Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E027506.13ON49849825750.0
NCAS0D026206.13ON49347120720.0
KAFR0B065206.13ON49549420340.0
SAKL0E00946g6.13ON49348019980.0
Smik_6.4706.13ON48849719970.0
CAGL0A01045g6.13ON48346019940.0
YPL262W (FUM1)6.13ON48849119870.0
TDEL0G045806.13ON48448419850.0
Ecym_30166.13ON48947219820.0
Skud_16.166.13ON48847619800.0
Suva_16.436.13ON48849119780.0
KLLA0D00902g6.13ON49249719750.0
KLTH0C11462g6.13ON49247319590.0
Kwal_56.223626.13ON49348219500.0
NDAI0I024706.13ON47546219290.0
ACR013C6.13ON48847319270.0
TPHA0J002706.13ON49646119180.0
Kpol_1032.46.13ON46746019100.0
Kpol_1045.766.13ON48548319000.0
ZYRO0C07964g6.13ON50546418950.0
TBLA0G010006.13ON46546118390.0
TBLA0A071306.13ON50048017920.0
AEL019W1.354ON4692151322e-07
Suva_15.2011.354ON4632841285e-07
Smik_8.831.354ON4632381251e-06
KLLA0A08404g1.354ON4612121241e-06
CAGL0I08987g1.354ON4612881223e-06
Skud_8.701.354ON4632841223e-06
Kpol_1018.1251.354ON4602891223e-06
NCAS0A090101.354ON4622861213e-06
NDAI0G059401.354ON4622391214e-06
ZYRO0G00748g1.354ON4622371205e-06
TDEL0D022201.354ON4652401196e-06
YHR018C (ARG4)1.354ON4632391197e-06
SAKL0D09746g1.354ON4642411189e-06
TPHA0A021901.354ON4632471161e-05
KAFR0A009501.354ON4642731161e-05
TBLA0F034801.354ON4662171152e-05
KNAG0I015601.354ON4622161133e-05
Ecym_27491.354ON4702391109e-05
KLTH0G19338g1.354ON4652561027e-04
Kwal_27.127821.354ON4652541019e-04
Ecym_24524.197ON482194990.002
Kpol_1042.164.197ON482187950.004
NCAS0J012004.197ON482187940.006
Kwal_47.180664.197ON482182940.007
NDAI0J019504.197ON482189940.007
TPHA0B010404.197ON482252940.007
KLLA0B13189g4.197ON482273930.008
SAKL0B04972g4.197ON482187930.010
KNAG0B058404.197ON482187930.010
CAGL0B02794g4.197ON482184900.023
Skud_12.4434.197ON482182880.033
Suva_10.4594.197ON482192870.042
ZYRO0B07964g4.197ON482184870.044
YLR359W (ADE13)4.197ON482192870.046
Smik_12.4464.197ON482192870.048
KLTH0A03344g4.197ON482187850.087
TDEL0E017604.197ON482187840.095
TBLA0A083204.197ON482184830.13
ZYRO0E09460g3.564ON100952820.23
KLLA0D15081g3.438ON101059800.34
KAFR0A062304.197ON482187780.58
Kpol_1039.422.267ON617206770.71
KAFR0K015903.438ON110357780.73
Kpol_359.123.438ON107553732.8
Skud_12.5084.296ON1933145714.3
KAFR0A054603.438ON75565688.8
TPHA0A011508.604ON818131689.0
ZYRO0C12606g3.438ON113063689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02750
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   996   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   802   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   788   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   774   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   773   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   772   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   769   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   769   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   768   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   767   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   766   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   765   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   759   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   755   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   747   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   746   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   743   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   740   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   736   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   734   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   712   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   694   0.0  
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    55   2e-07
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    54   5e-07
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    53   1e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    52   1e-06
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    52   3e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    52   3e-06
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    52   3e-06
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    51   3e-06
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    51   4e-06
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    51   5e-06
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    50   6e-06
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    50   7e-06
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    50   9e-06
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    49   1e-05
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    49   1e-05
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    49   2e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    48   3e-05
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    47   9e-05
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    44   7e-04
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    44   9e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    43   0.002
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    41   0.004
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    41   0.006
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    41   0.007
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    41   0.007
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    41   0.007
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    40   0.008
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    40   0.010
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    40   0.010
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    39   0.023
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    39   0.033
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    38   0.042
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    38   0.044
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    38   0.046
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    38   0.048
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    37   0.087
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    37   0.095
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    37   0.13 
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...    36   0.23 
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    35   0.34 
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    35   0.58 
Kpol_1039.42 s1039 (129479..131332) [1854 bp, 617 aa] {ON} (1294...    34   0.71 
KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON} Anc_3...    35   0.73 
Kpol_359.12 s359 complement(18165..21392) [3228 bp, 1075 aa] {ON...    33   2.8  
Skud_12.508 Chr12 (900873..906674) [5802 bp, 1933 aa] {ON} YLR42...    32   4.3  
KAFR0A05460 Chr1 complement(1086917..1089184) [2268 bp, 755 aa] ...    31   8.8  
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    31   9.0  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    31   9.1  

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/498 (97%), Positives = 485/498 (97%)

Query: 1   MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ 60
           MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ
Sbjct: 1   MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ 60

Query: 61  RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL 120
           RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL
Sbjct: 61  RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL 120

Query: 121 SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT 180
           SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT
Sbjct: 121 SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT 180

Query: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240
           VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ
Sbjct: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240

Query: 241 QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE 300
           QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE
Sbjct: 241 QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE 300

Query: 301 ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN 360
           ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN
Sbjct: 301 ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN 360

Query: 361 PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH 420
           PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH
Sbjct: 361 PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH 420

Query: 421 CLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLT 480
           CLNDLKANKDKIDENLNKSLMLVTALNPKIGYD             ITLKESALELGVLT
Sbjct: 421 CLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLT 480

Query: 481 EKEFDEWVIPENMISPKP 498
           EKEFDEWVIPENMISPKP
Sbjct: 481 EKEFDEWVIPENMISPKP 498

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/471 (80%), Positives = 418/471 (88%)

Query: 28  SASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILK 87
           + +A + Q++R+ETDSFGEI VPAD+YWGAQTQRSFQNFKIGG RE+IP+P++ AFGILK
Sbjct: 23  TTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILK 82

Query: 88  KSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISN 147
           KSAA VNE+LGTLD  +A  IK AADEV +GKL DHFPLVVFQTGSGTQ+NMN NEVISN
Sbjct: 83  KSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISN 142

Query: 148 RAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQH 207
           RAIEL+GG+LGSKQ+HPNNH NQSQSSNDTFP+VMHIAA  EI N LIPEL  LKDAL  
Sbjct: 143 RAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDV 202

Query: 208 KVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVG 267
           K +EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R++SSLYHL FLAQGGTAVG
Sbjct: 203 KAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVG 262

Query: 268 TGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQ 327
           TGLNTK+GFDKL+AEEVSKETG+ F+TAPNKFEALAAHDAIV ASGALNT+A SLFKIAQ
Sbjct: 263 TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQ 322

Query: 328 DIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQ 387
           DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN TI+ AGSQ
Sbjct: 323 DIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQ 382

Query: 388 GQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALN 447
           GQFELNVYKPLMI+NLL+SIRL+TDA KSFRIHC++DLKANKDKI+ENLNKSLMLVTALN
Sbjct: 383 GQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALN 442

Query: 448 PKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPKP 498
           PKIGYD             ITLKESALEL  LT +EFDEWV+PENMI PKP
Sbjct: 443 PKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/494 (77%), Positives = 426/494 (86%), Gaps = 2/494 (0%)

Query: 5   VFNSSGKAS-VKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSF 63
           + N S K S V +  L +   R  + S+I +  FR ETDSFGEINVP D+YWGAQTQRS 
Sbjct: 2   MINISSKGSIVHLVKLTSYTSRFYTMSSIKSS-FRAETDSFGEINVPNDKYWGAQTQRSL 60

Query: 64  QNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDH 123
           QNFKIGG+REKIP P++ AFGILKKSAA VNE LGTLD  +A  I +AADEV++GKL+DH
Sbjct: 61  QNFKIGGEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDH 120

Query: 124 FPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMH 183
           FPLVVFQTGSGTQSNMNANEVISNRAIEL+GG+LGSK VHPNNHVNQSQSSNDTFPTVMH
Sbjct: 121 FPLVVFQTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMH 180

Query: 184 IAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVE 243
           IAA  EI  KL+PEL +LK++L  K  EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ 
Sbjct: 181 IAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMT 240

Query: 244 NGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALA 303
           NGI+R++++LYHL FLAQGGTAVGTGLNTK GFDKL+AE++S+ETG++FETAPNKFEALA
Sbjct: 241 NGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALA 300

Query: 304 AHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQ 363
           AHDAIVE SGALNTLACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQ
Sbjct: 301 AHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 360

Query: 364 NEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLN 423
           NEAMTQVC+QVMGN+STITFAGSQGQFELNVYKPL+ISNLLSSIRLLTDAS SFR+HC++
Sbjct: 361 NEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCID 420

Query: 424 DLKANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKE 483
            LKAN++ I ENLNKSLMLVTALNP IGYD             ITLKESALELG+LTE++
Sbjct: 421 GLKANRENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQ 480

Query: 484 FDEWVIPENMISPK 497
           F EWVIPE MI PK
Sbjct: 481 FSEWVIPEKMIGPK 494

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/480 (76%), Positives = 418/480 (87%)

Query: 18  LLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPE 77
           L  +++R   ++S++  Q++R+ETD+FGEI VPAD+YWGAQTQRSF+NFKIGG RE++PE
Sbjct: 13  LPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPE 72

Query: 78  PVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQS 137
            VVRAFG+LKKSAA VNE+LGTLD  I+  I+ AADEV +GKL DHFPLVVFQTGSGTQS
Sbjct: 73  AVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQS 132

Query: 138 NMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPE 197
           NMNANEVISNRAIE++GGE GSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI + L+PE
Sbjct: 133 NMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPE 192

Query: 198 LQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLH 257
           L  L+D+ Q K +EFSSIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL+HL 
Sbjct: 193 LTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLK 252

Query: 258 FLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNT 317
           FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALNT
Sbjct: 253 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNT 312

Query: 318 LACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
           LACSLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN
Sbjct: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372

Query: 378 NSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLN 437
           N+ ITFAG+ GQFELNV+KP+MISNLLSS+RLL DAS SFR+HC++ +KAN+D+I + L+
Sbjct: 373 NAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLH 432

Query: 438 KSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPK 497
           +SLMLVTALNPKIGYD             ITLKESAL+LGVL EKEFDEWVIPE MI PK
Sbjct: 433 ESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/497 (76%), Positives = 424/497 (85%), Gaps = 9/497 (1%)

Query: 1   MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ 60
           M+R + NSS KA V+ +  + N+RR        N  FR ETD+FGEINVPAD+YWGAQTQ
Sbjct: 1   MLR-LTNSSCKAFVQSSY-KFNIRR-------MNSTFRTETDAFGEINVPADKYWGAQTQ 51

Query: 61  RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL 120
           RSFQNFKIGG RE++P P+V AFG+LKKSAA VNE+LG LD  I+  I+ AADEVA GKL
Sbjct: 52  RSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKL 111

Query: 121 SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT 180
            DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG++GSK+VHPNNH NQSQSSNDTFPT
Sbjct: 112 DDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPT 171

Query: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240
           VMHIAA+ +I N+LIPEL NLK+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQ
Sbjct: 172 VMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQ 231

Query: 241 QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE 300
           QVENGIQRV  SL  L FLAQGGTAVGTGLNTK GFD  +AE++SKETGL F+TAPNKFE
Sbjct: 232 QVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFE 291

Query: 301 ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN 360
           ALAAHDAIVE SGALNTLACSLFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVN
Sbjct: 292 ALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVN 351

Query: 361 PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH 420
           PTQNEA+TQVCVQVMGNN+ ITFAGSQGQFELNV+KP+MI+NLL+SIRL+TDA+ SFR+H
Sbjct: 352 PTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVH 411

Query: 421 CLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLT 480
           C+  +KAN+ +I E L KSLMLVTALNPKIGYD             ITLKESALELGVLT
Sbjct: 412 CVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLT 471

Query: 481 EKEFDEWVIPENMISPK 497
           EKEFDEWV+PENM+ PK
Sbjct: 472 EKEFDEWVVPENMLGPK 488

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/460 (78%), Positives = 406/460 (88%)

Query: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96
           +RVETD+FGEI VPAD+YWGAQTQRSFQNFKIGG RE++PEP+VRAFG+LKKSAA VNE 
Sbjct: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156
           LGTLD  IA  I+ AADEVA+GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGE
Sbjct: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216
           LGSK++HPNNH NQ+QSSNDTFP+VMHIAA TEI N L+PE+  LKDAL  K EEF  IV
Sbjct: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++++L HL +LAQGGTAVGTGLNTK GF
Sbjct: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336
           DKL+AE++SKETG+ F+TAPNKFEALAAHDAIVEASGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ +TFAG+ GQFELNV+K
Sbjct: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXX 456
           P+MISNLLSSIRLL DA  SFR+HC+  ++AN++KI+ NL+ SLMLVTALNPKIGYD   
Sbjct: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 457 XXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
                     ITLKESALEL  LT +EFDEWVIPENM+ P
Sbjct: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/491 (76%), Positives = 418/491 (85%), Gaps = 8/491 (1%)

Query: 7   NSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNF 66
           N S K  VK +  + N+RR        N  FR ETD+FGEI+VPAD+YWGAQTQRSFQNF
Sbjct: 6   NCSCKTFVKSSY-KLNIRR-------MNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNF 57

Query: 67  KIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPL 126
           KIGG RE++P P+V AFG+LKKSAA VNE+LG LD  I+  I+ AADEVA GKL DHFPL
Sbjct: 58  KIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPL 117

Query: 127 VVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAA 186
           VVFQTGSGTQSNMNANEVISNRAIE+LGG++GSKQVHPNNH NQSQSSNDTFPTVMHIAA
Sbjct: 118 VVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAA 177

Query: 187 TTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 246
           + +I N+LIPEL NLK+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGI
Sbjct: 178 SLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 237

Query: 247 QRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHD 306
           QRV  SL  L FLAQGGTAVGTGLNTK GFD  +AE++SKETGL F+TAPNKFEALAAHD
Sbjct: 238 QRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHD 297

Query: 307 AIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEA 366
           AIVE SGALNTLACSLFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVNPTQNEA
Sbjct: 298 AIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEA 357

Query: 367 MTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLK 426
           +TQVCVQVMGNN+ ITFAGSQGQFELNV+KP+MI+NLL+SIRL+TDA+ SFR+HC+  +K
Sbjct: 358 LTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIK 417

Query: 427 ANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDE 486
           AN+ +I E L KSLMLVTALNPKIGYD             ITLKESALELGVLTEKEFDE
Sbjct: 418 ANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDE 477

Query: 487 WVIPENMISPK 497
           WV+PE+M+ PK
Sbjct: 478 WVVPEHMLGPK 488

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/484 (75%), Positives = 419/484 (86%), Gaps = 3/484 (0%)

Query: 18  LLRNNL-RRNMSASAITNQ--EFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREK 74
           +LR  L  R +S   ++ +  +FRVETD+FGEI V ADRYWGAQTQRS +NF+IGG RE+
Sbjct: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60

Query: 75  IPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSG 134
           +PEP+VRAFG+LKKSAA VNE+LGTLD  +A  IK AADEVA+GKL+ HFPLVVFQTGSG
Sbjct: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120

Query: 135 TQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKL 194
           TQSNMNANEVISNRAIEL+GGELGSKQ+HPNNH NQ+QSSNDTFP+VMHIAA TEI   L
Sbjct: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180

Query: 195 IPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLY 254
           +PEL +L+D+L  K +EFS IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV+ SL+
Sbjct: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240

Query: 255 HLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGA 314
            L +LAQGGTAVGTGLNTK+GF + +AE+VSKETGL F+TAPNKFEALAAHDA+VEASGA
Sbjct: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300

Query: 315 LNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQV 374
           LNT+ACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360

Query: 375 MGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDE 434
           MGNN+ ITFAG+ GQFELNV+KP+MISNLLSS+RLL DAS SFR+HC++ + AN+D+I +
Sbjct: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420

Query: 435 NLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMI 494
            +++SLMLVTALNPKIGYD             ITLK+SAL+LGVLTE EFDEWV+PENMI
Sbjct: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480

Query: 495 SPKP 498
            PKP
Sbjct: 481 GPKP 484

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/472 (76%), Positives = 410/472 (86%)

Query: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84
           R MS +A  NQ+FR+ETD+FGEI VPA++YWGAQTQRS +NFKIGG RE++PEP+++AFG
Sbjct: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75

Query: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144
           ILKKSAA VNE+LGTLD  I+  I+ AADEV EGKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135

Query: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204
           ISNRAIEL+GGELG+KQ+HPNNH NQ+QSSNDTFP+VMHIAA TEI N L+PEL  L+D+
Sbjct: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195

Query: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264
            Q K EEFS IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV+ SL+HL FLAQGGT
Sbjct: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255

Query: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324
           AVGTGLNTKVGF + +AE+VSKET + F+TAPNKFEALAAHDA+VE SGALNT+ACSLFK
Sbjct: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315

Query: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQ CVQVMGNNSTITFA
Sbjct: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375

Query: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444
           G+ GQFELNV+KP+MISNLL+SIRLL DAS SFR+HC++ +KAN+DKI + L++SLMLVT
Sbjct: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435

Query: 445 ALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
           ALNPKIGYD             ITLKESALELGVL+E+EF EWV+PE MI P
Sbjct: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/476 (77%), Positives = 410/476 (86%), Gaps = 7/476 (1%)

Query: 22  NLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVR 81
           NLRR        N  FR+ETD+FGEINVPAD+YWGAQTQRSFQNFKIGG RE++P P+V 
Sbjct: 20  NLRR-------MNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72

Query: 82  AFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNA 141
           AFG+LKKSAA VNE+LG LD  I+  I+ AADEV  GKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 73  AFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNA 132

Query: 142 NEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNL 201
           NEVISNRAIE+LGG++GSK+VHPNNH NQSQSSNDTFPTVMHIAA+ +I N+LIPEL NL
Sbjct: 133 NEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNL 192

Query: 202 KDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQ 261
           K+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV  SL  L FLAQ
Sbjct: 193 KNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252

Query: 262 GGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACS 321
           GGTAVGTGLNTK GFD  +AE++S ETGL F+TAPNKFEALAAHDAIVE SGALNTLACS
Sbjct: 253 GGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312

Query: 322 LFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTI 381
           LFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVNPTQNEA+TQVCVQVMGNN+ I
Sbjct: 313 LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372

Query: 382 TFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLM 441
           TFAGSQGQFELNV+KP+MI+NLL+SIRL+TD++ SFR+HC+  +KAN+ +I E L KSLM
Sbjct: 373 TFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLM 432

Query: 442 LVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPK 497
           LVTALNPKIGYD             ITLKESALELGVLTEKEFDEWV+PENM+ PK
Sbjct: 433 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/491 (75%), Positives = 417/491 (84%), Gaps = 8/491 (1%)

Query: 7   NSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNF 66
           NSS KA ++ +  + N+RR        N  FR ETD+FGEINVPAD+YWGAQTQRSFQNF
Sbjct: 6   NSSCKAILQSSY-KVNIRR-------MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNF 57

Query: 67  KIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPL 126
           KIGG RE++P P+V AFG+LKKSAA VNE+LG LD  ++  I+ AADEVA GKL DHFPL
Sbjct: 58  KIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPL 117

Query: 127 VVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAA 186
           VVFQTGSGTQSNMNANEVISNRAIE+LGG++GSKQVHPNN  NQSQSSNDTFPTVMHIAA
Sbjct: 118 VVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAA 177

Query: 187 TTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 246
           + +I  +LIPEL NLK+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGI
Sbjct: 178 SLQIEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 237

Query: 247 QRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHD 306
           QRV  +L  L FLAQGGTAVGTGLNTK GFD  +AE++SKETGL F+TAPNKFEALAAHD
Sbjct: 238 QRVAHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHD 297

Query: 307 AIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEA 366
           AIVE SGALNTLACSLFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVNPTQNEA
Sbjct: 298 AIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEA 357

Query: 367 MTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLK 426
           +TQVCVQVMGNN+ ITF GSQGQFELNV+KP+MI+NLL+SIRL+ DAS+SFRIHC+  +K
Sbjct: 358 LTQVCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIK 417

Query: 427 ANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDE 486
           AN+ +I E L KSLMLVTALNPKIGYD             ITLKESALELGVLTEKEFDE
Sbjct: 418 ANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDE 477

Query: 487 WVIPENMISPK 497
           WV+PENM+ PK
Sbjct: 478 WVVPENMLGPK 488

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/497 (74%), Positives = 420/497 (84%), Gaps = 6/497 (1%)

Query: 1   MIRSVFNSSGKASVKVALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQ 60
           M+R+   S G A  +V+   N L      +++    +RVETD+FGEI VP+D+YWGAQTQ
Sbjct: 1   MLRNSIVSRGLAQTRVSAKVNRL------ASLRMVSYRVETDAFGEIQVPSDKYWGAQTQ 54

Query: 61  RSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKL 120
           RS QNFKIGG RE++PEP+V+AFG+LKKSAA VNE LGTLD  IA  IK AADEVA+GKL
Sbjct: 55  RSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKL 114

Query: 121 SDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPT 180
            +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGELGSK++HPNNH NQ+QSSNDTFP+
Sbjct: 115 MEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPS 174

Query: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240
           VMHIAA TEI + L+PEL+ LK AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQ
Sbjct: 175 VMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQ 234

Query: 241 QVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFE 300
           QVENGI RV+ SLYHL FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFE
Sbjct: 235 QVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFE 294

Query: 301 ALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVN 360
           ALAAHDA+VEASGALNTLA SLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVN
Sbjct: 295 ALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 354

Query: 361 PTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIH 420
           PTQNEAMTQVCVQVMGN++ ITFAG+ GQFELNV+KP+MISNLLSSIRLL DAS SFRIH
Sbjct: 355 PTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIH 414

Query: 421 CLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLT 480
           C+  +KAN+D+I + L++SLMLVTALNPKIGYD             ITLKESALEL VL+
Sbjct: 415 CVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLS 474

Query: 481 EKEFDEWVIPENMISPK 497
            +EFD+WVIPE MI PK
Sbjct: 475 SEEFDQWVIPEKMIGPK 491

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/473 (75%), Positives = 408/473 (86%)

Query: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84
           R +S S+  +Q+ RVETD+FGEINVPAD+YWGAQTQRS +NFKIGG RE++PEPVVRAFG
Sbjct: 20  RLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFG 79

Query: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144
           ILKKSAA VNE+LGTLD  I+  I+ AADEV  GKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 80  ILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEV 139

Query: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204
           ISNRAIE++GG++G+K +HPNNH NQ+QSSNDTFP+VMHIAA TEI + L+PEL  L+D+
Sbjct: 140 ISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDS 199

Query: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264
              K +EF SIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL HL FLAQGGT
Sbjct: 200 FATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGT 259

Query: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324
           AVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDAIVE SGALNTLACSLFK
Sbjct: 260 AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFK 319

Query: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ ITFA
Sbjct: 320 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379

Query: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444
           G+ GQFELNV+KP+MISNLLSS+RLL DA  SFR+HC++ ++AN+DKI + L++SLMLVT
Sbjct: 380 GASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVT 439

Query: 445 ALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPK 497
           ALNPKIGYD             ITLKESALEL VLT  EFD+WV+PENM+ PK
Sbjct: 440 ALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/482 (74%), Positives = 411/482 (85%)

Query: 17  ALLRNNLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIP 76
           AL+  +  R +S S+   Q++RVETD+FGEI VP D+ WGAQTQRS +NFKIGG RE++P
Sbjct: 12  ALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMP 71

Query: 77  EPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQ 136
           EP+V+AFGILKKSAA VNE+LGTLD  ++  I+ AADEV  GKL DHFPLVVFQTGSGTQ
Sbjct: 72  EPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQ 131

Query: 137 SNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIP 196
           SNMNANEVISNRAI+L+GGE+GSK +HPNNH NQ+QSSNDTFP+VMHIAA TE+ + L+P
Sbjct: 132 SNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLP 191

Query: 197 ELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHL 256
           EL  L+DA   K +EF SIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL++L
Sbjct: 192 ELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNL 251

Query: 257 HFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALN 316
            FLAQGGTAVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDA+VE SGALN
Sbjct: 252 KFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALN 311

Query: 317 TLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376
           TLACSLFKIA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMG
Sbjct: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371

Query: 377 NNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENL 436
           NN+ ITFAG+ GQFELNV+KP+MISNLLSSIRLL DA  SFR+HC+  ++AN+DKI + L
Sbjct: 372 NNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLL 431

Query: 437 NKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
           ++SLMLVTALNPKIGYD             ITLKESALELGVL+  EFDEWV+PENM+ P
Sbjct: 432 HESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

Query: 497 KP 498
           KP
Sbjct: 492 KP 493

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/462 (78%), Positives = 412/462 (89%)

Query: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96
           FRVETDSFGEI VP+++YWGAQTQRSFQNFKIGG+REKIP P+++AFGILKKSAA VN++
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156
           LGTLD SIA  I  A+DEV +GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA EL+G E
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216
           LGSK++HPNNHVNQSQSSNDTFP+VMHIAA  E+ N LIP+L  LK++L +K +E+++IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+Q+SLYHL FLAQGGTAVGTGLNTKVGF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336
           DK++A+EVSKETG+ FETAPNKFEALAAHDAIV AS A+ T+A SLFKIAQDIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN TI  AGSQGQFELNVYK
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXX 456
           PLMI+NLL+SIRL++DA  SF+IHC++ LKAN DKI+ENL+KSLMLVTALNPKIGYD   
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 457 XXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPKP 498
                     ITLKESALELG+LTE+EFD+WVIPENMI PKP
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/473 (73%), Positives = 404/473 (85%)

Query: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84
           R + ++A   Q+FRVETD+FGEI VPAD+YWGAQTQRS +NF+IGG RE++PEPVVRAFG
Sbjct: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74

Query: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144
           +LKKSAA VNE LGTL+  IA  I+ AADEVA+G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134

Query: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204
           ISNRAIELLGGELGSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI   L+PEL+ L+ +
Sbjct: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194

Query: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264
            Q K +EF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+ +   L FLAQGGT
Sbjct: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254

Query: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324
           AVGTGLNT+ GF + +A +VS+ETGL F TAPNKFEALAAHDA+VEASGALNTLACSLFK
Sbjct: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314

Query: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFA
Sbjct: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374

Query: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444
           G+ GQFELNV+KP+MI+NLLSS+RLL DA++SFR+HC++ ++ N+D+I + L++SLMLVT
Sbjct: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434

Query: 445 ALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPK 497
           ALNPKIGYD             ITL+ SALELGVLT+ EFDEWV+PE MI P+
Sbjct: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/461 (75%), Positives = 403/461 (87%)

Query: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96
           FR+ETD FGEI VPA++YWGAQT+RSF+NF+IGG RE++P+PVV+AFG+LKKSAA VNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156
            GTLD  I+  I+ AADEV +GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216
           LGSKQVHPNNHVNQ+QSSND+FPTVMHIAA TEI + LIPE+ NL+DAL+ K ++F+ IV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SL +L FLAQGGTAVGTGLNT++GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336
            + +AE++SKETG+ F+TAPNKFEALAAHDAIVEASGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396
           RCGYGEL LP NEPGSSIMPGK+NPTQNEA+TQVC Q++GNN TI FAG+QGQFELNV+K
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXX 456
           P+MISNLLSSIRLL D SKSFRIHC+  +KAN+++I + +NKSLMLVTALNPKIGYD   
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 457 XXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPK 497
                     ITLKESA++LG LTE EFDEWV+PE MI PK
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/460 (76%), Positives = 399/460 (86%)

Query: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96
           FR+ETD FGEI VPAD+YWGAQTQRS++NFKIGG RE++PEPVV+AFG+LKKSAA VNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156
            G LD  I+  I+ AADEV EGKL++HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216
           +GSK++HPNNH N +QSSNDTFPTVMHIAA TEI + LIP++  LKDAL +K +EF  IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SL +L FLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336
            + +AE+VSKETG+ F+TAPNKFEALAAHDAIVE+SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ ITFAG+ GQFELNV+K
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXXX 456
           P+MISNLLSSIRLL DA  SF IHC+  ++AN+DKI++ L++SLMLVTALNPKIGYD   
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 457 XXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
                     ITLKESALELGVLTE EFDEWV+PE M+ P
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/483 (73%), Positives = 408/483 (84%), Gaps = 4/483 (0%)

Query: 18  LLRNNLRRN---MSASAITN-QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDRE 73
           +LR+ +R N   +    I+N + FRVETD FGEI VPA++YWGAQT+RSF+NFKIGG RE
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 74  KIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGS 133
           ++PE VVRAFG+LKK AA VN  LG LD + +  I+ AADEVA GKL+DHFPLVVFQTGS
Sbjct: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 134 GTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANK 193
           GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA T+I+  
Sbjct: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           L+PEL +L+DAL  K  EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++ + 
Sbjct: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 254 YHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASG 313
            +L FLAQGGTAVGTGLNTK G+ + +A E+SKETGL F+TAPNKFEALAAHDAIVEASG
Sbjct: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 314 ALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQ 373
           ALNT+ACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 374 VMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKID 433
           VMGNN+ +TFAG+ GQFELNV+KP++ISNLLSS++LL DAS+SFR+HC+  +KAN+ KI 
Sbjct: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 434 ENLNKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENM 493
           E L++SLMLVTALNPKIGYD             ITLKESALELGVLTEKEFDEWV+PE M
Sbjct: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 494 ISP 496
           + P
Sbjct: 481 LGP 483

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/464 (75%), Positives = 396/464 (85%)

Query: 35  QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVN 94
           QE RVETD+FGEI VPAD+YWGAQTQRSF+NF+IGG RE++PE VV AFGILKK+ ATVN
Sbjct: 42  QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVN 101

Query: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154
           E  G LD  +A  IK AADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIELLG
Sbjct: 102 EANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 161

Query: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214
           G+LGSK VHPNNH+N SQSSNDTFPTVMHIAA   I   L+P L  LKD+LQ K EEF+ 
Sbjct: 162 GKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFAD 221

Query: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274
           IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI+RV+S+L  L  LAQGGTAVGTGLNTK+
Sbjct: 222 IVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKI 281

Query: 275 GFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGS 334
           G+ + VA EV+KETG+ F+TAPNKFEALAAHDA+VEASGALNTLA SLFKIAQDIRYLGS
Sbjct: 282 GWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGS 341

Query: 335 GPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNV 394
           GPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQVCVQV GN+S ITFAG+ GQFELNV
Sbjct: 342 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNV 401

Query: 395 YKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDX 454
           +KP+MISNLLSSI LL+DAS SFR+HC++ ++AN++ I + L++SLMLVTALNPKIGYD 
Sbjct: 402 FKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDA 461

Query: 455 XXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISPKP 498
                       ITLKESAL+L +LT +EFD WV+PE+MI PKP
Sbjct: 462 ASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/461 (72%), Positives = 395/461 (85%)

Query: 36  EFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNE 95
           E R+E D FGE+ VPA++YWGAQTQR+  NF IGG+RE++PEP++ A+GILKKS A VNE
Sbjct: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62

Query: 96  NLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 155
           +LGTLD  I+  I+ AADEVA+G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG
Sbjct: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122

Query: 156 ELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSI 215
           +LGSK VHPNNHVNQSQS+ND+FPT MHI+A  E+  KL+PEL+ L+DAL+ K  EF+ I
Sbjct: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182

Query: 216 VKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVG 275
           VKIGRTHLQDATPLTLGQEFSGYVQQVENGI RVQ+SL +L F+AQGGTAVGTG+NTK  
Sbjct: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242

Query: 276 FDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSG 335
           FD LVA+++S ETG+ F+TAPNKFEALA+HDAIVE SGALNTLACSLFKI+QDIR+LGSG
Sbjct: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302

Query: 336 PRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVY 395
           PRCGYGEL LP NEPGSSIMPGKVNPTQNEAM Q C+QVMGNNS ITFAG+ GQFELN Y
Sbjct: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362

Query: 396 KPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDXX 455
           KPLMISNLL+SIRLLTD+  SFRIHC+  ++AN+DKI++ LN+SLMLVTALNPKIGYD  
Sbjct: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422

Query: 456 XXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
                      +TLKE+AL+  +LT ++FDEW++PE+M+ P
Sbjct: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/480 (68%), Positives = 390/480 (81%), Gaps = 5/480 (1%)

Query: 22  NLRRNMSASAITN-----QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIP 76
           N +R+ S + +++     Q  R ETDSFGEI VPA++YWGAQTQRSF NFKIGG+RE++P
Sbjct: 20  NCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMP 79

Query: 77  EPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQ 136
           EP++RAFG  KK+AA VN +LGTLD ++   I  AA+EV++G L++HFPLVVFQTGSGTQ
Sbjct: 80  EPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQ 139

Query: 137 SNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIP 196
           SNMNANEVISNRAIELLGG LGSKQVHPNNHVNQSQSSNDTFPTVMHIAA TEI N L+P
Sbjct: 140 SNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLP 199

Query: 197 ELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHL 256
            L  L++ L  K +EF  I+KIGRTHLQDATPLTLGQEFSGY QQ+ N I+R++ +L  L
Sbjct: 200 NLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPEL 259

Query: 257 HFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALN 316
            ++AQGGTAVGTGLNTK+GF +  A ++S +T L F T+PNKFE+LAAHDAIV    +LN
Sbjct: 260 QYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLN 319

Query: 317 TLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376
           TLACSLFKI+QDIRYL SGPRCGYGEL +P NEPGSSIMPGKVNPTQNEAM Q CVQVMG
Sbjct: 320 TLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMG 379

Query: 377 NNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENL 436
           NNSTI+FAG+ GQFELN YKPLMI+NLLSS RLL+DA  SF +HC   ++ANKDKID  L
Sbjct: 380 NNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLL 439

Query: 437 NKSLMLVTALNPKIGYDXXXXXXXXXXXXXITLKESALELGVLTEKEFDEWVIPENMISP 496
           ++SLMLVT+LNPKIGYD             ITLK+SALEL +L+ K+FDEWV PENM+ P
Sbjct: 440 HESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 88/215 (40%), Gaps = 9/215 (4%)

Query: 163 HPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTH 222
           H +  V+  +S ND   T M +     + +K+ P L  L   L H+  E   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 223 LQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAE 282
           LQ A P+      S Y        +R++  +  L+   Q     G       G D+   E
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 283 EVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGE 342
            ++ E G       N   A++  D +VE     +     + ++A+D+  + S    G+ +
Sbjct: 217 YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFVK 274

Query: 343 LILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
           L   A   GSS+MP K NP   E +     +V G 
Sbjct: 275 LA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 110/284 (38%), Gaps = 26/284 (9%)

Query: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154
           + LG L ++  AKI     E+ +   +D F        +  +    ANE    R  EL+G
Sbjct: 50  QKLGLLTETELAKIHEGLAEIKKEWEADKFV-----RHANDEDIHTANE---RRLGELIG 101

Query: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214
            ++  K       V+  +S ND   T + I     + + L P ++ L D L  + E    
Sbjct: 102 RDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKGLVDVLVKRAEGEMD 154

Query: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274
           I+  G THLQ A P+      S Y        +R+      LH L Q     G       
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQI---LHRLNQSPLGAGALAGHPY 211

Query: 275 GFDKLVAEEVSKETGLHFETA-PNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLG 333
           G D+    E     GL F +   N   A++  D IVE           + + A+D+  + 
Sbjct: 212 GIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 334 SGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
                G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 266 CTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 141 ANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQN 200
           ANE    R  EL+G ++  K       V+  +S ND   T + I     +   L P L+ 
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 201 LKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLA 260
           L D L  + E    I+  G THLQ A P+      S Y        +R+      LH L 
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQI---LHRLN 197

Query: 261 QGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETA-PNKFEALAAHDAIVEASGALNTLA 319
           Q     G       G D+    E     GL F +   N   A++  D IVE         
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 320 CSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
             + + A+D+  +      G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 87/212 (41%), Gaps = 15/212 (7%)

Query: 168 VNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDAT 227
           V+  +S ND   T M I     +   ++P L +L   +  + EE   ++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 228 PLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDK--LVAEEVS 285
           P+      S Y        +R+Q  +  L+    G  A+        G D+  L A    
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA---GHPYGIDREFLAA---- 219

Query: 286 KETGLHFE-TAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELI 344
              GL+F     N   A+A  D +VE     +     + + A+D+  + S    G+ +L 
Sbjct: 220 ---GLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS 275

Query: 345 LPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376
             A   GSS+MP K NP   E +     +V G
Sbjct: 276 -DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 115/288 (39%), Gaps = 34/288 (11%)

Query: 97  LGTLDKSIAAKI----KLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 152
           LG + +S  AKI    K   +E  EGK   H            +S+ + +     R  EL
Sbjct: 53  LGLITESELAKIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGEL 100

Query: 153 LGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEF 212
           +G ++  K       V+  +S ND   T M I     +  K+ P +++L + L ++ E+ 
Sbjct: 101 IGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKE 153

Query: 213 SSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNT 272
             I+  G THLQ A P+      S Y       ++R++     L+    G  A+      
Sbjct: 154 IDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA---GH 210

Query: 273 KVGFDKLVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRY 331
             G D+    E     GL F     N   A++  D +VE           + + ++D+  
Sbjct: 211 PYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-I 264

Query: 332 LGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNS 379
           + S    G+ +L   A   GSS+MP K N    E +     +V G  S
Sbjct: 265 IYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELS 311

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 110/284 (38%), Gaps = 26/284 (9%)

Query: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154
           + LG L ++  AKI     E+ +   +D F           +    ANE    R  E++G
Sbjct: 50  QKLGLLTQAELAKIHEGLAEIKQEWDADKFI-----RHPNDEDIHTANE---RRLGEIIG 101

Query: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214
            ++  K       V+  +S ND   T + I     + + L P L+ L D L  + +   +
Sbjct: 102 RDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEIN 154

Query: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274
           I+  G THLQ A P+      S Y        +R+      LH L Q     G       
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQI---LHRLNQSPLGAGALAGHPY 211

Query: 275 GFDKLVAEEVSKETGLHFETA-PNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLG 333
           G D+    E     GL F +   N   A++  D IVE           + + A+D+  + 
Sbjct: 212 GIDREFLAE-----GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIY 265

Query: 334 SGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
                G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 266 CTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 112/289 (38%), Gaps = 28/289 (9%)

Query: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154
           E LG L +   +KI    D + +   SD F           +    ANE    R  EL+G
Sbjct: 48  EKLGLLTEVELSKIHDGLDAIKKEWDSDSFV-----RHPNDEDIHTANE---RRLGELIG 99

Query: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214
            ++  K       V+  +S ND   T + I     I +KL+P L++L   L  + E    
Sbjct: 100 TDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIG 152

Query: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274
           I+  G THLQ A P+      S Y        +R++  L  L+    G  A+        
Sbjct: 153 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSPLGAGALA---GHPY 209

Query: 275 GFDKLVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLG 333
           G D+          GL F     N   A++  D +VE           + + A+D+    
Sbjct: 210 GIDREFL-----ANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFMNHISRFAEDLIIYS 264

Query: 334 SGPRCGYGELILP-ANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTI 381
           +     +G + L  A   GSS+MP K N    E +     +V GN S +
Sbjct: 265 TAE---FGFITLSDAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLSGL 310

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 111/286 (38%), Gaps = 26/286 (9%)

Query: 95  ENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 154
           + +G L +   AKI +  D++ +    D F           +    ANE    R  E++G
Sbjct: 50  QKIGLLTEEELAKIHVGLDQIKKEWDEDKFV-----RHPNDEDIHTANE---RRLGEIIG 101

Query: 155 GELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSS 214
            ++  K       V+  +S ND   T + I     +  KL P L +L   L  + EE   
Sbjct: 102 RDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEID 154

Query: 215 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKV 274
           I+  G THLQ A P+      S Y       + R++  L   +    G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGALA---GHPY 211

Query: 275 GFDKLVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLG 333
           G D+    E     GL F     N   A++  D +VE           + + A+D+  + 
Sbjct: 212 GIDREFLAE-----GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIY 265

Query: 334 SGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNS 379
           S    G+ +L   A   GSS+MP K N    E +     +V G+ S
Sbjct: 266 STAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 97/239 (40%), Gaps = 21/239 (8%)

Query: 140 NANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQ 199
            ANE    R  E++G ++  K       V+  +S ND   T + I     +  KL P + 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 200 NLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFL 259
           +L + L  + EE   I+  G THLQ A P+      S Y       ++R++  L   +  
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 260 AQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNTL 318
             G  A+        G D+    E     GL F+    N   A++  D +VE        
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE-----GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 319 ACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
              + + A+D+  + S    G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 96/237 (40%), Gaps = 19/237 (8%)

Query: 141 ANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQN 200
           ANE    R  E++G ++  K       V+  +S ND   T M I     +  KL+P L+ 
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 201 LKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLA 260
           L   +  + E+    +  G THLQ A P+      S Y       ++R++  L   +   
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 261 QGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLAC 320
           Q     G       G D+   E +++E G       N   A++  D +VE          
Sbjct: 198 QSPLGAGALAGHPYGIDR---EFLAEELGFQ-GVIGNSLVAVSDRDFVVELMFWGTLFMN 253

Query: 321 SLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
            + + A+D+  + S    G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 98/240 (40%), Gaps = 25/240 (10%)

Query: 141 ANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQN 200
           ANE    R  E++G  +  K       V+  +S ND   T + I     + +KL P+LQ 
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 201 LKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLA 260
           L D +  + +E   ++  G THLQ A P+      S Y        +R++  +  ++   
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 261 QGGTAVGTGLNTKVGFDK--LVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNT 317
           Q     G       G D+  L A       GL F+    N   A++  D IVE       
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAA-------GLGFDGVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 318 LACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
               + + A+D+  + S    G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 140 NANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQ 199
            ANE    R  EL+G ++  K       V+  +S ND   T + I     + + L P L+
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 200 NLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFL 259
            L + L  + E    ++  G THLQ A P+      S Y        +R+      LH L
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQI---LHRL 196

Query: 260 AQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETA-PNKFEALAAHDAIVEASGALNTL 318
            Q     G       G D+    E     GL F +   N   A++  D IVE        
Sbjct: 197 NQSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 319 ACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
              + + A+D+  +      G+ +L   A   GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 98/241 (40%), Gaps = 21/241 (8%)

Query: 140 NANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQ 199
            ANE    R  E++G E+  K       V+  +S ND   T M I     +   L+P LQ
Sbjct: 91  TANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQ 140

Query: 200 NLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFL 259
                L  + +E   ++  G THLQ A P+      S Y         R++  +  L+  
Sbjct: 141 AFIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKS 200

Query: 260 AQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFE-TAPNKFEALAAHDAIVEASGALNTL 318
             G  A+        G D+   E +++  GL F+    N   A++  D +VE        
Sbjct: 201 PLGAGALA---GHPYGIDR---EFLAR--GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLF 252

Query: 319 ACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 378
              + + ++D+  + S    G+ +L   A   GSS+MP K NP   E +     +V G  
Sbjct: 253 MNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGEL 310

Query: 379 S 379
           S
Sbjct: 311 S 311

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 98/247 (39%), Gaps = 35/247 (14%)

Query: 141 ANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQN 200
           ANE    R  E++G ++  K       V+  +S ND   T + I     +++KL+  L+ 
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 201 LKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLA 260
           L + L ++ EE    +  G THLQ A P+      S Y        +R+      L+   
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 261 QGGTAVG--------TGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEAS 312
            G  A+           L  K+GFD ++                N   A++  D +VE  
Sbjct: 201 LGAGALAGHPYGIDREYLAEKLGFDSVIG---------------NSLVAVSDRDFVVEIL 245

Query: 313 GALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCV 372
                    + + A+D+  + S    G+ +L   A   GSS+MP K N    E +     
Sbjct: 246 FWSTLFMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 373 QVMGNNS 379
           +V GN S
Sbjct: 304 RVFGNLS 310

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 109/273 (39%), Gaps = 24/273 (8%)

Query: 110 LAADEVAE-----GKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHP 164
           L  DE++E     GK+ + +    F      +    ANE    R  E++G  +  K    
Sbjct: 56  LTEDELSEIHYGLGKIKEEWENNTFIRLPSDEDIHTANE---RRLGEIIGTGIAGK---- 108

Query: 165 NNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQ 224
              V+  +S ND   T M I     + N L+  L+ L   +  +  E   I+  G THLQ
Sbjct: 109 ---VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQ 165

Query: 225 DATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEV 284
            A P+      S Y        +R+Q  L  L+    G  A+        G D+   E +
Sbjct: 166 RAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSPLGAGALA---GHPYGIDR---EFL 219

Query: 285 SKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELI 344
           +++ G       N   A++  D +VE     +     + + ++D+  + S    G+ +L 
Sbjct: 220 AQDLGFS-GVIGNSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAEFGFIKLS 277

Query: 345 LPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
             A   GSS+MP K N    E +     +V G+
Sbjct: 278 -DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 87/217 (40%), Gaps = 9/217 (4%)

Query: 163 HPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTH 222
           H    V+  +S ND   T + I     +  KL+P + +L   +  + E    I+  G TH
Sbjct: 103 HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTH 162

Query: 223 LQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAE 282
           LQ A P+      S Y        +R++  L  L+    G  A+        G D+   +
Sbjct: 163 LQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA---GHPYGIDR---Q 216

Query: 283 EVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGE 342
            +S E G +     N   A++  D IV+           + + ++D+  + S    G+ +
Sbjct: 217 YLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFIK 274

Query: 343 LILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNS 379
           L   A   GSS+MP K N    E +     +V G  S
Sbjct: 275 LS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGQLS 310

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 85/216 (39%), Gaps = 11/216 (5%)

Query: 163 HPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTH 222
           H    V+  +S ND   T M I     +  KL+P + +L   L  + E     +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 223 LQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAE 282
           LQ A P+      S Y        +R++  L  L+    G  A+        G D+    
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA---GHPYGIDREFLA 219

Query: 283 EVSKETGLHF-ETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYG 341
           E     GL+F     N   A++  D +VE           + + A+D+  + S    G+ 
Sbjct: 220 E-----GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFV 273

Query: 342 ELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 377
           +L   +   GSS+MP K N    E +     +V G+
Sbjct: 274 KLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 92/239 (38%), Gaps = 19/239 (7%)

Query: 141 ANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQN 200
           ANE    R  EL+G  +  K       V+  +S ND   T M I     +  K++P + +
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 201 LKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLA 260
               L ++  E   ++  G THLQ A P+      S Y         R++  +  L+   
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN--- 197

Query: 261 QGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLAC 320
           Q     G       G D+    E     G+      N   A++  D ++E     +    
Sbjct: 198 QSPLGAGALAGHPYGIDRKYLAEQLGFNGI----IGNSLVAVSDRDFVIEIMFWGSLFMN 253

Query: 321 SLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNS 379
            + + A+D+  + S    G+  L   A   GSS+MP K NP   E +     +V G  S
Sbjct: 254 HISRFAEDL-IIYSTAEFGFINLA-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLS 310

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 102/256 (39%), Gaps = 30/256 (11%)

Query: 129 FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATT 188
           F    G +    ANE    R  E++G  +  K       V+  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 189 EIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQR 248
            + N +   L++L  A+  + E+    +  G THLQ A P+      + Y        +R
Sbjct: 131 ALDN-MAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 249 VQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAI 308
           ++     L+    G  A+        G D+   E +++  G       N  +A++  D +
Sbjct: 190 LKQIRERLNVSPLGCGALA---GHPYGIDR---EHIAERLGFD-GVIGNSLQAVSDRDFV 242

Query: 309 VEASGALNTLACSLF-----KIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQ 363
           VE         CSLF     + ++D+  + S     + +L   A   GSS+MP K NP  
Sbjct: 243 VEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDS 295

Query: 364 NEAMTQVCVQVMGNNS 379
            E +     +V G+ S
Sbjct: 296 LELLRGKSGRVFGSLS 311

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 102/254 (40%), Gaps = 30/254 (11%)

Query: 129 FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATT 188
           F    G +    ANE    R  E++G  +  K       V+  +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYCRE 130

Query: 189 EIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQR 248
            + N L   L++L  A+  + E+    +  G THLQ A P+      + Y        +R
Sbjct: 131 ALDN-LAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 249 VQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAI 308
           ++     L+    G  A+        G D+   E +++  G   +   N  +A++  D +
Sbjct: 190 LKQIRERLNVSPLGCGALA---GHPYGIDR---EFLAERLGFS-DVIGNSLQAVSDRDFV 242

Query: 309 VEASGALNTLACSLF-----KIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQ 363
           VE         CSLF     + ++D+  + S     + +L   A   GSS+MP K NP  
Sbjct: 243 VEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDS 295

Query: 364 NEAMTQVCVQVMGN 377
            E +     +V G+
Sbjct: 296 LELLRGKSGRVFGS 309

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 87/194 (44%), Gaps = 35/194 (18%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           LIP+L N+ + L     ++  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEE-----VSKETGLHFETAPNKF 299
             + F    GT        A+  G + KV   DK VAE      +   TG   +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTG---QTYSRKV 244

Query: 300 EALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILP--ANEPGSSIMPG 357
           +        ++  G L++ A +  K+A DIR L +       EL  P  A++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 358 KVNPTQNEAMTQVC 371
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ D L     E+  +  +G TH Q A   T+G+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL------LGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L++ A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 78/187 (41%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ D L     E+  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L + A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 78/182 (42%), Gaps = 11/182 (6%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           LIP+L N+ D L     E+  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGTAVGTGLNTKVGF----DKLVAEEVSKETGLHFETAPNKFEALAAHDAIV 309
             +      GT  GT  +    F    DK+ A +      L F+T         +    +
Sbjct: 188 NDIGLRGVKGTT-GTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDI 246

Query: 310 EASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQ 369
           +    L++ A +  K+A DIR L +       E     ++ GSS M  K NP + E   +
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE---R 300

Query: 370 VC 371
           VC
Sbjct: 301 VC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ D L     E+  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILP--ANEPGSSIMPGKVNPT 362
               ++    L++ A +  K+A DIR L +       EL  P   ++ GSS M  K NP 
Sbjct: 242 RKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPM 296

Query: 363 QNEAMTQVC 371
           + E   +VC
Sbjct: 297 RCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 104/252 (41%), Gaps = 28/252 (11%)

Query: 139 MNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATT---------- 188
           M AN +I+++ +     +    +     HV+    +      ++H+ AT+          
Sbjct: 60  MKANLIITDKELARASAQEAIVRHDVMAHVHTFGETCPAAAGIIHLGATSCYVTDNADLI 119

Query: 189 ---EIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 245
              +  + +IP+L N+ D L     E+  +  +G TH Q A   TLG+  + ++Q++   
Sbjct: 120 FLRDAYDVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWD 179

Query: 246 IQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF----DKL--VAEEVSKETGLHFETAPNKF 299
           ++    +   L      GT  GT  +    F    DK+  + E V++  G  F+T     
Sbjct: 180 LRNFVRARNDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVT 236

Query: 300 EALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKV 359
               +    ++    L + A +  K+A DIR L +       E     ++ GSS M  K 
Sbjct: 237 GQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 360 NPTQNEAMTQVC 371
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 111/273 (40%), Gaps = 64/273 (23%)

Query: 143 EVISNRAIELLGGEL---------GSKQVHPNNH--VNQSQSSNDTFPT---VMHIAATT 188
           +VIS  AIE +   L          SKQ     H  +    +  +T P    ++H+ AT+
Sbjct: 50  DVISEEAIEQMKAHLTINDEEIAAASKQEAIVRHDVMAHVHTFGETCPKAAGIIHLGATS 109

Query: 189 -------------EIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEF 235
                        +  + LIP+L N+ + L     E+  +  +G TH Q A   TLG+  
Sbjct: 110 CFVTDNADLIFLRDAYDILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRV 169

Query: 236 SGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGT---------GLNTKV-GFDKLVAE--- 282
           + ++Q++   ++    +   +      GT  GT         G + KV   DK VAE   
Sbjct: 170 TLWIQELLWDLRNFVRARNDIGLRGVKGT-TGTQASFLTLFHGDHDKVEALDKRVAELLG 228

Query: 283 --EVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGY 340
              V   TG   +T   K +        ++    L++ A +  K+A DIR L +      
Sbjct: 229 FSTVYPVTG---QTYSRKID--------IDVLAPLSSFAATAHKMATDIRLLAN-----L 272

Query: 341 GELILP--ANEPGSSIMPGKVNPTQNEAMTQVC 371
            EL  P   ++ GSS M  K NP + E   +VC
Sbjct: 273 KELEEPFEKSQIGSSAMAYKRNPMRCE---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           LIP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L++ A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ D L     ++  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L++ A S  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 15/184 (8%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGTAVGTGLNTKVGF----DKL--VAEEVSKETGLHFETAPNKFEALAAHDA 307
             +      GT  GT  +    F    DK+  + E V++  G  F+T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 308 IVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAM 367
            ++    L++ A S  K+A DIR L +       E     ++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 368 TQVC 371
            +VC
Sbjct: 300 -RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 11/182 (6%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGTAVGTGLNTKVGF----DKLVAEEVSKETGLHFETAPNKFEALAAHDAIV 309
             +      GT  GT  +    F    DK+ A +      L F+          +    +
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKIDI 246

Query: 310 EASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQ 369
           +    L++ A +  K+A DIR L +       E     ++ GSS M  K NP + E   +
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---R 300

Query: 370 VC 371
           VC
Sbjct: 301 VC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAE-----EVSKETGLHFETAPNKF 299
             +      GT        A+  G + KV   D+ V E     +V   TG   +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 300 EALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKV 359
           +        ++    L++ A +  K+A DIR L +       E     ++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 360 NPTQNEAMTQVC 371
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ D L      +  +  +G TH Q A   TLG+  + ++Q +   ++    + 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 254 YHLHFLAQGGTAVGTGLNTKVGF----DKLVAEEVSKETG--LHFETAPNKFEALAAHDA 307
             +      GT  GT  +    F    DK+  EE+ +     L FET         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKV--EELDQRVTELLGFETVYPVTGQTYSRKI 244

Query: 308 IVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAM 367
            ++    L + A +  K+A DIR L +       E      + GSS M  K NP + E  
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE-- 299

Query: 368 TQVC 371
            +VC
Sbjct: 300 -RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAE-----EVSKETGLHFETAPNKF 299
             +      GT        A+  G + KV   D+ V E     +V   TG   +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 300 EALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKV 359
           +        ++    L++ A +  K+A DIR L +       E     ++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 360 NPTQNEAMTQVC 371
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 82/192 (42%), Gaps = 31/192 (16%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAE-----EVSKETGLHFETAPNKF 299
             +      GT        A+  G + KV   D+ V E     +V   TG   +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 300 EALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKV 359
           +        ++    L++ A +  K+A DIR L +       E      + GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 360 NPTQNEAMTQVC 371
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           LIP+L N+ + L     ++  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL------LGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L + A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L     ++  +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   DK V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++    L++ A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 15/184 (8%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           +IP+L N+ + L +   E+  +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGTAVGTGLNTKVGF----DKLVAEEVSKETG--LHFETAPNKFEALAAHDA 307
             +      GT  GT  +    F    DK+  EE+ +     L F+T         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKV--EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 308 IVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAM 367
            ++    L + A +  K+A DIR L +       E     ++ GSS M  K NP + E  
Sbjct: 245 DIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 368 TQVC 371
            +VC
Sbjct: 300 -RVC 302

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P53067 Saccharomyces cerevisiae
           YGL241W
          Length = 1009

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 276 FDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEAS-GALNTLACSLFKIA 326
           +D +++EE+  E G+ FET    F  + ++DA  EA   ALN L C + +++
Sbjct: 155 YDDVISEEMFFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMS 206

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 184 IAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQV 242
           + ++ EI  ++IP+L++L+  L HK++E   +    +T++Q+   LT GQ    Y+  V
Sbjct: 270 VKSSKEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT-GQLLHKYIAAV 327

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 21/187 (11%)

Query: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253
           LIP+L N+ + L         +  +G TH Q A   TLG+  + ++Q++   ++  + + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 254 YHLHFLAQGGT--------AVGTGLNTKV-GFDKLVAEEVSKETGLHFETAPNKFEALAA 304
             +      GT        A+  G + KV   D+ V E       L F+T         +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVE------LLGFDTVYPVTGQTYS 241

Query: 305 HDAIVEASGALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQN 364
               ++A   L++ A +  K+A DIR L +       E     ++ GSS M  K NP + 
Sbjct: 242 RKIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRC 298

Query: 365 EAMTQVC 371
           E   +VC
Sbjct: 299 E---RVC 302

>Kpol_1039.42 s1039 (129479..131332) [1854 bp, 617 aa] {ON}
           (129479..131332) [1854 nt, 618 aa]
          Length = 617

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 87/206 (42%), Gaps = 41/206 (19%)

Query: 186 ATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 245
           A+ E++ ++IP L++L+  L  K++E    +K  ++  +++         S  +QQ +  
Sbjct: 265 ASKELSTEIIPRLEDLRRDLLVKIKE----IKFLQSDFKNSC--------SKELQQTKQD 312

Query: 246 IQRVQSSLYHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAA- 304
           ++R   S+    F    G+       TK+  DK + +++++E  LH   A +  E  AA 
Sbjct: 313 MRRFLDSIAEAKF----GSPKQDPYLTKIILDKQIKKQITEENFLH--EAYDNLENSAAE 366

Query: 305 --HDAIVEASGALNTLACSLFKIAQ----------DIRYLGSGPRCGYGELI------LP 346
                ++E   AL   A  + + +Q          D+ +    PR  +   I      +P
Sbjct: 367 LERVVVMEIQNALTIYARLIGQQSQIVFDVLISKLDMGFFSKDPRFEWDSFIARDPNFIP 426

Query: 347 ANEP----GSSIMPGKVNPTQNEAMT 368
            N P     S +   + +P  +E  T
Sbjct: 427 PNIPTRKVSSIVYKNQFDPLTHEVKT 452

>KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON}
           Anc_3.438 YPR115W
          Length = 1103

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 187 TTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVE 243
           + EI N LIP L+NL+  LQ K+++   +    RT++     LT GQ  + Y+  ++
Sbjct: 275 SKEIVNSLIPNLENLRKDLQFKIKDIKDLHNDFRTNINAHIKLT-GQLLNKYIGSIK 330

>Kpol_359.12 s359 complement(18165..21392) [3228 bp, 1075 aa] {ON}
           complement(18165..21392) [3228 nt, 1076 aa]
          Length = 1075

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 187 TTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYV 239
           + EIAN LIP+L++L+  L  KV++  S+    +T++ D   +T  Q  + Y+
Sbjct: 280 SKEIANNLIPQLESLRKDLSMKVKDIKSLHDNFKTNINDHIKIT-SQLLNKYI 331

>Skud_12.508 Chr12 (900873..906674) [5802 bp, 1933 aa] {ON} YLR422W
            (REAL)
          Length = 1933

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 174  SNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLT--- 230
            + +TFPT+M+ +   ++  K +  L+N   +LQ K++E   +  +    L+D   +    
Sbjct: 1670 TTNTFPTLMNRSEVVKVTKKKLSPLENAIRSLQVKIQELYGLENMCHKTLKDHGDVNDLF 1729

Query: 231  --LGQEFSGYVQQ-VENGIQRVQSSLYHLHFLAQGGTAVGTGLN---TKVGFDKLVAEEV 284
              L    +G +   +  GI + ++      FL    +   +  +     + FD+LVA  +
Sbjct: 1730 SELSTNITGTISAPINGGISQYKA------FLGNPTSKEFSAEDLARLTLAFDELVA-VL 1782

Query: 285  SKETGLHFETAPNKFEALAAHDAIV 309
             +   LH E  P+K E   +HD +V
Sbjct: 1783 GRCLALHAELLPSK-ELKPSHDLLV 1806

>KAFR0A05460 Chr1 complement(1086917..1089184) [2268 bp, 755 aa]
           {ON} Anc_3.438 YPR115W
          Length = 755

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 183 HIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLT--LGQEFSGYVQ 240
           H   + E+ N ++P+L+++K  L HK++E   +     ++L    P+T  L   F   ++
Sbjct: 246 HFKVSKELLNNVVPKLESMKKELSHKIKEIKGLHNDFASNLDYMLPITSNLLNNFISSIK 305

Query: 241 QVENG 245
             ++G
Sbjct: 306 TYKDG 310

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
           Anc_8.604 YOR195W
          Length = 818

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 56/131 (42%), Gaps = 23/131 (17%)

Query: 37  FRVETDSFGE-----INVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAA 91
            + E D   E     IN+ A+     QT+R  QN KI   ++KI E         K   +
Sbjct: 337 LKAEYDGLSEKYETKINITAEEMENIQTERENQNRKIDKLKKKISE--------YKDEIS 388

Query: 92  TVNENLGTLDKSIAAKIKLAADEVAEGKLSD---HFPLVVFQTGSGTQSNMNANEVISNR 148
            +N+N     K +  K    +DE  + KLS    +  L   +       N N N++IS++
Sbjct: 389 MLNQN----QKILQNKYNQTSDESEKWKLSHEEVNDKLQALEKDHQAVLN-NLNQLISDK 443

Query: 149 AIELLGGELGS 159
             E LG EL S
Sbjct: 444 --EKLGSELSS 452

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 181 VMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQ 240
           V  +  + EI   L+P +++L+  LQ K++E   +    RT++ +   +T GQ  + Y+ 
Sbjct: 278 VQQLKISKEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVAIT-GQLLNRYIS 336

Query: 241 QVE 243
            V+
Sbjct: 337 SVK 339

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,826,644
Number of extensions: 2025135
Number of successful extensions: 5135
Number of sequences better than 10.0: 87
Number of HSP's gapped: 5341
Number of HSP's successfully gapped: 87
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)