEVKLIAKKDNCKLGQESV 58

Query: 335 HFLGHMIDGTGIHMDNTKLTAI 356
           HFLGH +   GI     K  AI
Sbjct: 59  HFLGHQVSKHGIKPLQEKCEAI 80

>Skud_11.26 Chr11 (59574..60155) [582 bp, 193 aa] {ON}  (REPEAT)
          Length = 193

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 275 MNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQI 334
           M  + RD    F VVYLDDIL++S +KE+H + L  VL HL+   L AK  KC F +  +
Sbjct: 1   MTDLFRDL--DFAVVYLDDILIFSSTKEEHWQQLDKVLSHLKEAKLIAKVDKCKFGQESV 58

Query: 335 HFLGHMIDGTGIHMDNTKLTAI 356
           +FLGH +   GI     K  AI
Sbjct: 59  NFLGHQVSKHGIESLQEKCEAI 80

>TBLA0A00210 Chr1 (31142..31801) [660 bp, 219 aa] {ON} 
          Length = 219

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 260 MPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVH 319
           MPFGL +   TF   M  VL +  N  V VY DD+L+ S +K+Q      +VL  L+   
Sbjct: 1   MPFGLCNVLVTFSRYMQQVLGNLPN--VYVYPDDVLIASQNKKQQ-----VVLQKLKNTR 53

Query: 320 LTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           L  K+ KC F +  + FLGH I   GI + + K  AI
Sbjct: 54  LICKKKKCHFMQSSVEFLGHTISADGISVLHEKTKAI 90

>NDAI0A04060 Chr1 (914708..918319) [3612 bp, 1203 aa] {ON}
          Length = 1203

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 174 YGAPVLFVKKKDGTR-RLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISG 232
           Y +P  F++K+D    RL ++YR  N + I     LP I +    L  + F + LD+ S 
Sbjct: 286 YVSPGFFIRKRDTEELRLVINYRTANQYVIGMESQLPSIYDSIVTLPDSAF-TVLDITSA 344

Query: 233 YHQIPIKDQDRMKTAFLTHE-GQFAWRVM--PFGLTSAPSTFQMLMNGVLRDYLNKFVVV 289
           ++ + +   D++   FL  + G   +R +  P G  ++   F   +N +L   L   + +
Sbjct: 345 FYTVKL---DKLSQDFLCFKVGNQTYRPLRAPMGYKNSAQLFAAFINHILSSSLKPHLTI 401

Query: 290 YLDDILVYSPSKEQHAEHLSL-VLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGI 346
           Y+DD+L+    K      L+  V+ HL    +     K  F +R I +LG+ I   GI
Sbjct: 402 YVDDLLII--GKPNTIVSLTREVIQHLGGYGIRFSAKKIQFNQRSIEYLGYKIVPGGI 457

>NDAI0G04700 Chr7 complement(1121097..1124864) [3768 bp, 1255 aa]
           {ON} 
          Length = 1255

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 174 YGAPVLFVKKKDGTR-RLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISG 232
           Y +P  F++K+D    RL ++YR  N + I     LP I +    L  +  F+ LD+ S 
Sbjct: 286 YVSPGFFIRKRDTEELRLVINYRTANQYVIGMESQLPSIYDSIVTLPDS-VFTVLDITSA 344

Query: 233 YHQIPIKDQDRMKTAFLTHE-GQFAWRVM--PFGLTSAPSTFQMLMNGVLRDYLNKFVVV 289
           ++ + +   D++   FL  + G   +R +  P G  ++   F   +N +L   L   + +
Sbjct: 345 FYTVKL---DKLSQDFLCFKVGNQTYRPLRAPMGYKNSAQLFAAFINHILPSSLKPHLTI 401

Query: 290 YLDDILVYSPSKEQHAEHLSL-VLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGI 346
           Y+DD+L+    K      L+  V+ HL    +     K  F +R I +LG+ I   GI
Sbjct: 402 YVDDLLII--GKPNTIVSLTREVIQHLGGYGIRFSAKKIQFNQRSIEYLGYKIVPGGI 457

>NDAI0G03370 Chr7 complement(802196..804754) [2559 bp, 852 aa] {ON} 
          Length = 852

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 83/178 (46%), Gaps = 11/178 (6%)

Query: 174 YGAPVLFVKKKDGTR-RLCVDYRKLNSHTIKSRFPLPLIDNLFDQLAGAKFFSSLDLISG 232
           Y +P  F++K+D    RL ++YR  N + I     LP I +    L  +  F+ LD+ S 
Sbjct: 27  YVSPGFFIRKRDTEELRLVINYRTANQYVIGMESQLPSIYDSIVTLPDS-VFTVLDITSA 85

Query: 233 YHQIPIKDQDRMKTAFLTHE-GQFAWRVM--PFGLTSAPSTFQMLMNGVLRDYLNKFVVV 289
           ++ + +   D++   FL  + G   +R +  P G  ++   F   +N +L   L   + +
Sbjct: 86  FYTVKL---DKLSQDFLCFKVGNQTYRPLRAPMGYKNSAQLFAAFINHILPSSLKPHLTI 142

Query: 290 YLDDILVYSPSKEQHAEHLSL-VLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGI 346
           Y+DD+L+    K      L+  V+ HL    +     K  F +R I +LG+ I   GI
Sbjct: 143 YVDDLLII--GKPNTIVSLTREVIQHLGGYGIRFSAKKIQFNQRSIEYLGYKIVPGGI 198

>TBLA0C06360 Chr3 (1537418..1538056) [639 bp, 212 aa] {ON} 
          Length = 212

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 286 FVVVYLDDILVYSPSKEQHAEHLSLVLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTG 345
           F  VYLDDIL+ S  K+ H + +  VL  L+  +L  K+ KC F +  + FLG  +   G
Sbjct: 2   FCFVYLDDILISSKDKKSHLQDIRKVLQILKKENLVCKKKKCHFLQESVEFLGFRLGKNG 61

Query: 346 IHMDNTKLTAI 356
           I +   K+ A+
Sbjct: 62  IMVQQEKIRAV 72

>NCAS0A05300 Chr1 complement(1050310..1051029) [720 bp, 239 aa] {ON}
           
          Length = 239

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (4%)

Query: 43  AMTIIPPDKEVVSI--SIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHTVTDTES 100
           AM II    ++V+I   I  +   + R     ++TE  LF V    T  ++      +E 
Sbjct: 123 AMPIINRKVKLVTIDDQIKMISALKARRLLTKKTTEAHLFWVSAGGTIRKD----VSSEL 178

Query: 101 VQTIKAQYKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRE 160
            Q +  ++  VI   LP   T    I+H I+L+PG+SP   R YRMS  +++EL +Q++E
Sbjct: 179 TQQLLKKFGKVIVDELPNLPTPNRIIKHHIELLPGSSPVARRAYRMSFSERKELERQLQE 238

Query: 161 L 161
           L
Sbjct: 239 L 239

>Kpol_250.3 s250 complement(6333..6992) [660 bp, 219 aa] {ON}
           complement(6333..6992) [660 nt, 220 aa]
          Length = 219

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 260 MPFGLTSAPSTFQMLMNGVLRDY---LNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLR 316
           MP+GL SAP  +   +  ++ +     +  +  Y DDI++ S S   H + +  +   L+
Sbjct: 1   MPYGLASAPYWWGEFIQRIIDEISTSTSTVIRYYYDDIIIASKSVTDHHQIVLKLFQALK 60

Query: 317 AVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
              L+  E K      ++ FLG+ I    I ++ +K+ AI
Sbjct: 61  KNGLSISEEKLQLASDKVTFLGYEISADRIAIEPSKIEAI 100

>Skud_5.220 Chr5
           complement(348581..348730,348734..348841,348845..348850,
           348863..348868,348872..348877,348881..349060,
           349064..349108,349112..349192,349199..349411,
           349415..349468) [849 bp, 283 aa] {OFF} YER132C (PSEUDO)
          Length = 283

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 64/146 (43%), Gaps = 19/146 (13%)

Query: 197 LNSHTIKSRFPLPLIDNLFDQLAGAKF-FSSLDLISGYHQIPIKDQDRMKTAFLTHEGQF 255
           + +  IK   P+  ++ LF ++   K  F++ D  S +HQI +K     K  F     + 
Sbjct: 87  MKAGLIKESIPIAPLEILFAKICKEKIVFTNFD--SRHHQIQMK-----KFMFQLFGFKI 139

Query: 256 AWRVMPFGLTSAPSTFQMLMNGVLRDYLNKFVVVYLDDILVYSPSKEQHAEHLSLVLDHL 315
                P G  S P      +  + R  +  FVVVYLDDILV+S  KE   +++  V   +
Sbjct: 140 DIGCCPLG-RSKPLVCSFDIADLFR--VLGFVVVYLDDILVFSDMKEHWKQYVECVGKVV 196

Query: 316 RAVHLTAKESKCSFFKRQIHFLGHMI 341
                   ++KC F      FLG  I
Sbjct: 197 --------QTKCKFEHELEQFLGDQI 214

>KNAG0A06940 Chr1 (1081636..1081896) [261 bp, 86 aa] {ON} 
          Length = 86

 Score = 35.8 bits (81), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%)

Query: 334 IHFLGHMIDGTGIHMDNTKLTAITS 358
           + FLGH+ID  GIH+DN K+ A+ +
Sbjct: 4   VQFLGHVIDKDGIHVDNAKIDAMVN 28

>Kpol_541.1 s541 (1906..2055,2059..2121,3029..3775,3779..3943) [1125
           bp, 375 aa] {ON}
           (1906..2055,2059..2121,3029..3775,3779..3943) [1125 nt,
           375 aa]
          Length = 375

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 260 MPFGLTSAPSTFQMLMNGVLRDYL---NKFVVVYLDDILVYSPSKEQHAEHLSLVLDHLR 316
           +P+GL SAP  +   ++ ++       +  +  Y DDI++ S   E H   L+ +L  L 
Sbjct: 72  LPYGLASAPYLWGEFLHSLISQIPASNHTKIAYYYDDIIIASTDIEDHNPLLNQLLHILE 131

Query: 317 AVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
              L     K    + QI FLG+++    + +D  K T I
Sbjct: 132 DNGLRISYEKVQTAQPQIKFLGYILTHNRLSVDPEKKTTI 171

>TBLA0B06845 Chr2 (1615825..1616712) [888 bp, 295 aa] {ON}
          Length = 295

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 127 QHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERIFPTTSPYGAPVLFVKKKDG 186
            H I L  G S     PYR++    QE    + +L+    I  +  PY +PVL VKKK+G
Sbjct: 234 SHDIVLKKGESLPKFPPYRLTPLLTQECKHIVDDLLAKGFIVNSDKPYSSPVLLVKKKNG 293

Query: 187 T 187
           +
Sbjct: 294 S 294

>Skud_15.220 Chr15 (398128..398418,398422..398550) [420 bp, 140 aa]
           {ON} YFR013W (REPEAT)
          Length = 140

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 311 VLDHLRAVHLTAKESKCSFFKRQIHFLGHMIDGTGIHMDNTKLTAI 356
           VL  L+   L AK  KC+F +  +HFLG      GI     K  AI
Sbjct: 3   VLSRLKEKKLIAKIDKCNFDQESVHFLGQTGSKYGIKPLQEKCEAI 48

>NCAS0D01880 Chr4 complement(347496..347684) [189 bp, 62 aa] {ON} 
          Length = 62

 Score = 30.8 bits (68), Expect = 0.68,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 271 FQMLMNGVLRDYLNKF--VVVYLDDILVYSPSKEQHAEHLSLVL 312
           F + + G+  D    F  V VYLD+I+++S   E H +HL  V+
Sbjct: 2   FLVHLQGIWSDMFGDFDYVNVYLDEIMIFSADLEWHWKHLDGVV 45

>Ecym_5575 Chr5 complement(1179335..1183828) [4494 bp, 1497 aa] {ON}
           similar to Ashbya gossypii AEL218W
          Length = 1497

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 73/164 (44%), Gaps = 19/164 (11%)

Query: 35  SFNGPSNNAMTIIPPDKEVVSISIGTVKTKELRDNRDNQSTECCLFLVHTATTESENAHT 94
           S +GPS   + +  P KE VS  +G        D +   S      L+H  +++SE+  +
Sbjct: 126 SGDGPSEEVIWMFSPVKETVSKDVG--------DKQVPMSANGSPILIHEYSSDSEDDFS 177

Query: 95  VTDTESVQTIKAQYKNV-----IASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGE 149
           + +  S   +  ++K +     + S+  L    + K   +     G +PT   P+  S E
Sbjct: 178 IHNDSSTPMVPNKFKTLLTFPNVQSNDSLLPPNSLKRDSMRSATRGLTPT---PFSESKE 234

Query: 150 KKQELSKQIRELIRDERIFPT---TSPYGAPVLFVKKKDGTRRL 190
           K +++   I +++ D  + PT   +SP  + VL  K K+  R L
Sbjct: 235 KMRDIDDIINDIVGDFGLKPTQIPSSPIKSEVLTNKSKNKQRTL 278

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 64  KELRDNRDNQSTECCLFLVHTATTESENAHTVTDTESVQTIKAQYKNVIASSLPLRTTYT 123
           +EL+   D    E CLF+      +SE    +    ++  ++   K  I ++  L +T+ 
Sbjct: 137 RELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTL--VEKLDKLEIINANELISTFH 194

Query: 124 GKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELI 162
           GK+   + + PG+S  HS     +GEK + L+ +  E I
Sbjct: 195 GKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENI 233

>YPR115W Chr16 (754877..758128) [3252 bp, 1083 aa] {ON}
           RGC1Pleckstrin homology domain containing protein
           proposed to function as a glycerol channel activator;
           paralogous to Ask10p; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 1083

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%)

Query: 108 YKNVIASSLPLRTTYTGKIQHVIDLIPGTSPTHSRPYRMSGEKKQELSKQIRELIRDERI 167
           Y++   SS  L + Y+   Q+++D+IP +    + P   + +      K+ +++  DE I
Sbjct: 38  YRSFGGSSDELASMYSADSQYLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYI 97

Query: 168 FPTTSP 173
            P T P
Sbjct: 98  LPKTDP 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,508,334
Number of extensions: 1685684
Number of successful extensions: 5696
Number of sequences better than 10.0: 68
Number of HSP's gapped: 5827
Number of HSP's successfully gapped: 68
Length of query: 358
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 247
Effective length of database: 40,753,473
Effective search space: 10066107831
Effective search space used: 10066107831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)