Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E027406.45ON55655624010.0
KAFR0A052406.45ON5534588611e-108
ZYRO0C07194g6.45ON5584388321e-104
TDEL0G042506.45ON5174338101e-101
TBLA0B005606.45ON4924347563e-93
TPHA0F024806.45ON6054317643e-93
YOL013C (HRD1)6.45ON5514467578e-93
Smik_15.1576.45ON5504457421e-90
NDAI0C027706.45ON6304747411e-89
Suva_15.1596.45ON5504457324e-89
Skud_15.1486.45ON5484417238e-88
SAKL0E01958g6.45ON5244277104e-86
CAGL0E02299g6.45ON5454527038e-85
NCAS0D020106.45ON5104566921e-83
Kpol_1035.506.45ON6014176972e-83
Kwal_56.225226.45ON5134326833e-82
KLTH0C10604g6.45ON5154316537e-78
KLLA0C05874g6.45ON5534464503e-48
ACL019C6.45ON5754383844e-39
Ecym_30486.45ON6704473602e-35
NCAS0C033108.317ON5701171322e-07
TPHA0C008508.317ON7811601252e-06
KLLA0E04071g8.317ON7041371224e-06
TBLA0I014902.545ON750801206e-06
KLTH0G12408g8.317ON603611206e-06
Kpol_1036.668.317ON6681241172e-05
TDEL0B063402.545ON762281144e-05
KAFR0B014602.545ON761281134e-05
TPHA0C042602.545ON757531127e-05
Suva_11.1892.545ON758281119e-05
Kpol_1052.193.279ON103371011e-04
SAKL0A09812g2.545ON751281101e-04
YKL034W (TUL1)2.545ON758281101e-04
Skud_11.1922.545ON758281101e-04
CAGL0L01947g2.545ON757281091e-04
Kwal_56.239008.317ON589911092e-04
Ecym_72412.545ON758281082e-04
KNAG0A070902.545ON762281082e-04
AFR275W2.545ON753281082e-04
KLLA0F25674g2.545ON757281072e-04
Kpol_1002.72.545ON754281073e-04
ZYRO0E05632g2.545ON765281073e-04
Smik_11.2132.545ON759281063e-04
NCAS0A047602.545ON761281064e-04
AER390W5.628ON316351034e-04
Kwal_26.80992.545ON750281046e-04
KLTH0D07216g2.545ON747281046e-04
Ecym_42508.317ON657371037e-04
Suva_2.3048.317ON624761038e-04
KAFR0B030708.317ON643321010.001
AGR034W3.279ON15944960.001
CAGL0E01441g8.317ON717301010.001
YDR143C (SAN1)8.317ON6101331000.002
Kwal_27.105463.279ON10486920.002
Ecym_13285.628ON32061980.002
ZYRO0C11176g5.628ON36838970.003
SAKL0G07370g5.628ON32135970.003
NDAI0K018102.545ON76225980.003
Smik_4.3878.317ON634142970.004
Skud_4.4028.317ON61238970.004
TBLA0A096405.628ON32529950.004
NDAI0H008405.628ON34135950.005
CAGL0M08690g5.628ON32829950.005
SAKL0H17116gsingletonON54437960.005
TPHA0A039903.279ON17528910.006
Ecym_54453.405ON32153940.006
SAKL0H15686g8.317ON59937950.006
CAGL0H10274g3.279ON17534900.008
YDR265W (PEX10)5.628ON33729930.008
KLTH0E02464g5.628ON32929930.008
Kpol_526.345.628ON32829930.008
KNAG0G023908.317ON68830940.009
Skud_4.5285.628ON33744920.010
KLLA0E16677g5.628ON30529910.013
NDAI0G026308.317ON66137920.015
Suva_2.4335.628ON33744910.016
TDEL0D034603.279ON14441860.017
Skud_2.1863.279ON17828880.017
NCAS0A04680singletonON27432890.019
Suva_4.3023.279ON15028860.019
KAFR0H005605.628ON32729900.020
KLTH0C05258g3.279ON15228860.020
YBR062C3.279ON18028870.024
Kwal_55.199995.628ON15229860.025
Smik_4.5165.628ON33729890.030
NDAI0A074503.279ON17345860.030
SAKL0C03586gsingletonON147437900.031
SAKL0C01760gsingletonON147437900.032
Smik_2.1963.279ON18528860.033
SAKL0A09526gna 1ON66236890.035
CAGL0B05049g1.389ON147027890.036
SAKL0D03058g3.279ON15534840.048
ZYRO0D05830g8.317ON78041880.050
CAGL0K02563g2.542ON58630870.054
TDEL0A049405.628ON32629850.069
TDEL0A03090na 1ON58636860.074
KNAG0J015605.628ON30973850.075
ABR104W3.405ON32843840.091
NCAS0C052905.628ON33029840.094
TDEL0F02870na 2ON260120840.100
Ecym_26583.279ON15944810.10
KAFR0A019902.542ON56030850.10
Kwal_26.8030na 1ON66036850.12
TPHA0A033403.405ON38441840.12
KNAG0I013801.389ON149326850.13
TBLA0C013301.389ON145229850.13
NDAI0B018202.542ON62563830.16
TBLA0G023102.542ON67426830.16
TDEL0F044408.317ON554119830.16
NDAI0E004408.808ON41635830.17
KLTH0D06886gna 1ON66436830.18
TBLA0I019603.279ON18434800.20
YOL138C (RTC1)3.22ON134125830.20
KNAG0C056602.542ON50730820.21
TPHA0C003505.628ON27829810.22
ZYRO0B02046gna 1ON44536820.22
TPHA0C042502.542ON55626820.23
ZYRO0E05192g1.389ON152027820.25
Kpol_480.228.808ON42536810.31
Kpol_1048.731.389ON154929810.31
Suva_15.223.22ON133625810.31
NCAS0B009908.808ON39250800.32
Skud_15.163.22ON133225810.33
Kpol_1002.82.542ON55826800.36
ZYRO0E06996g3.279ON17228770.36
Suva_8.422.542ON58526800.38
TBLA0B026708.808ON47836800.40
YHL010C (ETP1)2.542ON58526800.40
ZYRO0B02244g2.542ON56326800.41
CAGL0K08052g3.405ON30528790.42
TPHA0I005908.799ON159141800.44
Skud_8.352.542ON58526800.44
Smik_8.322.542ON58526800.45
TDEL0B061701.389ON147027800.46
KNAG0A012303.22ON132125800.47
NCAS0A125502.542ON57226790.48
KLTH0F11044g3.405ON29129780.49
KLTH0C04664g8.808ON30636780.49
KLLA0F18458g3.279ON14028750.49
KLLA0F25740g2.542ON51737790.49
TDEL0A031802.542ON56739790.50
SAKL0D02354g8.808ON33136780.54
YPR093C (ASR1)3.405ON28827780.55
KNAG0J008503.279ON16241760.56
TPHA0I005608.808ON39436780.61
SAKL0D08272g1.389ON149127790.63
KLTH0D07150g2.542ON54026780.65
KLLA0E18503gna 1ON65036780.67
NDAI0G038103.22ON139325790.68
KNAG0A012803.28ON11426730.69
NCAS0A087801.389ON150227780.70
NCAS0A082803.279ON11841730.72
KLLA0C15697g3.405ON30440770.78
SAKL0A09746g2.542ON54826770.81
Smik_15.163.22ON132625780.87
Kwal_27.104198.808ON30036760.88
NCAS0A113503.405ON42828770.89
KLLA0F12166g1.389ON152826780.89
TBLA0A039008.317ON69831770.93
KAFR0D016708.808ON35732760.98
NDAI0G052001.389ON158626770.99
Ecym_7253na 1ON61736761.1
ABL058C8.799ON154642771.2
NDAI0I004006.332ON48130761.3
KLTH0G18150g1.389ON155427761.3
Suva_10.3441.389ON156026761.3
TBLA0F032803.405ON55526761.3
ZYRO0C17424g3.405ON27328741.4
KLLA0C14344g8.799ON151837761.5
KAFR0F028406.332ON44530751.5
KLTH0E13992g8.799ON155040751.7
ZYRO0F12760g8.799ON155537751.7
YLR247C (IRC20)1.389ON155626751.7
YOL054W (PSH1)8.808ON40636741.8
AAL030C1.389ON153924751.8
Smik_15.1138.808ON40636741.9
KAFR0I020901.389ON146626752.0
Kwal_26.80902.542ON52026742.1
Skud_15.1028.808ON40636742.1
SAKL0A01474g6.332ON46832742.1
Kwal_27.123278.799ON157440742.2
Suva_15.1158.808ON41136732.3
KAFR0C004603.279ON15728712.3
SAKL0B08976g3.405ON32241732.4
KLTH0A06556g6.332ON46030732.7
Kwal_14.12871.389ON151827733.0
TPHA0B036501.389ON157626733.5
TBLA0I023606.332ON64430723.7
Suva_2.6345.579ON388105713.8
KLLA0C08756g6.332ON42724713.9
SAKL0C13332g3.22ON135325724.1
ZYRO0G13376g8.808ON44537714.3
KLLA0E20967g3.22ON132133724.4
Smik_12.3201.389ON155326714.8
KNAG0G032808.808ON35133704.8
TDEL0C030407.440ON100597714.9
Skud_12.3281.389ON155726715.4
KLLA0F15334g5.190ON194561706.3
NDAI0D02810na 2ON25274696.5
KNAG0I028806.332ON46130697.2
CAGL0J03586g6.332ON41130697.3
Smik_16.3333.405ON29027688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E02740
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   929   0.0  
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   336   e-108
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   325   e-104
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   316   e-101
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   295   3e-93
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   298   3e-93
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   296   8e-93
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   290   1e-90
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   290   1e-89
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   286   4e-89
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   283   8e-88
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   278   4e-86
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   275   8e-85
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   271   1e-83
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   273   2e-83
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   267   3e-82
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   256   7e-78
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   177   3e-48
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   152   4e-39
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   143   2e-35
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     55   2e-07
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    53   2e-06
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    52   4e-06
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    51   6e-06
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    51   6e-06
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    50   2e-05
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    49   4e-05
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    48   4e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    48   7e-05
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    47   9e-05
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    44   1e-04
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    47   1e-04
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    47   1e-04
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    47   1e-04
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    47   1e-04
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    47   2e-04
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    46   2e-04
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    46   2e-04
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    46   2e-04
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    46   2e-04
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    46   3e-04
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    46   3e-04
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    45   3e-04
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    45   4e-04
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    44   4e-04
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    45   6e-04
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    45   6e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    44   7e-04
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    44   8e-04
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    44   0.001
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    42   0.001
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    44   0.001
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    43   0.002
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    40   0.002
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    42   0.002
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    42   0.003
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    42   0.003
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    42   0.003
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    42   0.004
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    42   0.004
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    41   0.004
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    41   0.005
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    41   0.005
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    42   0.005
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    40   0.006
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    41   0.006
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    41   0.006
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    39   0.008
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    40   0.008
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    40   0.008
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    40   0.008
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    41   0.009
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    40   0.010
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    40   0.013
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     40   0.015
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    40   0.016
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    38   0.017
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    39   0.017
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      39   0.019
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    38   0.019
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    39   0.020
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    38   0.020
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    38   0.024
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    38   0.025
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    39   0.030
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    38   0.030
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    39   0.031
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    39   0.032
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    38   0.033
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    39   0.035
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    39   0.036
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    37   0.048
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    39   0.050
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    38   0.054
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    37   0.069
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               38   0.074
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    37   0.075
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    37   0.091
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    37   0.094
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      37   0.100
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    36   0.10 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.10 
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    37   0.12 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    37   0.12 
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    37   0.13 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    37   0.13 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     37   0.16 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.16 
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    37   0.16 
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    37   0.17 
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    37   0.18 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    35   0.20 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    37   0.20 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    36   0.21 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    36   0.22 
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    36   0.22 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.23 
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    36   0.25 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    36   0.31 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    36   0.31 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    36   0.31 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    35   0.32 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    36   0.33 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    35   0.36 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.36 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.38 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    35   0.40 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.40 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.41 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    35   0.42 
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    35   0.44 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.44 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.45 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    35   0.46 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    35   0.47 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    35   0.48 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    35   0.49 
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    35   0.49 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    33   0.49 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.49 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.50 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    35   0.54 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    35   0.55 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    34   0.56 
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    35   0.61 
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    35   0.63 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.65 
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    35   0.67 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    35   0.68 
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    33   0.69 
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    35   0.70 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    33   0.72 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    34   0.78 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.81 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    35   0.87 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    34   0.88 
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    34   0.89 
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    35   0.89 
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    34   0.93 
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    34   0.98 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    34   0.99 
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    34   1.1  
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    34   1.2  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    34   1.3  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    34   1.3  
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    34   1.3  
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    34   1.3  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    33   1.4  
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    34   1.5  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   1.5  
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    33   1.7  
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    33   1.7  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    33   1.7  
YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3 ub...    33   1.8  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    33   1.8  
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    33   1.9  
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   2.0  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    33   2.1  
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    33   2.1  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    33   2.1  
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    33   2.2  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    33   2.3  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   2.3  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   2.4  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    33   2.7  
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    33   3.0  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   3.5  
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    32   3.7  
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    32   3.8  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    32   3.9  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    32   4.1  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    32   4.3  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    32   4.4  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    32   4.8  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    32   4.8  
TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7....    32   4.9  
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    32   5.4  
KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa...    32   6.3  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      31   6.5  
KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {O...    31   7.2  
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    31   7.3  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    31   8.9  

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/556 (83%), Positives = 467/556 (83%)

Query: 1   MLVLNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLL 60
           MLVLNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLL
Sbjct: 1   MLVLNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLL 60

Query: 61  NIVLLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXX 120
           NIVLLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDI         
Sbjct: 61  NIVLLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLV 120

Query: 121 XKVSHWILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXX 180
            KVSHWILRDRLEGFLQRIND             RNLLIFGILDYFVTKIC         
Sbjct: 121 LKVSHWILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFY 180

Query: 181 XXXXXSNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSED 240
                SNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSED
Sbjct: 181 HHGDFSNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSED 240

Query: 241 ENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVN 300
           ENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVN
Sbjct: 241 ENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVN 300

Query: 301 NGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDD 360
           NGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDD
Sbjct: 301 NGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDD 360

Query: 361 EKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCP 420
           EKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCP
Sbjct: 361 EKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCP 420

Query: 421 ICRVPVFDKDGNVRPSIAKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           ICRVPVFDKDGNVRPSIAKT                                        
Sbjct: 421 ICRVPVFDKDGNVRPSIAKTRRSPPMSSSRSANRSRASPAPIPTPTLTPTPTQTQAQTQP 480

Query: 481 XXXXXXXXXXXXVQVSLMDIPNRTKSRFAIEKDTADDQERNITIRFRDLNDPSKSFKATV 540
                       VQVSLMDIPNRTKSRFAIEKDTADDQERNITIRFRDLNDPSKSFKATV
Sbjct: 481 QTTPTSTAPTLPVQVSLMDIPNRTKSRFAIEKDTADDQERNITIRFRDLNDPSKSFKATV 540

Query: 541 NVQRNPYLHEAAFTSS 556
           NVQRNPYLHEAAFTSS
Sbjct: 541 NVQRNPYLHEAAFTSS 556

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  336 bits (861), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 269/458 (58%), Gaps = 51/458 (11%)

Query: 6   LRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLL 65
           ++SRKQQ  +  ++IYLLT  T+  ++ +S TFL+ T  LTQG+N +I+A F+ LN+ LL
Sbjct: 3   VQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLL 62

Query: 66  WKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSH 125
           W+   +++FG+LRLIE EHIFER+P T+IN++ + S+ ++   F+           KV H
Sbjct: 63  WEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFH 122

Query: 126 WILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTK-------------ICX 172
           WIL+DRLE  LQ IND              NL IF +LD+++                  
Sbjct: 123 WILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNSTN 182

Query: 173 XXXXXXXXXXXXXSNITQ-------IMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQS 225
                        +N+T        ++FG+E+ V+F+DLIN+  HTVLNFY F+ +Q  +
Sbjct: 183 NNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRAT 242

Query: 226 ARFNLEMMNDDFSEDENDSGVNADG--GLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRF 283
           A  N+    D+ SE+E D   +     GLEGKF+YEKLID      +T +H  +LI  + 
Sbjct: 243 AHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKL 302

Query: 284 QSMLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLL-DHDNMCIVCMDDLV 342
           Q M++KD VWD   L  +  SLWKIYKNN+QL+ KLP +++ D+  D+DN+CIVCMDDLV
Sbjct: 303 QIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLV 362

Query: 343 LVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGH 402
              H  +                             VE TQ DID ++ SK+PKKLPCGH
Sbjct: 363 PSLHGKE----------------------------AVEMTQADIDSISKSKRPKKLPCGH 394

Query: 403 MLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPSIAKT 440
           MLH SCLKNWMERSQTCPICR+PVFD++GNV+P +  T
Sbjct: 395 MLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHTT 432

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/438 (39%), Positives = 249/438 (56%), Gaps = 41/438 (9%)

Query: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67
           +R++Q A   + +Y LT + V N+   S +FL+ T  LT G N VI+  F++LN  +LWK
Sbjct: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65

Query: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWI 127
             T ++FG+L L+E EHIFER+P T+IN + +SS+  ++  F +          KV HWI
Sbjct: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHWI 125

Query: 128 LRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXSN 187
           L+DRLE  LQ I++              NL++  ILDY +   C              S 
Sbjct: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGC---ITNSLSNSFGAST 182

Query: 188 ITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVN 247
              +M G+E+A++ IDL+N+  HTVLNFY F+RTQ+ +   +++   D   E+  D  VN
Sbjct: 183 SVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDEDVN 242

Query: 248 AD--GGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSL 305
                GLEGKF+YE++ID     L+T +H  MLIP R   +L+KD  WD+  L    +SL
Sbjct: 243 GSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSL 302

Query: 306 WKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTE 365
           W+I++NN+QL+ KL  ++  +L   DN+CIVCMD+L                        
Sbjct: 303 WRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELC----------------------- 339

Query: 366 KDKPSTTEEDLSEVEPTQG-DIDRMADSK--KPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
                    DL EV   QG D +++A +   KPK+LPCGH+LH  CLKNWMERSQTCPIC
Sbjct: 340 --------ADLEEV--VQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPIC 389

Query: 423 RVPVFDKDGNVRPSIAKT 440
           R+PVFD++GNV  S + T
Sbjct: 390 RLPVFDENGNVVQSQSST 407

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/433 (40%), Positives = 236/433 (54%), Gaps = 51/433 (11%)

Query: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67
           +RK+QF +  + +Y LT ++V NA   S +FL+    LT+G N VII  F  LN VLLWK
Sbjct: 6   TRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWK 65

Query: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWI 127
             T ++FG LRLIE EHIFER+P T+IN +++SS+ S+     +          KV HWI
Sbjct: 66  LSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHWI 125

Query: 128 LRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXSN 187
           LRDRLE  LQ I +              NL++  I DY +   C              S 
Sbjct: 126 LRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHC---VSNSLDNSFGASA 182

Query: 188 ITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVN 247
              +M G+E+A++ IDL+N   H  L FY F+++Q    R       +  ++DE+D+   
Sbjct: 183 SVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRR-------NAVNDDEDDTQF- 234

Query: 248 ADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSLWK 307
              GLEGKFIYE++ID     L+T LH  +L+P R   ML+KD +WD   L  N   LWK
Sbjct: 235 --SGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWK 292

Query: 308 IYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEKD 367
           I++NN+QL+ KLP ++ + L + DNMCI+CMD+L+    P +          DE +T   
Sbjct: 293 IWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELI----PEQ----------DEGHTRNT 338

Query: 368 KPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVF 427
           K                         KPK+LPCGH+LH  CLKNWMERSQTCPICR+ VF
Sbjct: 339 K------------------------NKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVF 374

Query: 428 DKDGNVRPSIAKT 440
           D+ GNV  S   T
Sbjct: 375 DEMGNVVQSTVPT 387

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  295 bits (756), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 177/434 (40%), Positives = 247/434 (56%), Gaps = 54/434 (12%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
           +SR  QF L  + IY+LT  +V  A  +S +FL+ T  LTQG N +II+ FS++N ++LW
Sbjct: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILW 64

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
           K   Y++FG+LRLIE EH+ ER+P TVIN++ +SS+ ++  +F            KVS+W
Sbjct: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNW 124

Query: 127 ILRDRLEGFLQRINDXXXX-XXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXX 185
           ILRDRLE  LQ +ND               NL++F ++DY +   C              
Sbjct: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSNIGSS 184

Query: 186 SNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEND-- 243
           +++  +M G+E+ ++ +DL NILCH++LN Y F+++ L S   +L       SEDE D  
Sbjct: 185 ASVYLLM-GMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLT------SEDEEDDE 237

Query: 244 SGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGN 303
           SG N   GLEGKFIYEK+ID     L+T +H  +LIP     ML KD V DL  L  N N
Sbjct: 238 SGFN---GLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNIN 294

Query: 304 SLWKIYKNNRQLNKKLPNIAIEDLLD-HDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEK 362
           ++WKI+ NNR+L+ +LP +    L    D +CI+CMDDL +         S+Q      K
Sbjct: 295 TIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSI--------NSIQ------K 340

Query: 363 NTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           N EK                          +KPK LPCGH+LH +CLKNWMERSQTCP+C
Sbjct: 341 NFEK--------------------------RKPKMLPCGHILHMNCLKNWMERSQTCPMC 374

Query: 423 RVPVFDKDGNVRPS 436
           R+PVF++ G V P+
Sbjct: 375 RLPVFNEKGEVLPT 388

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  298 bits (764), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 239/431 (55%), Gaps = 34/431 (7%)

Query: 8   SRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWK 67
           +RK Q AL+  VIY  T F    A  +S ++L+ T  LT+G+N +I+  F LLN+  +WK
Sbjct: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66

Query: 68  GFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDK-YMFDIXXXXXXXXXXKVSHW 126
           G  Y++F  LRLIE EHI ER+P T+IN  ++SS+ +++  +  I          KV+HW
Sbjct: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126

Query: 127 ILRDRLEGFLQRINDXXXXXXXX-XXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXX 185
           +L+DRLE  LQ +ND               NL +F ++DY +   C              
Sbjct: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQC---VTNSIKNSMGA 183

Query: 186 SNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSG 245
           S    ++ G+E+ ++ +DL+N+  HT LN Y FH++ ++    N+   ++D   D+ +  
Sbjct: 184 STSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS-IEDRNLNIVGEDEDGLVDDEEEF 242

Query: 246 VNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSL 305
                 LEGKF+YEK ID     L+T LH  M IP R + +L+KD +WD+  L  +  SL
Sbjct: 243 ----NELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSL 298

Query: 306 WKIYKNNRQLNKKLPNIAIEDLLDHDN-MCIVCMDDLVLVHHPTKRRQSVQEECDDEKNT 364
           WK ++N++QL++KLP +++E+L   DN MCIVCMD L+ +   +      +E+ +   N 
Sbjct: 299 WKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNA 358

Query: 365 EKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRV 424
                                   +   +KPKKLPC H+LH  CLKNWMERSQTCPICR+
Sbjct: 359 -----------------------AIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRL 395

Query: 425 PVFDKDGNVRP 435
            VFD +GN+ P
Sbjct: 396 SVFDSNGNILP 406

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  296 bits (757), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 252/446 (56%), Gaps = 58/446 (13%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
            +R++Q A+ VVV YLLT + V +A   S +FL+ T  L +G N ++++ F LLN  LLW
Sbjct: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
           +  T ++FG+LRLIE EHIFER+P T+IN + +SSL  ++Y F +          KV HW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 127 ILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXS 186
           IL+DRLE  LQ IND              NL++  ++DY +   C              +
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIEST 183

Query: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSE------D 240
           ++  I   +E+ ++ IDL+N+   T LNF+ F+R+Q   +  N  +++ D ++      D
Sbjct: 184 SLYLIQV-MEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESD 242

Query: 241 ENDSGVNAD----------GGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKD 290
           ++   +N D           GLEGKF+YEK ID     L+T LH +MLIP R   ML+KD
Sbjct: 243 QSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 302

Query: 291 FVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHP 347
            VWD+  L  +G SLWKI++NN+QL+  L  + +E L    + DN+CI+CMD+  L+H P
Sbjct: 303 VVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDE--LIHSP 360

Query: 348 TKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFS 407
            ++             T K+K                       +KKPK+LPCGH+LH S
Sbjct: 361 NQQ-------------TWKNK-----------------------NKKPKRLPCGHILHLS 384

Query: 408 CLKNWMERSQTCPICRVPVFDKDGNV 433
           CLKNWMERSQTCPICR+PVFD+ GNV
Sbjct: 385 CLKNWMERSQTCPICRLPVFDEKGNV 410

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  290 bits (742), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 246/445 (55%), Gaps = 57/445 (12%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
            +R++Q  + +V+ YLLT + V +A   S +FL+ T  L +G N ++++ F LLN  LLW
Sbjct: 4   ENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLW 63

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
              T ++FG+LRLIE EHIFER+P T+IN + +SS+  ++Y F +          KV HW
Sbjct: 64  HLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 127 ILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXS 186
           IL+DRLE  LQ IND              NL++   LDY +   C              +
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDIVST 183

Query: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSE------D 240
           ++  +M  +E+ ++ IDL+N+   T LNF+ F+R+Q   +     +++DD S+      D
Sbjct: 184 SL-YLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDFD 242

Query: 241 ENDSGVNAD---------GGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDF 291
            +   +N D          GLEGKF+YEK ID     L+T LH +MLIP R   ML+KD 
Sbjct: 243 GSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 302

Query: 292 VWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHPT 348
           +WD+  L  +   LWKI++NN+QL+  L  + +E L    + DN+CI+CMD+L+   H T
Sbjct: 303 IWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELI---HST 359

Query: 349 KRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSC 408
            ++            T K+K                       +KKPK+LPCGH+LH SC
Sbjct: 360 NQQ------------TWKNK-----------------------NKKPKRLPCGHILHLSC 384

Query: 409 LKNWMERSQTCPICRVPVFDKDGNV 433
           LKNWMERSQTCPICR+PVFD  GNV
Sbjct: 385 LKNWMERSQTCPICRLPVFDDKGNV 409

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 171/474 (36%), Positives = 252/474 (53%), Gaps = 67/474 (14%)

Query: 6   LRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLL 65
           L S+K QF +  + +YL+T FT+INA  +S +FL     L +G N +II  F LLN +L 
Sbjct: 8   LNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLS 67

Query: 66  WKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSH 125
           WK  T+ +F DLRLIE+EHI ER+P TVIN I+++++ ++++ F +          +V H
Sbjct: 68  WKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYH 127

Query: 126 WILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXX------------ 173
           WIL+DRLE  +Q IND              NL+   +++  + + C              
Sbjct: 128 WILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQN 187

Query: 174 -------------XXXXXXXXXXXXSNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHR 220
                                    SN   +M G+E++++ ++  N+L H++L+ + F++
Sbjct: 188 LFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYK 247

Query: 221 TQLQSARFNLEMMNDDFSE------DENDSGVNAD--------------GGLEGKFIYEK 260
           ++  S +      N+  +       DEN+  +  D               GLEGKFIYEK
Sbjct: 248 SKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEK 307

Query: 261 LIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLP 320
           +ID     L T +H ++L+PL    +LVKD +WD F+L  N  SL+KI+KNN++L   LP
Sbjct: 308 IIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALP 367

Query: 321 NIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVE 380
           N+  +DL   DN+CI+CMDDL+    P+       E  +   N            +S   
Sbjct: 368 NMTPDDLQHSDNVCIICMDDLL----PS------LETLEHATN------------VSSTT 405

Query: 381 PTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           P+      +   KKPKKLPCGH LHFSCLKNWMERSQTCPICR+ VFDK+GNV+
Sbjct: 406 PSSNHYLNIKKKKKPKKLPCGHFLHFSCLKNWMERSQTCPICRLDVFDKNGNVK 459

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  286 bits (732), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 242/445 (54%), Gaps = 58/445 (13%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
            +R++Q    +VV YLLT + V +A   S +FL+ T  L +G N ++++ F LLN  LLW
Sbjct: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
           +  T ++FG+LRLIE EHIFER+P T+IN + +SS+  ++Y F +          KV HW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 127 ILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXS 186
           I++DRLE  LQ IND              NL +  + DY +   C              +
Sbjct: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVST 183

Query: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEN--DS 244
           ++  +M  +E+ ++ IDL+N+   T LNF+ F+ +Q   +  N  ++ D+  EDEN  DS
Sbjct: 184 SL-YLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEV-EDENEVDS 241

Query: 245 G-------------VNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDF 291
           G                  GLEGKF+YEK ID     L+T LH +MLIP R   ML+KD 
Sbjct: 242 GEPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 301

Query: 292 VWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHPT 348
           VWD+  L  +  +LWKI++NN+QL+  L  + IE +    + DN+CI+CMD+L+      
Sbjct: 302 VWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELI------ 355

Query: 349 KRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSC 408
               S  ++    KN                             KKPK+LPCGH+LH SC
Sbjct: 356 ---HSANQQAWKNKN-----------------------------KKPKRLPCGHILHLSC 383

Query: 409 LKNWMERSQTCPICRVPVFDKDGNV 433
           LKNWMERSQTCPICR+PVFD+ GNV
Sbjct: 384 LKNWMERSQTCPICRLPVFDEKGNV 408

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  283 bits (723), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 168/441 (38%), Positives = 244/441 (55%), Gaps = 53/441 (12%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
            +R++Q  + +VV YLLT + V +A   S +FL+ T  L +G N ++++ F LLN  LLW
Sbjct: 4   ENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
           +  T ++FG+LRLIE EHIFER+P T+IN + +SS+  ++Y F +          KV HW
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 127 ILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXS 186
           IL+DRLE  LQ IND              NL++  ++D+ +   C              +
Sbjct: 124 ILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDIIST 183

Query: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSE----DEN 242
           ++  +M  +E+ ++ IDL+N+   T LNF+ F+R+Q   +  +  +++DD       +E 
Sbjct: 184 SL-YLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEEA 242

Query: 243 DSGVNAD-------GGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDL 295
            + +N D        GLEGKF+YEK ID     L+T LH +MLIP R   ML+KD VWD+
Sbjct: 243 HAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWDV 302

Query: 296 FNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHPTKRRQ 352
             L  +G SLWKI++NN+QL+  L  +  E L    + DN+CI+CMD+L+          
Sbjct: 303 LALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELM---------- 352

Query: 353 SVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNW 412
                                        +Q D      +KKPK+LPCGH+LH SCLKNW
Sbjct: 353 ----------------------------HSQADQTWKNKNKKPKRLPCGHILHLSCLKNW 384

Query: 413 MERSQTCPICRVPVFDKDGNV 433
           MERSQTCPICR+ VFD+ GNV
Sbjct: 385 MERSQTCPICRLSVFDEKGNV 405

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  278 bits (710), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/427 (37%), Positives = 232/427 (54%), Gaps = 61/427 (14%)

Query: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66
           ++R+ QF +  V  Y    ++V ++  +S TFL+ T  L +GVN +I+  F LLN VLLW
Sbjct: 5   QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 64

Query: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHW 126
           K  T ++FG+LRLIE EH+FER+  T++N I +SS+  ++    +          KV HW
Sbjct: 65  KLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 124

Query: 127 ILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXS 186
           IL+DRLE   Q  N+              NLL    +DY + + C              S
Sbjct: 125 ILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYC---LSNSISNDQWTS 181

Query: 187 NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGV 246
           +   +MFG+++A++ +D ++I  H V+NF   +R Q  ++ ++ E +             
Sbjct: 182 SSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFL------------- 228

Query: 247 NADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGNSLW 306
               GLEGKF+YEKLID  A +L+  LH  +LIP R   M++KD +WD  +L     SLW
Sbjct: 229 ----GLEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLW 284

Query: 307 KIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEK 366
           K +KN ++L++KLP++  E+L   +NMCIVCMDD++                    N+E 
Sbjct: 285 KTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDML-------------------PNSE- 324

Query: 367 DKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPV 426
               T   +L                 KPKKLPCGH+LH SCLK+WMERSQTCPICR+PV
Sbjct: 325 ----TRNANL-----------------KPKKLPCGHILHLSCLKSWMERSQTCPICRLPV 363

Query: 427 FDKDGNV 433
           FD+ GNV
Sbjct: 364 FDERGNV 370

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  275 bits (703), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 175/452 (38%), Positives = 241/452 (53%), Gaps = 63/452 (13%)

Query: 9   RKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWKG 68
            K++F +   + Y+LT + VI+A  +S +FL+    L++G N +II  F+LLN  LLW+ 
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 69  FTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWIL 128
            T M+FG+LR+IE EHIFER+P  VIN I + S  ++KY F +          KV HWIL
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 129 RDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXX--- 185
           RDRL+  LQ IN+              NLL+  ++D +V   C                 
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 186 -------SNITQ-----IMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMM 233
                  S +TQ     IM  +E+  + IDL+N++ +T L FY FH ++  S   N    
Sbjct: 186 SIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQ--NNPTF 243

Query: 234 NDDFSED---ENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKD 290
           N   +ED   E++ G +   GLEGKF+YEKLID V   L+T +H  M + L    MLVKD
Sbjct: 244 NSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKD 303

Query: 291 FVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDL---LDHDNMCIVCMDDLVLVHHP 347
              D++ L  N  SL  I+KN++QL+ KLP +  +DL    + DN+CIVCMD+LV     
Sbjct: 304 IFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELV----- 358

Query: 348 TKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFS 407
                                             ++      +D KKPKKLPCGH+LH S
Sbjct: 359 ----------------------------------SENPHHHQSDGKKPKKLPCGHVLHLS 384

Query: 408 CLKNWMERSQTCPICRVPVFDKDGNV-RPSIA 438
           CLKNWMERSQTCPICR+PVFD++G +  PS A
Sbjct: 385 CLKNWMERSQTCPICRLPVFDENGEILAPSSA 416

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  271 bits (692), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/456 (34%), Positives = 231/456 (50%), Gaps = 71/456 (15%)

Query: 6   LRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLL 65
           L++R+ Q      +IY+LT   +IN+   S +FL  +  L QG N +II  F LLN +LL
Sbjct: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLL 61

Query: 66  WKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSH 125
           WK   +++F +LRLIE+EHI ER+P T+IN I IS++ ++K+   +          K+ +
Sbjct: 62  WKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121

Query: 126 WILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXX 185
           WIL+DRLE FL + N               NL+I   ++  + K C              
Sbjct: 122 WILKDRLE-FLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 186 S-------------------------NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHR 220
           S                         N   +M  +E+A++ I+ IN+  H++L+ Y  ++
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 221 TQLQSARFNLEMMNDDFSEDENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIP 280
           +  Q  + N  + + +   D++D       GLE KFIYEK+ID     L T +H ++ +P
Sbjct: 241 SN-QYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALP 299

Query: 281 LRFQSMLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDD 340
           L    +++KD +WDL +L  N   L++I KNN+ L+ KLP++  EDL D DN+CIVCMDD
Sbjct: 300 LNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDD 359

Query: 341 LVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPC 400
           L+   H                                              KK K+LPC
Sbjct: 360 LLSEEH--------------------------------------------KKKKAKRLPC 375

Query: 401 GHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
           GH LH SCLKNWMERSQTCPICR+PVFD+ GNV+ S
Sbjct: 376 GHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 162/417 (38%), Positives = 238/417 (57%), Gaps = 37/417 (8%)

Query: 24  TAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWKGFTYMVFGDLRLIEEE 83
           T  ++  A  +S ++L+ T  L+QG N +++  F++LN   +W+ F ++ FG+LRLIE E
Sbjct: 24  TFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYE 83

Query: 84  HIFERIPLTVINLIMISSLLSDKYM-FDIXXXXXXXXXXKVSHWILRDRLEGFLQRINDX 142
           H+ ER+P T++N+++  S+ +DK + F            KV HWILRDRL+  +Q  ND 
Sbjct: 84  HVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDS 143

Query: 143 XXXXXXXXXXXX-RNLLIFGILDYFVTKICXXXXXXXXXXXXXXSNITQIMFGLEYAVVF 201
                         NL+IF I+DY +   C              S    ++ G+E+ ++ 
Sbjct: 144 STLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGA---STTVHLLLGMEFTMLL 200

Query: 202 IDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVNADGGLEGKFIYEKL 261
           IDL+N+  HT LN Y FH T L+ +  N+   + +  E++++   N+   LEGKF+YEK 
Sbjct: 201 IDLLNLFLHTCLNLYEFHLTTLERSS-NIIQEDGEDDEEDDELQFNS---LEGKFMYEKT 256

Query: 262 IDFVAGVLRTGLHFTMLIPLRFQS-MLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLP 320
           ID     L+T +H  MLIPLR +  +L+KD +W++ +L  +  SLWK +KNN+QL+ KLP
Sbjct: 257 IDVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLP 316

Query: 321 NIAIEDLLDHDN-MCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEV 379
             +IE+L + DN +CIVCMDDL+                    N+EK      +E    +
Sbjct: 317 TASIEELKNTDNNICIVCMDDLL-----------------PRINSEKYDSQREKELYDHI 359

Query: 380 EPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
                    M   +KPKKLPCGH+LH +CLKNWMERSQTCPICR+PVFD  GNV PS
Sbjct: 360 ---------MKSKQKPKKLPCGHILHLNCLKNWMERSQTCPICRLPVFDDKGNVMPS 407

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  267 bits (683), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 224/432 (51%), Gaps = 60/432 (13%)

Query: 4   LNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIV 63
           + +R +++QFA  V   Y   A+ +I     S +FLE +  L +G+N +++  F+ +N V
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 64  LLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKV 123
           LLWK  T+++FG+LRL+E EHIFER+  T++N   +SS  S+     +          KV
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 124 SHWILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXX 183
            HW+LRDRLE   Q  ++              N+ + G LD+ +TK C            
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 184 XXSNIT-QIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEN 242
             S+++  +MF +E+A++ +D+  +   +++N    ++ +   AR       +D++    
Sbjct: 181 YSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFAR-----DGEDYT---- 231

Query: 243 DSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNG 302
                   GLEGKF+YEK++  +  + R GLH  +++P     M+ KD +WD F + +  
Sbjct: 232 --------GLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTA 283

Query: 303 NSLWKIYKNNRQLNKKLPNIAIEDLLDHDN-MCIVCMDDLVLVHHPTKRRQSVQEECDDE 361
            SL   +K+NRQ+++KLP+++   L   D+ MCIVCMDD++              EC + 
Sbjct: 284 KSLLLTWKSNRQIDEKLPDVSEAQLAASDDKMCIVCMDDML-----------APSECTNA 332

Query: 362 KNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPI 421
           K                              +KPK+LPC H LH  CLK+WMERSQTCPI
Sbjct: 333 K------------------------------QKPKRLPCNHCLHLGCLKSWMERSQTCPI 362

Query: 422 CRVPVFDKDGNV 433
           CRVPVFDK GNV
Sbjct: 363 CRVPVFDKKGNV 374

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  256 bits (653), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 214/431 (49%), Gaps = 60/431 (13%)

Query: 4   LNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIV 63
           + LR +++QF    V  Y   A++V++    S +FL+    L +G+N V++  F+++N +
Sbjct: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60

Query: 64  LLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKV 123
           LLWKG T ++FG+LRL+E EHIFER+  T++N   +SS   +     +          +V
Sbjct: 61  LLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120

Query: 124 SHWILRDRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXX 183
            HW+L+DRLE   Q  ++              N++IF ++DY + + C            
Sbjct: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPS 180

Query: 184 XXSNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEND 243
             + +  I+F ++++++ +D+  +   +V+N       +L   +   E   DDF      
Sbjct: 181 PSAPV-YILFCVDFSMLLVDVAEVAMKSVINL-----IELIQCKRAFERDGDDFV----- 229

Query: 244 SGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGN 303
                  GL+GKF+YEKL+  V  VL+ GL    L P     M+ KD +WD   L + G 
Sbjct: 230 -------GLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGK 282

Query: 304 SLWKIYKNNRQLNKKLPNIAIEDL-LDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEK 362
           S+W+ +K+NRQ+++KLP++    L    D MCIVCM+D++     T  +           
Sbjct: 283 SVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKH---------- 332

Query: 363 NTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
                                          KPKKLPC H LH  CLK+WMERSQTCPIC
Sbjct: 333 -------------------------------KPKKLPCNHCLHLGCLKSWMERSQTCPIC 361

Query: 423 RVPVFDKDGNV 433
           RV VFD  GNV
Sbjct: 362 RVSVFDSKGNV 372

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  177 bits (450), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 131/446 (29%), Positives = 206/446 (46%), Gaps = 77/446 (17%)

Query: 11  QQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWKGFT 70
           Q+F    ++ Y   A+++      S ++L   T +T+G++ +I     LLN VL+ KG  
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 71  YMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWILRD 130
           +M+FG LRLIE EHI ERI  TVI L++  S + +  +  +          +  HWIL+D
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVITLLLSCSSM-NGLISVMQIHCVLFVCCRTLHWILKD 142

Query: 131 RLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILD-----YFVTKICXXXXXXXXXXXXXX 185
           R+E   Q  +               NLL+   +D     Y+V KI               
Sbjct: 143 RMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNI--------- 193

Query: 186 SNITQIMFGL-EYAVVFIDLINILCHTVLNFYAFHRTQLQS-ARFNLEMMNDD--FSEDE 241
            ++T  +F + +YA++  DL+ ++  T LN +     Q ++  R N +   D+   + +E
Sbjct: 194 -DVTYTLFIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEE 252

Query: 242 NDSGV---------NADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFV 292
             + V           + GLEGKFIYEKLID     ++  + F          +++   +
Sbjct: 253 RPNAVAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFAS--SFSTGRVMMVTVL 310

Query: 293 WDLFNLVNNGNSLWKIYKNNRQLNKKL---PNIAIEDLLDHDNMCIVCMDDLVLVHHPTK 349
           W+      +   LWK +K+++ L+  L    +I IE      ++CIVCM+D +    P+ 
Sbjct: 311 WEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIES--GEIDICIVCMEDFL----PSH 364

Query: 350 RRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCL 409
           +R+S                                     D KK K LPC H LH SCL
Sbjct: 365 QRKS-------------------------------------DGKKVKILPCTHALHLSCL 387

Query: 410 KNWMERSQTCPICRVPVFDKDGNVRP 435
           KNW+ RS TCPICR+P+FD++GNV P
Sbjct: 388 KNWIARSPTCPICRLPIFDENGNVMP 413

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  152 bits (384), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 115/438 (26%), Positives = 185/438 (42%), Gaps = 88/438 (20%)

Query: 13  FALLVVVIYLLTAFTVINAFGNSHTFLEWTTGL---TQGVNYVIIAAFSLLNIVLLWKGF 69
           +A+ +   Y L  ++   A+  + +F +  + L   + GV++VI   F +++  L     
Sbjct: 10  WAMFITATYALAGWS---AYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAI 66

Query: 70  TYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWILR 129
             ++FG L  IE +HIFER+ + ++ L  I   +   YM              V+HW+LR
Sbjct: 67  IRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAG-HMTILFYTLCLVAHWVLR 125

Query: 130 DRLEGFLQRINDXXXXXXXXXXXXXRNLLIFGILDYFVTKICXXXXXXXXXXXXXXSNIT 189
           DR++   Q                  +LL+ G++DY + K C                  
Sbjct: 126 DRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHELY---- 181

Query: 190 QIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDSGVNAD 249
            +M  L +A + +D+++++  T LN +   R                 S     + +  +
Sbjct: 182 -LMLALSFAQLILDVLHVVLLTSLNLFEMVR-----------------SRRTRSANLVYE 223

Query: 250 GG------------LEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFN 297
           GG            LEGK+IYE + D    VL+  L     + + +   +V         
Sbjct: 224 GGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSI---FVR 280

Query: 298 LVNNGNSLWKIY---KNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSV 354
            +  G S   +Y   KNN++L +KL +++ E L D D+MCI+CMDD++     TK     
Sbjct: 281 SIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKM---- 336

Query: 355 QEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWME 414
                                                +++ K LPCGHMLHF CLK+WME
Sbjct: 337 -------------------------------------NRRAKMLPCGHMLHFGCLKSWME 359

Query: 415 RSQTCPICRVPVFDKDGN 432
           RSQTCPICR+ VF  D N
Sbjct: 360 RSQTCPICRLSVFANDSN 377

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 195/447 (43%), Gaps = 83/447 (18%)

Query: 16  LVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWKGFTYMVFG 75
            + V Y L A+++ N    S +FL+     T GV+ +I   F L++  +       M+FG
Sbjct: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72

Query: 76  DLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIXXXXXXXXXXKVSHWILRDRLE-G 134
            L L+E EHIFER+ LTV++ + +   +  K               +V HW++RDR+E  
Sbjct: 73  RLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFV 132

Query: 135 FLQRINDXXXXXXXXXXXXXRNLLIFGILD-----YFVTKICXXXXXXXXXXXXXXSNIT 189
           F   I                ++++ G++D     YF  +                   T
Sbjct: 133 FAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNT 192

Query: 190 -----QIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDS 244
                 +  G+++ ++F+D + ++    L F        ++ R   E    D +E END 
Sbjct: 193 SEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVEL----FKAGRRVQEHQLLDNNELEND- 247

Query: 245 GVNADGG--LEGKFIYEKLIDFVAGVLR---------TGLH-FTMLIPLRFQSMLVKDFV 292
            +  DG   LE KFIYEK+++ V  +L+         +G+H F +   +  +S+   +  
Sbjct: 248 -IEDDGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERC 306

Query: 293 WDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQ 352
             LFN           +KNNR+L++KL ++    L   D  C +CMDD++    P+K   
Sbjct: 307 VLLFNY----------WKNNRRLHEKLLDVTAGHLDGVDITCTICMDDML----PSK--- 349

Query: 353 SVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNW 412
                                             D   ++KK K LPCGHMLHF CLK+W
Sbjct: 350 ----------------------------------DVKVNNKKAKMLPCGHMLHFGCLKSW 375

Query: 413 MERSQTCPICRVPVFDKDGNVRPSIAK 439
           M+R+QTCPICR PVF   G+  P   +
Sbjct: 376 MQRAQTCPICRFPVF---GSSNPRAGQ 399

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 10/117 (8%)

Query: 317 KKLPNIAIEDLLDH--DNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEK---DKPST 371
           +KLP + ++DL  +  D  C +C +  V     TK+R     + ++  N +K   D  + 
Sbjct: 142 EKLPVLTLDDLKKNGSDLQCSICFEPYVADATTTKKRSLSGTDSEEPGNAKKRKIDATTA 201

Query: 372 TEEDLSEVEPTQG--DIDRMAD---SKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           +    +E EPT    D D  A    +  P KLPCGH+    CL  W +   TCP+CR
Sbjct: 202 STPTSNEPEPTTTVEDNDEEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 67/160 (41%), Gaps = 44/160 (27%)

Query: 317 KKLPNIAIEDLL-DHDNMCIVCMDDLVLVHH-----PTKRRQSVQEECD--DEK------ 362
           + LP + + D++ ++D  C +C DDLV           KR+ SV EE D  D+K      
Sbjct: 163 ETLPVLKLSDIVNENDKTCSICYDDLVDEDQVEEGADNKRKYSVDEEDDIKDQKKVKTGP 222

Query: 363 NTEKDKP----------STTEEDLSEVE-----PTQG--DIDRMADSK----KPKKLPCG 401
           N  +++P          ST+ ++ +E E     P  G   I    DS      P +LPC 
Sbjct: 223 NNNRERPTEQLLDAVRSSTSAQNNTESETQTSRPASGVDTIQSEEDSPTYLHSPTELPCK 282

Query: 402 HMLHFSCLKNWMERSQTCPICR---------VPVFDKDGN 432
           H+    CL  W     TCP+CR          P    DGN
Sbjct: 283 HIFGRECLYKWTRVQNTCPLCRHIIAESPVNAPPNAPDGN 322

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 48/137 (35%), Gaps = 35/137 (25%)

Query: 326 DLLDHDNMCIVCMDDLV-------------------LVHHPTKRRQSVQE---------- 356
           D LD +  C +C DDL+                       P  +RQ  +E          
Sbjct: 116 DTLD-EKTCAICYDDLINDPKDFASTSSKRGREEIGSAESPNSKRQRNEEAAPLPHQEGL 174

Query: 357 ---ECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWM 413
              E D   + E   P ++     E E  Q D      S     LPCGH+    CL  W 
Sbjct: 175 PENESDQRVDNELPDPESSAHHTGEQEGGQEDTPTYGHSAT--VLPCGHVFGRECLYKWT 232

Query: 414 ERSQTCPICRVPVFDKD 430
               +CPICR P+  ++
Sbjct: 233 TEHNSCPICRAPILSEE 249

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 349 KRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKL--PCGHMLHF 406
           +  +SV  E   E  T K+        +SEV     DI+   +  K   +  PC H+ H 
Sbjct: 668 QYHKSVSNELLLEHGTNKNHTVDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHT 727

Query: 407 SCLKNWMERSQTCPICRVPV 426
           +CL+NWM     CP+CR P+
Sbjct: 728 TCLENWMSYKLQCPVCRAPL 747

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%)

Query: 371 TTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKD 430
           +T E   E E    + + +A    P KLPCGH+    C++ W     TCPICR  +   D
Sbjct: 202 STSEPPKENEADTNNQESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGAD 261

Query: 431 G 431
           G
Sbjct: 262 G 262

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 47/124 (37%), Gaps = 28/124 (22%)

Query: 328 LDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEK------------NTEKDKPSTTEED 375
            D D  C VC D+ V    P  +R+   +  +DE+            ++E + P   E +
Sbjct: 164 ADADKTCGVCYDEFVDEPVPGAKRERETDNKEDEEEEGSGNVKRAKVSSENEGPQPNEGE 223

Query: 376 LSEVE--PTQGDIDRMADS--------------KKPKKLPCGHMLHFSCLKNWMERSQTC 419
             + E  P QG       +              + P +LPC H+    CL  W     TC
Sbjct: 224 TRQTENGPNQGTTSTQNSNTLPNQEESNEPVYLESPVELPCHHIFGRECLYKWTRHENTC 283

Query: 420 PICR 423
           P+CR
Sbjct: 284 PLCR 287

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PCGH+ H  CL+NWM     CP+CR P+
Sbjct: 732 PCGHVFHTQCLENWMSYKLQCPVCRSPL 759

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H SCL+NWM     CP+CR P+
Sbjct: 731 PCNHIFHTSCLENWMSYKLQCPVCRAPL 758

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 376 LSEVEPTQGDIDR--MADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICRVPV 426
           +SEV     DI      D +     PC H+ H +CL+NWM     CP+CR P+
Sbjct: 702 MSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLENWMGYKLQCPVCRAPL 754

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H SCL+NWM     CP+CR P+
Sbjct: 728 PCNHVFHTSCLENWMSYKLQCPVCRSPL 755

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 3/37 (8%)

Query: 390 ADSKKP--KKLP-CGHMLHFSCLKNWMERSQTCPICR 423
           AD K P   KLP CGH   + CL  W+ +++TCP+CR
Sbjct: 42  ADDKYPLISKLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PCGH+ H  CL++WM     CP+CR P+
Sbjct: 721 PCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H SCL+NWM     CP+CR P+
Sbjct: 728 PCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H SCL+NWM     CP+CR P+
Sbjct: 728 PCDHVFHTSCLENWMSYKLQCPVCRSPL 755

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC HM H SCL++WM     CP+CR P+
Sbjct: 727 PCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 346 HPTKRR-QSVQEECDDEKNTEKDKPSTT----EEDLSEVEPTQGDIDRMADSKKPKKLPC 400
           HP + R +  + E DD+     D  + +    +E   + E +  D  ++     P +LPC
Sbjct: 168 HPKRTRYEQDESEVDDQNGPANDGETASSPPEQEQPKDNENSGDDQGKVTYKHSPVQLPC 227

Query: 401 GHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431
            H+    C++ W     TCPICR  +   DG
Sbjct: 228 SHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 728 PCAHVFHTECLENWMSYKLQCPVCRAPL 755

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 732 PCNHIFHTECLENWMSYKLQCPVCRTPL 759

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 723 PCSHLFHTGCLENWMSYKLQCPVCRAPL 750

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 727 PCSHIFHTECLENWMSYKLQCPVCRAPL 754

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 724 PCNHVFHTQCLENWMGYKLQCPVCRAPL 751

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 735 PCAHIFHTQCLENWMSYKLQCPVCRSPL 762

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 729 PCNHVFHTPCLENWMSYKLQCPVCRSPL 756

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL+NWM     CP+CR P+
Sbjct: 731 PCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 389 MADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           +AD   P  LPCGHM  ++C+  W      CP+CR
Sbjct: 270 LADMTDPSCLPCGHMFCWACVMQWCNERNECPLCR 304

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL++WM     CP+CR P+
Sbjct: 720 PCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPV 426
           PC H+ H  CL++WM     CP+CR P+
Sbjct: 717 PCSHIFHTQCLESWMSYKLQCPVCRAPL 744

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431
           P +LPCGH+    C+  W +   +CPICR  + + +G
Sbjct: 276 PTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 358 CDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKK--PKKLPCGHMLHFSCLKNWMER 415
            D++ N+    P+ +   L   +P   + +    S K  P +LPCGH+    CL  W   
Sbjct: 231 SDNDSNSNATTPNPSSTPLESNQPHTANDEETNPSYKHSPIRLPCGHVFGRECLYKWSRL 290

Query: 416 SQTCPICRVPVFDKDG 431
             +CP+CR  + +  G
Sbjct: 291 ENSCPLCRHKISESAG 306

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 392 SKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           S  P KLPCGH+    CL  W +   TCP+CR
Sbjct: 296 SHSPLKLPCGHIFGRECLFKWSKVENTCPLCR 327

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPSIAK 439
           +LP CGH     C+  W+ RS TCP+CR  V  +   +  S A+
Sbjct: 107 ELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVLVRKPEIDGSAAE 150

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 394 KPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
            P K+PCGH+   SCL  W     +CP+CR
Sbjct: 289 SPVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 52/133 (39%), Gaps = 27/133 (20%)

Query: 318 KLPNIAIEDLLDHDN-MCIVCMD---DLVLVHHPTKRRQSVQEECDDEKNTEKDK----- 368
           KLP + + DL   +  +C +C D   D V      ++R S  EE  +     KD      
Sbjct: 148 KLPVLQVSDLPKAEGPLCSICYDEYEDEVDSTKAKRKRDSENEEESEGTKKRKDNEGAPL 207

Query: 369 ---------PSTTEE--------DLSEVEPTQGDIDRMADSK-KPKKLPCGHMLHFSCLK 410
                    PS T           L+E + T  D +     K  P KLPCGH+    C+ 
Sbjct: 208 RTTADNDSNPSITNATVVEPPSIPLTEQQRTLNDEETNPSYKHSPIKLPCGHIFGRECIY 267

Query: 411 NWMERSQTCPICR 423
            W     +CP+CR
Sbjct: 268 KWSRLENSCPLCR 280

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 36/86 (41%), Gaps = 7/86 (8%)

Query: 352 QSVQEECDDEKNTEKDK-PSTTEEDLSEVEPTQGDIDRMADSKKP--KKLP-CGHMLHFS 407
           Q  QE C D   T  D  P   +  L + E          D K P   +LP C H     
Sbjct: 7   QEKQEGCPD---TYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLE 63

Query: 408 CLKNWMERSQTCPICRVPVFDKDGNV 433
           C+  W+ +S+TCP+CR  V     NV
Sbjct: 64  CVAVWLSKSRTCPLCRDDVLSHKPNV 89

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 370 STTEEDLSEV-------EPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           STT  DLS         E ++  I  + D   P  LPCGH+  ++C+ +W      CP+C
Sbjct: 248 STTHIDLSNPKCLPLIPEHSRSCILCLVDMVDPSCLPCGHLFCWNCIMHWCTERSECPLC 307

Query: 423 R 423
           R
Sbjct: 308 R 308

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 386 IDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           ++ M D   P   PCGH+  ++C+ NW +  + CP+CR
Sbjct: 322 LNEMTDPSCP---PCGHLFCWACIMNWCKEREECPLCR 356

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 389 MADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           + + K P   PCGH+  ++C+ NW +    CP+CR
Sbjct: 275 LTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCR 309

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICR 423
           PC H+ H  CL+NWM     CP+CR
Sbjct: 732 PCNHIFHTECLENWMGYKLQCPVCR 756

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 28/142 (19%)

Query: 318 KLPNIAIEDLLDHDN-MCIVCMDDLVLVH--HPTKRRQSVQEECDDE------------- 361
           KLP + I DL   +  +C +C D+    +    TKR +  ++E + E             
Sbjct: 157 KLPVLKISDLPTSEGPLCSICYDEYEEENDISKTKREREFEDEGESEGIKKRKDNGGAPI 216

Query: 362 -KNTEKDKPSTTEED----------LSEVEPTQGDIDRMADSK-KPKKLPCGHMLHFSCL 409
            + T  +  S T+ +          L+E   T  D +     K  P KLPCGH+    C+
Sbjct: 217 TQTTTGNSGSATDTNAEIAGQSSTPLTEQPLTPNDEETNPSYKHSPIKLPCGHIFGRECI 276

Query: 410 KNWMERSQTCPICRVPVFDKDG 431
             W     +CP+CR  + +  G
Sbjct: 277 YKWSRLENSCPLCRHKISENAG 298

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 394 KPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431
            P KLPCGH+    C+  W +   +CP+CR  + +  G
Sbjct: 250 SPIKLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  ++CL NW +  + CP+CR
Sbjct: 285 PSCAPCGHIYCWNCLINWCKEKEECPLCR 313

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDK 429
           P   PCGH+  + CL +W +    CP+CR P   +
Sbjct: 300 PSCSPCGHIFCWRCLMDWCQERAECPLCRQPCLPQ 334

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P  LPCGH+  + C+ +W + +  CP+CR
Sbjct: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431
           P +L CGH+    C+  W + + +CPICR  +  ++G
Sbjct: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP CGH   F C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 387 DRMADSKKPKKLPCGHMLHFSCLKNWME---RSQTCPICRVPV---FDKDGNV 433
           D MAD+   K +PC H  H SC++ W       +TCP CRV +    D D NV
Sbjct: 14  DSMADNV-AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEIRELIDMDHNV 65

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDG 431
           P +L CGH     C+  W +   +CPICR  +  ++G
Sbjct: 242 PTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 39.3 bits (90), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDK 429
           +LP CGH   F C+  W+ ++ TCP+CR  V  K
Sbjct: 121 ELPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHK 154

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  +SCL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + CL NW +    CP+CR
Sbjct: 289 PSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+ NW +    CP+CR
Sbjct: 288 PSAAPCGHIFCWDCIINWCKERPECPLCR 316

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 394 KPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
            P KLPCGH+    C+  W     +CP+CR
Sbjct: 334 SPTKLPCGHIFGRDCIFKWSHLENSCPLCR 363

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 380 EPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           E ++  I  + D   P   PCGH+  ++CL +W +    CP+CR
Sbjct: 281 ESSRKCILCLMDMTDPSCTPCGHLFCWNCLMSWCKERPECPLCR 324

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+  W    Q CP+CR
Sbjct: 265 PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 394 KPKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKD 430
            P KLPC H+    CL  W +   +CP+CR  + + D
Sbjct: 240 SPVKLPCDHIFGRECLYKWSKLENSCPLCRHKIIESD 276

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 380 EPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           E ++  I  + D   P   PCGH+  + CL +W +    CP+CR
Sbjct: 281 EASRKCILCLMDMTDPSCTPCGHLFCWDCLMSWCKERPECPLCR 324

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 37.7 bits (86), Expect = 0.017,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
           +LP CGH     CL  W  +S +CP+CR  V      V  S
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEVDTS 132

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 38.5 bits (88), Expect = 0.017,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     CL  W+ RS TCP+CR
Sbjct: 124 ELPHCNHRFDLECLSVWLSRSTTCPLCR 151

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 398 LP-CGHMLHFSCLKNWMERSQTCPICRVPVFD 428
           LP C H  HF C+K W++++  CP+CR  V +
Sbjct: 228 LPNCSHHFHFECIKLWLQKNSLCPLCRDNVME 259

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 37.7 bits (86), Expect = 0.019,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     CL  W+ RS TCP+CR
Sbjct: 96  ELPHCHHKFDLECLSVWLSRSTTCPLCR 123

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+ NW      CP+CR
Sbjct: 287 PSCAPCGHLYCWDCILNWCNEKPECPLCR 315

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 37.7 bits (86), Expect = 0.020,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           KLP C H     C+  W+ +S+TCP+CR
Sbjct: 100 KLPHCSHRFDLECVAVWLSKSRTCPLCR 127

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 38.1 bits (87), Expect = 0.024,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     CL  W+ RS TCP+CR
Sbjct: 126 ELPHCHHKFDLECLSVWLSRSTTCPLCR 153

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 37.7 bits (86), Expect = 0.025,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + CL +W      CP+CR
Sbjct: 112 PSCAPCGHVFCWKCLLSWCNERPECPLCR 140

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWDCLMSWCKERPECPLCR 324

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPSIAKT 440
           +LP CGH     C+  W+ +S TCP+CR  V     ++   ++KT
Sbjct: 121 ELPHCGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDI--DVSKT 163

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%)

Query: 400  CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
            CGH   +SC+  W++   TCP+C+        NV PS
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKT-------NVTPS 1208

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%)

Query: 400  CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
            CGH   +SC+  W++   TCP+C+        NV PS
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKT-------NVTPS 1208

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 37.7 bits (86), Expect = 0.033,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     CL  W+ RS TCP+CR
Sbjct: 131 ELPHCHHKFDLECLSVWLSRSTTCPLCR 158

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C   + + S  CP C+V V + D   R
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLNMDAQFR 434

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 400  CGHMLHFSCLKNWMERSQTCPICRVPV 426
            CGH+   SC+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 37.0 bits (84), Expect = 0.048,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDK 429
           +LP C H     CL  W+ ++ TCP+CR  V +K
Sbjct: 103 ELPHCSHRFDLECLTPWLLKNSTCPLCRDDVMEK 136

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRP 435
           P +LPC H+    CL  W +   +CP+CR  + +     RP
Sbjct: 298 PVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVEVQPEQRP 338

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICRVPVF 427
           +PC H  H  CL  W  ++  CP+CR+  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+ +W +    CP+CR
Sbjct: 286 PSCAPCGHIFCWDCILSWCKERPECPLCR 314

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C   +   S  CP C+V V + D   R
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLNMDAQFR 385

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 9/73 (12%)

Query: 360 DEKNTEKDKPSTTEEDLS----EVEPTQGDIDR-----MADSKKPKKLPCGHMLHFSCLK 410
           +E     +KP TT   +S    EV P      R     +     P   PCGH   + CL 
Sbjct: 224 NENGVLTEKPQTTISKISLRDPEVMPFISGPSRDCTLCLLPMTNPSCAPCGHTYCWDCLF 283

Query: 411 NWMERSQTCPICR 423
            W      CP+CR
Sbjct: 284 KWCNERPECPLCR 296

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 398 LPCGHMLHFSCLKNWME---RSQTCPICRVP---VFDKDGNVR 434
           +PCGH  H +C++ W      +++CP+CR     + D D  V+
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDTDHEVK 75

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+ +W +    CP+CR
Sbjct: 290 PSCSPCGHIFCWECILDWCKERPECPLCR 318

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 44/120 (36%), Gaps = 33/120 (27%)

Query: 314 QLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTE 373
           +L K+ PN    +L + D  C +C++ L                    K  E D  + T 
Sbjct: 125 ELEKRNPN----ELANDDETCCICLELL--------------------KTQEYD--TITT 158

Query: 374 EDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWM-------ERSQTCPICRVPV 426
           +D   V+   G   +         +PC H  H  CLK W         R   CP+CR+ +
Sbjct: 159 QDGMRVKTKGGPPTKSIKDTDIVMIPCQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDI 218

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPSIAK 439
           KLP C H     C+  W+ +S TCP+CR  V      +  S+ +
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKIDTSMVE 150

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICRVPVF 427
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C   + + S  CP C+V V + +   R
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEAQFR 440

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 2/41 (4%)

Query: 399 PCGHMLHFSCLKNWMERSQ--TCPICRVPVFDKDGNVRPSI 437
           PC H  H  C++ W   S    CP CR+       N+ P I
Sbjct: 35  PCNHKYHIDCIRTWHNYSNDLNCPTCRIETNQLSVNIYPEI 75

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 398  LPCGHMLHFSCLKNWMERS--QTCPICRV 424
            L CGH     C+ NW+E+S  + CPIC++
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 364 TEKDKPSTTEEDLSEVE-PTQGDIDRMADSKKPK--KLPCGHMLHFSCLKNWMERSQTCP 420
           T KD P+T    L +VE PT        DS+      +PC H  H SCL  W      CP
Sbjct: 252 TNKDSPTT----LKKVELPTCPVCLERMDSETTGLITIPCQHTFHCSCLDKW--NDSRCP 305

Query: 421 ICR 423
           +CR
Sbjct: 306 VCR 308

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CPICR
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICR 323

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 317 KKLPNIAIEDLLD-HDNMCIVCMD----DLVLVHHPTKR-----RQSVQEECDDEKNT-- 364
           ++LP + + +L D H+ +C +C D    +L  +   T+      R  +Q++   E     
Sbjct: 125 EQLPALKVRELADRHNTICSICYDAYEDELSNIFKRTREDDLDGRDGLQKKQRSESPVVV 184

Query: 365 EKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
             ++ S+ +++ +E  P    ++       P  LPC H+    CL  W +   +CP+CR
Sbjct: 185 PTEQSSSQQDENTEQAPNV--MEPPTYKHSPVVLPCNHVFGRECLFKWSQLENSCPLCR 241

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 395 PKKLPCGHMLHFSCLKNWM---ERSQTCPICRVPV 426
           P   PCGH   + CL NW+    +   CP CR  +
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCRSTI 74

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C   + + S  CP C+V + + +   R
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILNMEAQFR 439

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDK 429
           +LP C H     C+  W++++ +CPICR  V +K
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLEK 165

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            LPCGH  HF C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICRVPVF 427
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           P   PCGH+  + C+ +W      CP CR
Sbjct: 238 PSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C +     S  CP C+V V + D   R
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLNMDAQFR 274

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            + CGH     C+ +W++ +Q+CP+C+ 
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCKT 1240

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQT----CPICRVPV 426
           P  + CGH   +SCL +W   ++T    CP CR  V
Sbjct: 46  PMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANV 81

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 8/29 (27%), Positives = 17/29 (58%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRVPV 426
            + CGH     C+++W++   +CP+C+   
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCKTET 1267

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            LPCGH  HF C++ W   E+ + CP
Sbjct: 1303 LPCGHEGHFQCIQEWFLNEKERECP 1327

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 395 PKKLPCGHMLHFSCLKNWM----ERSQTCPICRVPVFDKDGNVRPSIAKT 440
           P    CGH   + CLK+W+    ++   CP CR  + D   N+ P I +T
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDT-PNLNPFIQQT 88

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            LPCGH  HF C++ W   E+   CP
Sbjct: 1299 LPCGHEGHFQCIQEWFLDEKEHECP 1323

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.3 bits (77), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     C+  W+ +S +CP+CR
Sbjct: 120 ELPHCNHKFDLECISVWLSKSTSCPLCR 147

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQ----TCPICRVPV 426
           P   PCGH   + CL +W   S     +CP CR  +
Sbjct: 40  PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSI 75

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 399 PCGHMLHFSCLKNWMERSQ--TCPICRV 424
           PCGH  H  C++ W   ++   CP+CR+
Sbjct: 24  PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%)

Query: 390  ADSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICRVPV 426
             D K P K+   C +  H SCL  W   S   TCP+CR  +
Sbjct: 1547 VDRKLPTKVCPTCNNKFHGSCLYKWFRSSNNNTCPLCRSEI 1587

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            + CGH    SC+ +W++   +CP+C+ 
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCKT 1193

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1321

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNW--MERSQTCP 420
            L CGH  HF+CL+ W   E + TCP
Sbjct: 1287 LSCGHEGHFACLREWFITENADTCP 1311

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCR 278

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%)

Query: 398 LPCGHMLHFSCLKNWMERSQT--CPICRV 424
           + CGH  HF+C++ W   S+   CP CR+
Sbjct: 19  VECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQ----TCPICRVPV 426
           P    CGH   + C+ NW+  +     TCP CR P+
Sbjct: 4   PVMTSCGHNYCYECISNWLVSNNANELTCPQCRSPL 39

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           K+P C H     CL  W++ + TCP+CR
Sbjct: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRP 435
           PC H  H  CL  W  ++  CP+CR     KD N  P
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCRYSQL-KDVNNEP 266

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 386 IDRM-ADSKKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
           ++RM +D+     +PC H  H  CL  W  ++  CP+CR
Sbjct: 238 LERMDSDTTGLITIPCQHTFHCQCLDKW--KNSRCPVCR 274

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQ----TCPICRVPV 426
           P    CGH   + C+ NW+  +     TCP CR  V
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 400 CGHMLHFSCLKNWMERS--QTCPICRV 424
           CGH  H +C++ W + S    CPICRV
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 386 IDRMADSKKP--KKLP-CGHMLHFSCLKNWMERSQTCPICR 423
            +R  +   P   +LP CGH+    C+  W+    TCP+CR
Sbjct: 96  FERFGNDNYPLLAQLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQT----CPICRVPV 426
           P    CGH   + CLK+W   ++T    CP CR  V
Sbjct: 40  PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSV 75

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            + CGH    SC+ +W+     CP+C++
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  +   CP+CR
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCR 287

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C   +++ S  CP C V V + +   R
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVINMEREFR 425

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            L CGH  HF C KNW   E   TCP
Sbjct: 1361 LRCGHEAHFQCFKNWFLDEGMNTCP 1385

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 32.7 bits (73), Expect = 0.69,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 400 CGHMLHFSCLKNWMERSQTCPICRVP 425
           CGH  H  C+  W++    CP+   P
Sbjct: 81  CGHAFHLHCINKWIKTRDACPLDNQP 106

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436
           +LP C H     C+  W+ +S TCP+CR  V +   N+  S
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTS 106

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 386 IDRMADSKKPKKLPCGHMLHFSCLKNWMERSQ--TCPICR 423
           ++ M ++ + + LPC H  H SC++ W   S    CP CR
Sbjct: 9   LESMNETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W  +   CP+CR
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCR 277

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            LPCGH  HF C++ W   E    CP
Sbjct: 1293 LPCGHEGHFQCIQEWFLNENEHECP 1317

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQ----TCPICRVPV 426
           P    CGH   + C+ NW+  +     TCP CR P+
Sbjct: 4   PVMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 399 PCGHMLHFSCLKNWMERSQT--CPICRV 424
           PC H  H+ C++ W   S    CP+CR 
Sbjct: 31  PCNHKYHYDCIRRWHGYSDNSDCPLCRC 58

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            L CGH     C+ +W +++ +CP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPICR 423
             P +L C H+   SCL  W +   +CP+CR
Sbjct: 330 NSPVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {ON}
           Anc_8.808 YOL054W
          Length = 357

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%)

Query: 399 PCGHMLHFSCLKNWME----RSQTCPICRVPV 426
           PCGH   + CL  W +    R   CP CRV +
Sbjct: 48  PCGHTYCYECLLTWFKNNENRELNCPDCRVSI 79

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            L CGH     C+ +W++    CPIC+
Sbjct: 1280 LKCGHFFCEDCIYDWLQTRTICPICK 1305

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVR 434
           PCGH +H  C  +    S  CP C+V V + +   R
Sbjct: 388 PCGHAIHQHCFNDHTRHSYKCPQCQVTVVNMEAQFR 423

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 386  IDRMADSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICR 423
            I  + D K P K+   C +  H +CL  W + S   TCP+CR
Sbjct: 1498 ILHVVDRKLPSKVCPTCSNRFHGACLYKWFKSSGNNTCPLCR 1539

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++ +++ +  CP+C
Sbjct: 36  KTPVLTPCGHTFCSVCIREYLQSNSKCPLC 65

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            + CGH    SC+ +W++   +CP+C++
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH    SC+  W+     CPIC+
Sbjct: 1256 IKCGHYFCKSCILTWLRSHSKCPICK 1281

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 400 CGHMLHFSCLKNW--MERSQTCPICR 423
           C H  HF+C++ W    +S  CP+CR
Sbjct: 22  CQHNFHFNCIRQWHLTSKSLECPVCR 47

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 399 PCGHMLHFSCLKNWMERSQ--TCPICRV 424
           PC H  H  CL+ W   +    CPICRV
Sbjct: 24  PCNHKFHRDCLRRWHLYAHDLVCPICRV 51

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 391  DSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICR 423
            D K P K+   C +  H +CL  W + S   TCP+CR
Sbjct: 1475 DRKLPTKVCPTCNNRFHGACLYKWFKSSGNNTCPLCR 1511

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++ ++ R   CP+C
Sbjct: 36  KVPVLTPCGHTFCSICIREYINRQSKCPLC 65

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 391  DSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICRVPV 426
            D K P K+   C +  H +CL  W   S   TCP+CR  +
Sbjct: 1507 DRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1546

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 4/37 (10%)

Query: 391  DSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICR 423
            D K P K    C +  H SCL  W   S   TCP+CR
Sbjct: 1512 DRKLPTKTCPTCNNKFHGSCLYKWFRSSGNNTCPLCR 1548

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH    SC+  W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3
           ubiquitin ligase that mediates poyubiquitination and
           degradation of centromere-binding protein Cse4p and
           prevents Cse4p from mislocalizing to euchromatin;
           ubiquitylation of Cse4p may be antagonized by Scm3p
          Length = 406

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNW----MERSQTCPICRVPV 426
           P   PCGH   + CL  W     ++   CP CR  +
Sbjct: 40  PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 401  GHMLHFSCLKNWMERSQTCPICRV 424
            GH     C+ +W+E  Q+CP+C+ 
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCKT 1258

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNW----MERSQTCPICRVPV 426
           P   PCGH   + CL  W     ++   CP CR  +
Sbjct: 40  PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH     C+ +W++    CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 398 LPCGHMLHFSCLKNWMERSQTCPICR 423
           +PC H  H  CL  W +    CP+CR
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCR 267

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNW----MERSQTCPICRVPV 426
           P   PCGH   + CL  W     ++   CP CR  +
Sbjct: 40  PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPICRV 424
           K P   PCGH     C++ ++ R   CP+C V
Sbjct: 52  KTPVLTPCGHTFCSLCIREYLNRELKCPLCLV 83

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 391  DSKKPKKL--PCGHMLHFSCLKNWMERS--QTCPICRVPV 426
            D K P K+   C +  H +CL  W   S   TCP+CR  +
Sbjct: 1531 DRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1570

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
           (REAL)
          Length = 411

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 395 PKKLPCGHMLHFSCLKNW----MERSQTCPICRVPV 426
           P   PCGH   + CL  W     ++   CP CR  +
Sbjct: 40  PMMTPCGHNYCYGCLNTWFSSNTQKELACPQCRSDI 75

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 397 KLP-CGHMLHFSCLKNWMERSQTCPICR 423
           +LP C H     C+  W+  + TCP+CR
Sbjct: 104 ELPHCSHKFDLQCISVWLSSNSTCPVCR 131

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 5/41 (12%)

Query: 398 LPCGHMLHFSCLKNWMERSQ--TCPICRV---PVFDKDGNV 433
           + C H  H  C++ W   SQ   CP CRV    + D + NV
Sbjct: 21  VTCQHEYHLECIREWHNHSQDFKCPTCRVESNKLLDVENNV 61

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++ ++ R   CP+C
Sbjct: 45  KTPVLTPCGHTFCSLCIREYLNRELKCPLC 74

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICRV 424
            + CGH     C+ +W++   +CP+C++
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH    +C+ +W++ +  CP+C+
Sbjct: 1284 ISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++ ++ +   CP+C
Sbjct: 36  KIPVLTPCGHTFCSLCIRGYLNKEPKCPLC 65

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 42/105 (40%), Gaps = 5/105 (4%)

Query: 158 LIFGILDYFVTKICXXXXXXXXXXXXXXSNITQIMFGLEYAVVFIDLINILCHTVLNFYA 217
           ++FG+L Y     C               ++     GL  AV F+D I +     +  + 
Sbjct: 22  IVFGLLCYCTWAYCHKLCYDQIYKQFHHRSVA---IGLICAVCFLDAIVVFIWYQMVIWV 78

Query: 218 FHRTQLQSARFNLEMMNDDFSEDENDSGVNADGGLEGKFIYEKLI 262
              TQ   A F++  + +   ED N+ G N +G  +    Y+ +I
Sbjct: 79  GPGTQPHVAPFSI--LPEVSKEDANEEGANGEGSQDASMEYDAVI 121

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 399 PCGHMLHFSCLKNWMERSQTCPIC 422
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1353

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCP 420
            L CGH  HF C K W   E  Q CP
Sbjct: 1321 LNCGHEGHFECFKKWFLEENMQECP 1345

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQ---TCPICRVPVFD 428
           P    CGH   + CL +W + +    +CP CR  + D
Sbjct: 40  PVMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASISD 76

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1321

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 3/33 (9%)

Query: 398  LPCGHMLHFSCLKNWM--ERSQTCPI-CRVPVF 427
            L CGH  HF CLK W   E    CP+ C   +F
Sbjct: 1289 LNCGHEGHFECLKKWFFDENMDVCPLGCPAILF 1321

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH    +C+  W+     CPIC+
Sbjct: 1249 IKCGHYFCKNCILTWLRAHSKCPICK 1274

>KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {ON}
           Anc_8.808 YOL054W
          Length = 351

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 395 PKKLPCGHMLHFSCLKNWMERSQT----CPICR 423
           P  + CGH   ++CLK+W+  ++     CP CR
Sbjct: 39  PMMVECGHNYCYTCLKHWLTSNENTVLKCPDCR 71

>TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7.440
           YBL104C
          Length = 1005

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 36/97 (37%), Gaps = 12/97 (12%)

Query: 334 CIVCMDDLVLVHHP---TKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMA 390
           C++C+  L     P   +        +  DE  + KD   T +     +E  + D+ +  
Sbjct: 901 CVICLLPLGTTGLPFVISGVESKYDRDAIDEGPSPKD--GTNKSQNGAIEQEKADVAKTY 958

Query: 391 DSKKPK-------KLPCGHMLHFSCLKNWMERSQTCP 420
             KK +        L C H +H    + W ER   CP
Sbjct: 959 QRKKERLNEWFSFCLSCNHGMHAGHAEEWFERHDVCP 995

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 398  LPCGHMLHFSCLKNWMERSQTCPICR 423
            + CGH    +C+  W+     CPIC+
Sbjct: 1253 IKCGHYFCKNCILTWLRAHNKCPICK 1278

>KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa]
            {ON} uniprot|O60014 Kluyveromyces lactis UBR1 N-END-
            RECOGNIZING PROTEIN (UBIQUITIN-PROTEIN LIGASE E3
            COMPONENT) (N-RECOGNIN)
          Length = 1945

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 370  STTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQ------TCPICR 423
            +T   DL   +   G    M +S +   + C H +H+ C K+++++ +       CP+C+
Sbjct: 1241 ATYNTDLFYKKKENGASQLMHESTQKVLVSCNHAVHYRCFKHYIDKKRYSTDLFICPLCQ 1300

Query: 424  V 424
             
Sbjct: 1301 T 1301

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 23/74 (31%)

Query: 369 PSTTEEDLSEVEPTQGDIDRMAD--SKKPKKLPCGHMLHFSCLKNWME------RSQT-- 418
           PST     +++E  Q   ++  D    K  KLPC H  H  C+K+W        +S T  
Sbjct: 160 PST-----NDLEKQQNGTEQTTDMIPSKVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHS 214

Query: 419 --------CPICRV 424
                   CP+CR+
Sbjct: 215 FAIGPTYFCPLCRL 228

>KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {ON}
           Anc_6.332 YCR066W
          Length = 461

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++  + +S  CP+C
Sbjct: 36  KVPVLTPCGHTFCSICIREAINKSAKCPLC 65

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 393 KKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422
           K P   PCGH     C++ ++     CP+C
Sbjct: 35  KNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 2/27 (7%)

Query: 400 CGHMLHFSCLKNWMERS--QTCPICRV 424
           C H  H +C++ W + S    CPICR+
Sbjct: 23  CRHQFHLNCIREWHKYSIDLKCPICRI 49

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,617,553
Number of extensions: 2174101
Number of successful extensions: 13435
Number of sequences better than 10.0: 241
Number of HSP's gapped: 13717
Number of HSP's successfully gapped: 259
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)