Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009806.9ON41441422040.0
ZYRO0F00462g6.9ON39338813071e-180
NDAI0K029006.9ON43842912751e-174
Skud_5.336.9ON40140012601e-172
NCAS0F001906.9ON41140412401e-169
Kpol_1045.786.9ON39239112341e-169
YEL056W (HAT2)6.9ON40140112321e-168
Suva_5.126.9ON40140012271e-167
TDEL0G046206.9ON39238912201e-166
Smik_5.316.9ON42740012031e-163
KAFR0L003206.9ON39138511791e-160
CAGL0B03575g6.9ON41939611751e-159
TPHA0M001906.9ON39139111601e-157
Ecym_30126.9ON39739811511e-156
KLLA0D00814g6.9ON40839711441e-155
SAKL0E00814g6.9ON39838211131e-150
ACR017W6.9ON42338211151e-150
KLTH0C11550g6.9ON39837310991e-148
Kwal_56.223456.9ON39637710471e-140
TBLA0A071206.9ON4073869991e-133
TBLA0H036508.548ON4194133678e-39
Kpol_1024.398.548ON4174263423e-35
KLLA0E23541g8.548ON4173953335e-34
NDAI0C055108.548ON4194123195e-32
Ecym_70428.548ON4143963185e-32
SAKL0H09900g8.548ON4254223186e-32
AEL250C8.548ON4174043179e-32
YBR195C (MSI1)8.548ON4224143082e-30
NCAS0B021708.548ON4144293053e-30
KNAG0A036708.548ON4264263021e-29
ZYRO0A13068g8.548ON3974102982e-29
KAFR0I008408.548ON4134192974e-29
Suva_4.4498.548ON4244212966e-29
TPHA0L017208.548ON4194172922e-28
KLTH0E12694g8.548ON4184072904e-28
Skud_2.3218.548ON4224122889e-28
Kwal_27.120708.548ON4184122871e-27
Smik_2.3358.548ON4224162862e-27
TDEL0B029808.548ON4124082809e-27
CAGL0M05291g8.548ON4194082632e-24
Skud_13.2912.401ON5094191853e-14
Suva_13.3112.401ON5104231821e-13
KAFR0A003802.401ON5164251756e-13
CAGL0K03861g2.401ON5134191757e-13
KNAG0E021802.401ON5173541731e-12
Smik_13.3292.401ON5094191722e-12
TBLA0B092502.401ON5263761712e-12
TDEL0G033402.401ON5143861703e-12
Kpol_1041.202.401ON5154121685e-12
TPHA0G026502.401ON5164221677e-12
YMR131C (RRB1)2.401ON5112421667e-12
Sklu_YGOB_Anc_2.4012.401ON5202451668e-12
Ecym_60672.401ON5222541668e-12
ZYRO0A08690g2.401ON5163691632e-11
NCAS0F019702.401ON5112421588e-11
Skud_4.637.310ON12732621581e-10
Ecym_8044na 1ON3112141541e-10
NCAS0G038702.283ON3891811551e-10
Kwal_47.178272.401ON5233921561e-10
ADR242C2.401ON5212201552e-10
AEL269C7.534ON4552531542e-10
NDAI0H027502.401ON5123891543e-10
KLLA0F19734g8.288ON11331581526e-10
KLTH0E09394g2.401ON5224141516e-10
Kpol_1019.307.310ON12521731526e-10
NCAS0G011206.276ON4941721508e-10
KLLA0F17237g2.401ON5233741491e-09
Ecym_80617.310ON12282881501e-09
Ecym_33212.283ON4091921471e-09
Suva_4.537.310ON12712111473e-09
KLTH0G10296g2.283ON4261711443e-09
Kwal_27.115502.283ON4071781443e-09
SAKL0E07766g2.283ON3981351434e-09
KNAG0B028007.310ON13072211439e-09
Kwal_56.236858.288ON11021381421e-08
KLLA0F15598g5.201ON4782501401e-08
KAFR0L013207.310ON12402071421e-08
TPHA0C033702.283ON4131991401e-08
TBLA0C050107.356ON5721721392e-08
SAKL0F10384g7.310ON12612441392e-08
KNAG0M017505.201ON4852011373e-08
Kwal_56.245267.322ON12102321383e-08
KLTH0H01892g7.322ON12092321374e-08
TDEL0C023607.310ON12642761374e-08
TBLA0B059202.283ON4031871364e-08
KNAG0I010508.288ON11591531374e-08
KNAG0F038707.534ON4652271346e-08
ADR090W7.310ON12332661357e-08
Smik_4.457.310ON12702521358e-08
Kpol_1048.598.544ON8502061349e-08
TPHA0A031007.310ON12652511349e-08
TPHA0I032407.534ON4772401339e-08
Ecym_74032.469ON5172451321e-07
KNAG0I009208.316ON3812111311e-07
Suva_14.3112.283ON3891891312e-07
KLLA0F05159g7.310ON12312101312e-07
Kwal_56.244787.310ON12962221312e-07
ZYRO0D06556g8.288ON11472261312e-07
ZYRO0F05808g7.310ON12822171312e-07
Kpol_1036.658.316ON3712981292e-07
KLLA0E08449g2.283ON4222391292e-07
KAFR0H033402.283ON3671751283e-07
ZYRO0B10450g5.201ON4821681284e-07
SAKL0F10648g7.322ON12032321294e-07
NCAS0F033405.429ON4481651275e-07
Suva_3.936.325ON9202231285e-07
TDEL0C022407.322ON12012321285e-07
ABL044C2.469ON5182231275e-07
KAFR0L013907.322ON12062351285e-07
SAKL0G12892g5.201ON4762521275e-07
KLTH0G13068g8.288ON11011431268e-07
KNAG0E024702.469ON5092951258e-07
NCAS0B036908.288ON11452251269e-07
Kpol_2001.657.322ON12062361269e-07
Skud_4.1097.322ON12012321251e-06
KAFR0B003707.534ON4611921241e-06
Ecym_71055.201ON4842001241e-06
NDAI0F012406.276ON5241701241e-06
NDAI0A020907.322ON12002331251e-06
Smik_4.907.322ON12012321251e-06
ZYRO0G20152g2.431ON3192181231e-06
Suva_4.997.322ON12012321251e-06
KNAG0I028406.340ON5192171241e-06
YDL195W (SEC31)7.310ON12732591251e-06
YNL035C2.283ON3892081231e-06
SAKL0E03080g2.469ON5152231241e-06
YKR036C (CAF4)1.247ON6431711241e-06
TBLA0H020005.201ON4731401232e-06
TPHA0D045007.322ON12082361242e-06
Skud_3.1336.325ON9162031232e-06
NCAS0A139407.322ON12052301232e-06
Smik_3.1576.325ON9242031232e-06
KLLA0E19515g7.356ON5721721222e-06
Kpol_530.257.356ON5741731222e-06
CAGL0A04037g7.356ON5831731222e-06
AAR078W7.356ON5621811213e-06
NDAI0G006302.283ON3971931213e-06
YDL145C (COP1)7.322ON12012321223e-06
KLTH0A07282g6.363ON7252181213e-06
CAGL0H00781g6.276ON5131771203e-06
AER255C5.429ON4671601204e-06
NCAS0D027305.201ON4752531204e-06
YCR057C (PWP2)6.325ON9232031205e-06
SAKL0F11506g7.356ON5681721195e-06
Skud_14.2982.283ON3891881185e-06
KLTH0H02134g7.310ON12992071196e-06
Smik_14.2962.283ON3891901176e-06
CAGL0I03718g7.322ON12012321196e-06
KLLA0F04884g7.322ON12122321196e-06
TBLA0A038908.316ON3622381178e-06
Ecym_42808.288ON11321611188e-06
NCAS0D046106.340ON5151701178e-06
NCAS0E037507.310ON12762151188e-06
YLR196W (PWP1)7.356ON5761811178e-06
KLLA0A08822g4.122ON5821511171e-05
TDEL0D013101.247ON7091741171e-05
CAGL0G01628g2.283ON3761101161e-05
TBLA0F022307.322ON12162331171e-05
Kpol_1016.111.247ON6692231161e-05
Kpol_1060.246.276ON4861751161e-05
AAL157C5.201ON4791991151e-05
Kwal_56.24399na 1ON3691371151e-05
KLTH0G12430g8.316ON3672791151e-05
Ecym_21396.276ON4352781151e-05
Kpol_1003.342.283ON3881791151e-05
KAFR0A064804.122ON568671151e-05
TPHA0D035906.276ON5983281152e-05
Ecym_55285.429ON4711661152e-05
ZYRO0D08206g6.340ON5151971152e-05
Ecym_60982.431ON3182411132e-05
TDEL0G021402.283ON3922141142e-05
Smik_6.4516.276ON5231701142e-05
ZYRO0A01804g2.283ON3761101132e-05
SAKL0H22396g4.122ON5551521142e-05
KLTH0B03410g5.201ON4771481142e-05
NCAS0F018502.431ON3182461122e-05
SAKL0A02970g6.276ON4152471132e-05
Kwal_56.246617.356ON5611841142e-05
TPHA0I018808.544ON10343111142e-05
Ecym_25236.363ON6462831133e-05
NCAS0A042702.431ON3182461123e-05
KLTH0H01122g7.356ON5791881133e-05
Smik_11.2981.247ON6621671133e-05
NCAS0J011104.122ON5952101123e-05
TDEL0H003707.534ON4652151124e-05
Kwal_55.214505.429ON5032201124e-05
TBLA0F021407.310ON13002051134e-05
KAFR0H024508.672ON4172141114e-05
CAGL0D05588g5.201ON4772141124e-05
NDAI0I021805.201ON4791431124e-05
KAFR0L015207.356ON5841731124e-05
TPHA0G023802.431ON3182181104e-05
Kpol_1028.416.340ON5122081124e-05
TPHA0F007704.122ON6311731124e-05
Skud_16.326.276ON5221851124e-05
ZYRO0E08184g6.276ON5063041114e-05
KLTH0E08162g4.122ON5561731114e-05
AGL234W6.363ON6292831114e-05
ADL184W3.25ON4491531114e-05
TPHA0B011201.247ON7191781115e-05
KAFR0J009805.201ON4801501115e-05
YPL247C6.276ON5231691115e-05
KLLA0E04819g7.534ON4592261115e-05
YJL112W (MDV1)1.247ON7141681115e-05
CAGL0E01485g3.22ON1336691125e-05
Kwal_33.151365.201ON4731381105e-05
KNAG0H020402.283ON3991831105e-05
TPHA0G031002.469ON5092221115e-05
KLLA0E21187g5.429ON4291651106e-05
KAFR0F043506.340ON5152991106e-05
Smik_12.525.201ON4891431106e-05
TDEL0A024502.469ON5102241106e-05
TBLA0C009902.663ON3931211096e-05
TDEL0F041508.288ON11341511117e-05
YLL011W (SOF1)5.201ON4892021097e-05
KLTH0A06754g6.340ON5142071097e-05
TDEL0C019207.356ON5631741097e-05
KLTH0H02508gna 1ON3091501088e-05
TBLA0A096105.631ON3861211098e-05
KLTH0F16192g5.429ON4621511098e-05
KLLA0E04093g8.316ON3722001088e-05
TBLA0B091002.431ON3172161088e-05
Smik_10.1261.247ON7121681099e-05
TDEL0B020108.435ON8052261099e-05
ADR077C7.322ON12042321099e-05
AFR199C2.431ON3341831079e-05
KNAG0B025807.356ON5801721091e-04
NCAS0A078602.469ON5102951081e-04
TDEL0E042805.201ON4811691081e-04
Kwal_23.63246.340ON5142381081e-04
Suva_16.1598.672ON4512081081e-04
ZYRO0F11110g7.322ON12012351091e-04
Skud_10.1021.247ON7081691081e-04
Smik_13.2772.469ON5132291081e-04
TBLA0I022806.325ON9272091081e-04
SAKL0F15972g7.534ON4702531071e-04
CAGL0C00737g8.435ON8161601081e-04
Suva_10.645.201ON4901431071e-04
TDEL0A075506.340ON5152061071e-04
NCAS0G036001.399ON3272821052e-04
Suva_13.2952.431ON3192461052e-04
Skud_13.2752.431ON3192461052e-04
Smik_13.3052.431ON3192461052e-04
YMR116C (ASC1)2.431ON3192461052e-04
KAFR0E031808.544ON8141891072e-04
SAKL0H06666g8.672ON4412141062e-04
TPHA0E030805.201ON4881501062e-04
Kpol_1028.546.325ON9051901072e-04
Kwal_56.238958.316ON3672971052e-04
ZYRO0B02486g7.356ON5751731062e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00980
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   853   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   508   e-180
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     495   e-174
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   489   e-172
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   482   e-169
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   479   e-169
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   479   e-168
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   477   e-167
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   474   e-166
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   468   e-163
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   458   e-160
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   457   e-159
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   451   e-157
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   447   e-156
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   445   e-155
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   433   e-150
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   434   e-150
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   427   e-148
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   407   e-140
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   389   e-133
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   145   8e-39
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   136   3e-35
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   132   5e-34
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   127   5e-32
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   127   5e-32
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   127   6e-32
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   126   9e-32
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   123   2e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   122   3e-30
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   120   1e-29
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   119   2e-29
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   119   4e-29
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   118   6e-29
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   117   2e-28
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   116   4e-28
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   115   9e-28
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   115   1e-27
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   114   2e-27
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   112   9e-27
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   105   2e-24
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    76   3e-14
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    75   1e-13
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    72   6e-13
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    72   7e-13
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    71   1e-12
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    71   2e-12
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    70   2e-12
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    70   3e-12
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    69   5e-12
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    69   7e-12
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    69   7e-12
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    69   8e-12
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    69   8e-12
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    67   2e-11
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    65   8e-11
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    65   1e-10
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    64   1e-10
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     64   1e-10
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    65   1e-10
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    64   2e-10
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    64   2e-10
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    64   3e-10
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    63   6e-10
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    63   6e-10
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    63   6e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    62   8e-10
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    62   1e-09
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    62   1e-09
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    61   1e-09
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    61   3e-09
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    60   3e-09
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    60   3e-09
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    60   4e-09
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    60   9e-09
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    59   1e-08
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    59   1e-08
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    59   1e-08
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    59   1e-08
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    58   2e-08
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    58   2e-08
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    57   3e-08
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    58   3e-08
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    57   4e-08
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    57   4e-08
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    57   4e-08
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    57   4e-08
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    56   6e-08
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    57   7e-08
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    57   8e-08
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    56   9e-08
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    56   9e-08
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    56   9e-08
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    55   1e-07
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    55   1e-07
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    55   2e-07
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    55   2e-07
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    55   2e-07
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    55   2e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    55   2e-07
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    54   2e-07
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    54   2e-07
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    54   3e-07
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    54   4e-07
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    54   4e-07
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    54   5e-07
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    54   5e-07
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    54   5e-07
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    54   5e-07
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    54   5e-07
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    54   5e-07
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    53   8e-07
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    53   8e-07
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    53   9e-07
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    53   9e-07
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    53   1e-06
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    52   1e-06
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    52   1e-06
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    52   1e-06
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    53   1e-06
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    53   1e-06
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    52   1e-06
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    53   1e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    52   1e-06
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    53   1e-06
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    52   1e-06
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    52   1e-06
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    52   1e-06
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    52   2e-06
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    52   2e-06
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    52   2e-06
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    52   2e-06
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    52   2e-06
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    52   2e-06
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    52   2e-06
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    52   2e-06
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    51   3e-06
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    51   3e-06
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    52   3e-06
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    51   3e-06
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    51   3e-06
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    51   4e-06
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     51   4e-06
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    51   5e-06
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    50   5e-06
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    50   5e-06
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    50   6e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    50   6e-06
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    50   6e-06
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    50   6e-06
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    50   8e-06
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    50   8e-06
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     50   8e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    50   8e-06
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    50   8e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    50   1e-05
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    50   1e-05
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    49   1e-05
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    50   1e-05
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    49   1e-05
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    49   1e-05
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    49   1e-05
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    49   1e-05
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    49   1e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    49   1e-05
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    49   1e-05
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    49   1e-05
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    49   2e-05
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    49   2e-05
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    49   2e-05
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    48   2e-05
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    49   2e-05
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    49   2e-05
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    48   2e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    49   2e-05
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    49   2e-05
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    48   2e-05
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    48   2e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    49   2e-05
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    49   2e-05
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    48   3e-05
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    48   3e-05
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    48   3e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    48   3e-05
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              48   3e-05
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    48   4e-05
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    48   4e-05
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    48   4e-05
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    47   4e-05
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    48   4e-05
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    48   4e-05
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    48   4e-05
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    47   4e-05
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    48   4e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    48   4e-05
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    48   4e-05
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    47   4e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    47   4e-05
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    47   4e-05
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    47   4e-05
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    47   5e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    47   5e-05
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    47   5e-05
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    47   5e-05
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    47   5e-05
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    48   5e-05
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    47   5e-05
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    47   5e-05
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    47   5e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    47   6e-05
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    47   6e-05
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    47   6e-05
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    47   6e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    47   6e-05
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    47   7e-05
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    47   7e-05
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    47   7e-05
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    47   7e-05
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    46   8e-05
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    47   8e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    47   8e-05
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    46   8e-05
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    46   8e-05
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    47   9e-05
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    47   9e-05
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    47   9e-05
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    46   9e-05
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    47   1e-04
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    46   1e-04
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    46   1e-04
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    46   1e-04
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    46   1e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    47   1e-04
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    46   1e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    46   1e-04
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    46   1e-04
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    46   1e-04
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    46   1e-04
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    46   1e-04
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    46   1e-04
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    45   2e-04
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    45   2e-04
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    45   2e-04
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    45   2e-04
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    45   2e-04
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    46   2e-04
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    45   2e-04
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    45   2e-04
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    46   2e-04
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    45   2e-04
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    45   2e-04
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    45   2e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       45   2e-04
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    45   2e-04
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    45   2e-04
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    45   2e-04
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    45   2e-04
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    45   2e-04
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    45   2e-04
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    45   2e-04
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    45   2e-04
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    45   3e-04
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    45   3e-04
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    45   3e-04
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    45   3e-04
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    45   3e-04
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    45   3e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    45   3e-04
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    45   3e-04
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    45   3e-04
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    45   3e-04
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    44   3e-04
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    45   3e-04
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    45   3e-04
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    45   3e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    45   3e-04
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    45   3e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    45   3e-04
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    45   4e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    45   4e-04
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    44   4e-04
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    45   4e-04
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    44   4e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    44   4e-04
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    44   4e-04
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    44   4e-04
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    44   4e-04
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    44   4e-04
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    44   4e-04
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    45   4e-04
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    44   4e-04
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    44   4e-04
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    44   4e-04
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      44   4e-04
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    44   5e-04
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    44   5e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    44   5e-04
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    44   5e-04
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    44   5e-04
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    44   5e-04
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    44   5e-04
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    44   5e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    44   6e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   6e-04
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    44   6e-04
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    43   6e-04
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    44   6e-04
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    44   6e-04
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    44   6e-04
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    44   6e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    44   6e-04
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    44   7e-04
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    43   7e-04
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    44   7e-04
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    44   7e-04
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    44   7e-04
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    44   7e-04
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    44   7e-04
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    44   8e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    44   8e-04
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    44   8e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    44   9e-04
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    43   9e-04
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    43   9e-04
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    43   0.001
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    43   0.001
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    43   0.001
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    43   0.001
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    43   0.001
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    44   0.001
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    44   0.001
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    44   0.001
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    43   0.001
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             43   0.001
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    43   0.001
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    43   0.001
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    43   0.001
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    43   0.001
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    43   0.001
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    43   0.001
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    43   0.001
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    43   0.001
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    43   0.001
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    43   0.001
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    43   0.001
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    43   0.001
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    43   0.001
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    43   0.001
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    42   0.001
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    43   0.001
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    43   0.001
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    43   0.001
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    43   0.001
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    43   0.001
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    42   0.001
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    43   0.001
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    43   0.002
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    43   0.002
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       43   0.002
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    43   0.002
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    42   0.002
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    42   0.002
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    42   0.002
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    42   0.002
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.002
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    42   0.002
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.002
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    42   0.002
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    42   0.002
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    42   0.002
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    42   0.002
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    42   0.002
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    42   0.002
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    42   0.002
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.002
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    42   0.002
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    42   0.002
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    42   0.002
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    42   0.002
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    42   0.002
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    42   0.003
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    42   0.003
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    42   0.003
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    42   0.003
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    42   0.003
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    42   0.003
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    42   0.003
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    42   0.003
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    42   0.003
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    42   0.003
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    42   0.003
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    42   0.003
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    41   0.003
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    42   0.003
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    42   0.003
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    42   0.003
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    41   0.003
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    41   0.003
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    42   0.003
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.003
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    42   0.003
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    41   0.003
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    42   0.003
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    41   0.004
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    41   0.004
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    42   0.004
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    42   0.004
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    41   0.004
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    42   0.004
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    41   0.004
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    41   0.004
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    41   0.004
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    41   0.004
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    41   0.004
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    41   0.004
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    41   0.004
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    41   0.004
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    41   0.004
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    41   0.004
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    41   0.005
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    41   0.005
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    41   0.005
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    41   0.005
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    41   0.005
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    41   0.005
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    41   0.005
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    41   0.005
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    41   0.005
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    41   0.005
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               41   0.005
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    41   0.005
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    41   0.005
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    41   0.006
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    41   0.006
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    41   0.006
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    41   0.006
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    40   0.006
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               40   0.006
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    40   0.006
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    40   0.007
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    40   0.007
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    40   0.007
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    40   0.007
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    40   0.007
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    41   0.007
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    41   0.007
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    40   0.007
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    41   0.007
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    40   0.007
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    40   0.007
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    40   0.007
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    40   0.007
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    40   0.008
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    40   0.008
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    40   0.008
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    40   0.008
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    40   0.008
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    40   0.008
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    40   0.008
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    40   0.008
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    40   0.008
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    40   0.009
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    40   0.009
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    40   0.009
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    40   0.009
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     40   0.009
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    40   0.009
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    40   0.009
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    40   0.009
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    40   0.009
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    40   0.010
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.010
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    40   0.010
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    40   0.010
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    40   0.010
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    40   0.010
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    40   0.011
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    40   0.011
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    40   0.011
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    40   0.011
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    39   0.011
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.011
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    40   0.012
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    40   0.012
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    40   0.012
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    40   0.012
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    40   0.012
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    39   0.012
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    40   0.012
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    40   0.013
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    40   0.013
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    40   0.013
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    40   0.013
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    40   0.013
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    40   0.014
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    40   0.014
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    39   0.014
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    40   0.014
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    40   0.014
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    39   0.014
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    40   0.014
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    39   0.014
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.015
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    39   0.015
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    39   0.016
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               39   0.016
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    40   0.016
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    39   0.016
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    39   0.017
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    39   0.017
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    39   0.017
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    39   0.017
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    39   0.017
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    39   0.018
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    39   0.018
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    39   0.018
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    39   0.018
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    39   0.018
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    39   0.019
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    39   0.020
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    39   0.021
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       39   0.021
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    39   0.022
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    39   0.022
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    39   0.022
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    39   0.022
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    39   0.022
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    39   0.023
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    39   0.023
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    39   0.023
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    39   0.023
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    39   0.024
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    39   0.025
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    39   0.025
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    39   0.025
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    39   0.025
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    39   0.026
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    39   0.026
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    38   0.027
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    39   0.029
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    39   0.029
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    38   0.029
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    39   0.029
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    39   0.030
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    39   0.030
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    39   0.031
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    38   0.033
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    38   0.034
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    39   0.035
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    39   0.035
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    38   0.035
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    38   0.037
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.037
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    38   0.039
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    38   0.040
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    38   0.040
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    38   0.040
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      38   0.040
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    38   0.042
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    38   0.042
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    37   0.042
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    38   0.045
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    38   0.047
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    38   0.047
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    38   0.047
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    37   0.047
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    38   0.047
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    38   0.048
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    38   0.048
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     38   0.048
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    37   0.048
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    37   0.050
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    38   0.051
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    38   0.051
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    37   0.052
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    37   0.053
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    38   0.053
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    38   0.055
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    37   0.056
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    38   0.057
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    38   0.058
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    37   0.060
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    37   0.064
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               37   0.064
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    37   0.064
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    38   0.066
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    37   0.067
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    37   0.068
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    37   0.068
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    37   0.068
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    37   0.068
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    37   0.069
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    37   0.071
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    37   0.072
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    37   0.072
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    37   0.072
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    37   0.073
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    37   0.073
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    37   0.074
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    37   0.074
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    37   0.077
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    37   0.078
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.080
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    37   0.081
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    37   0.082
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    37   0.083
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    37   0.083
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    37   0.085
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    37   0.088
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    37   0.089
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               37   0.089
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    37   0.090
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    37   0.090
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    37   0.091
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    37   0.093
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    37   0.094
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    37   0.095
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    37   0.096
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    37   0.097
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    37   0.099
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    37   0.10 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    37   0.10 
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    37   0.10 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    37   0.10 
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    37   0.10 
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    37   0.11 
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    37   0.11 
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    37   0.11 
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    37   0.11 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    37   0.12 
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    37   0.12 
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    36   0.12 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    37   0.12 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    37   0.13 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    37   0.13 
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    37   0.13 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    37   0.13 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    36   0.14 
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    36   0.14 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    36   0.15 
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    36   0.15 
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    36   0.15 
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    36   0.15 
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    36   0.15 
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    36   0.16 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    36   0.16 
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    36   0.16 
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    36   0.16 
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    36   0.16 
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    36   0.16 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     36   0.16 
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     36   0.17 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    36   0.17 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    36   0.17 
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    36   0.17 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    36   0.17 
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    36   0.17 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    36   0.18 
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    36   0.18 
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    36   0.19 
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    36   0.20 
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    36   0.20 
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    36   0.21 
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    36   0.21 
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    36   0.21 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    36   0.22 
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    35   0.22 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    36   0.22 
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    35   0.23 
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    36   0.24 
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    36   0.25 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    35   0.25 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    36   0.25 
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    36   0.25 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    35   0.26 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    35   0.26 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    35   0.27 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    35   0.27 
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    35   0.27 
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    35   0.27 
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    35   0.27 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    35   0.27 
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    35   0.28 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    35   0.28 
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    35   0.28 
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    35   0.29 
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    35   0.30 
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     35   0.30 
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    35   0.30 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    35   0.30 
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    35   0.30 
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    35   0.31 
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    35   0.31 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    35   0.31 
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    35   0.32 
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    35   0.32 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    35   0.33 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     35   0.33 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.33 
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    35   0.35 
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    35   0.36 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   0.37 
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    35   0.38 
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    35   0.38 
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    35   0.39 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    35   0.39 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    35   0.39 
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    35   0.40 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    35   0.40 
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    35   0.41 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    35   0.42 
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    35   0.42 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    35   0.43 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    35   0.43 
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    35   0.43 
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    35   0.44 
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    35   0.44 
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    34   0.45 
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    34   0.45 
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    35   0.45 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    35   0.46 
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    34   0.46 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    35   0.46 
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    35   0.47 
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    35   0.47 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    34   0.49 
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    35   0.49 
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    35   0.50 
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    34   0.51 
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    34   0.52 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     35   0.52 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    34   0.53 
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    35   0.55 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    34   0.55 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    34   0.56 
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    34   0.56 
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    34   0.57 
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    34   0.57 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    34   0.59 
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    34   0.59 
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    34   0.59 
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    34   0.59 
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    34   0.60 
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      34   0.60 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    34   0.62 
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    34   0.62 
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    34   0.65 
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    34   0.70 
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    34   0.71 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    34   0.72 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    34   0.72 
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    34   0.73 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    34   0.73 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    34   0.74 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    34   0.75 
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    34   0.79 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    34   0.85 
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    33   0.85 
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    34   0.87 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    34   0.88 
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    34   0.91 
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    34   0.91 
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    34   0.91 
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    34   0.94 
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    34   0.95 
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    33   0.96 
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    33   1.0  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    33   1.0  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    33   1.0  
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    33   1.1  
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    33   1.1  
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    33   1.1  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    33   1.1  
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    33   1.1  
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      33   1.1  
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    33   1.2  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    33   1.2  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    33   1.2  
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    33   1.2  
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    33   1.2  
Kpol_264.9 s264 complement(18422..19198) [777 bp, 258 aa] {ON} c...    33   1.2  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    33   1.3  
SAKL0G01694g Chr7 (142556..145099) [2544 bp, 847 aa] {ON} simila...    33   1.3  
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    33   1.3  
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    33   1.3  
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    33   1.3  
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    33   1.3  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   1.3  
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    33   1.3  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    33   1.4  
ZYRO0G21802g Chr7 (1794478..1795557) [1080 bp, 359 aa] {ON} simi...    33   1.4  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   1.4  
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    33   1.4  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    33   1.4  
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    33   1.4  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    33   1.4  
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    33   1.4  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   1.5  
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    33   1.6  
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    33   1.6  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    33   1.6  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    33   1.7  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    33   1.7  
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    32   1.7  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    33   1.7  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    33   1.7  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    33   1.7  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    33   1.8  
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    32   1.9  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    33   1.9  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    33   1.9  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    32   2.0  
NCAS0A10250 Chr1 (2045419..2046318) [900 bp, 299 aa] {ON} Anc_3....    32   2.0  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    32   2.0  
NCAS0D02850 Chr4 complement(541931..542698) [768 bp, 255 aa] {ON}      32   2.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    33   2.0  
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    32   2.0  
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    32   2.0  
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    33   2.0  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    32   2.0  
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    33   2.1  
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    32   2.2  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    32   2.2  
KLLA0E21847g Chr5 complement(1948687..1951230) [2544 bp, 847 aa]...    33   2.3  
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    32   2.3  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   2.3  
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    32   2.3  
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    32   2.4  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    32   2.4  
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    32   2.5  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    32   2.5  
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    32   2.5  
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    32   2.5  
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    32   2.6  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    32   2.6  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    32   2.7  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    32   2.7  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    32   2.7  
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    32   2.9  
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    32   2.9  
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    32   3.0  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    32   3.1  
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    32   3.1  
Ecym_3583 Chr3 complement(1104298..1106202) [1905 bp, 634 aa] {O...    32   3.1  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    32   3.1  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    32   3.2  
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    32   3.4  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    32   3.5  
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    32   3.5  
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    32   3.7  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             32   3.7  
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    32   3.8  
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    32   3.8  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    32   3.9  
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    32   3.9  
Kpol_1027.5 s1027 complement(11866..14520) [2655 bp, 884 aa] {ON...    32   3.9  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    32   3.9  
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    32   4.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    32   4.0  
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    32   4.0  
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    32   4.2  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    32   4.2  
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    32   4.2  
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    32   4.2  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    32   4.3  
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    32   4.3  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   4.3  
Skud_8.262 Chr8 (460838..462565) [1728 bp, 575 aa] {ON} YHR196W ...    32   4.3  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    32   4.4  
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    32   4.4  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    32   4.5  
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    32   4.5  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    32   4.5  
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    31   4.6  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   4.6  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    32   4.6  
AEL154C Chr5 complement(339962..342628) [2667 bp, 888 aa] {ON} S...    32   4.6  
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    32   4.6  
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    31   4.7  
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    32   4.9  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    32   4.9  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    31   4.9  
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    32   5.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    32   5.0  
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    31   5.3  
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    31   5.4  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    31   5.4  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    31   5.5  
TDEL0C00690 Chr3 (111718..113595) [1878 bp, 625 aa] {ON} Anc_8.4...    31   5.8  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    31   5.9  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    31   6.1  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    31   6.1  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    31   6.2  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    31   6.2  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    31   6.3  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    31   6.6  
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    31   6.9  
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    31   7.0  
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     31   7.3  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    31   7.3  
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    31   7.5  
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    31   7.5  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    30   8.0  
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    31   8.0  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    31   8.0  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    31   8.1  
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    31   8.2  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    30   8.3  
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    31   8.4  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    31   8.5  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    30   8.6  
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    31   8.7  
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      30   8.7  
KAFR0G01280 Chr7 (286915..288597) [1683 bp, 560 aa] {ON} Anc_3.9...    30   8.8  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    30   8.9  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    30   9.0  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    30   9.4  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    30   9.7  
YLR055C Chr12 complement(251272..253080) [1809 bp, 602 aa] {ON} ...    30   9.9  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    30   9.9  

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/414 (100%), Positives = 414/414 (100%)

Query: 1   MDLSDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPS 60
           MDLSDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPS
Sbjct: 1   MDLSDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPS 60

Query: 61  LTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRS 120
           LTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRS
Sbjct: 61  LTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRS 120

Query: 121 NIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGY 180
           NIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGY
Sbjct: 121 NIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGY 180

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT
Sbjct: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP
Sbjct: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI
Sbjct: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360

Query: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
           HAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDMLQ
Sbjct: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  508 bits (1307), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 238/388 (61%), Positives = 305/388 (78%), Gaps = 5/388 (1%)

Query: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE 88
           +PL   EEYDLWKSNVP+MYDFVSET L WPSLT++WLP S  +   RQE+ILGTHTSDE
Sbjct: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS--NRQEMILGTHTSDE 66

Query: 89  EQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILA 148
           EQNYLKIA + LP EV   +   E +EE ++SN+++ +KF+H++EVTRARYMPQD N++A
Sbjct: 67  EQNYLKIAAIYLPDEVVPDAEPKE-EEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIA 125

Query: 149 TISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVT 207
           TISG GT+Y+Y+R+NE ++  + T Q+H +NGYGL+FNP  KG LLSGSDDSN+ LWDVT
Sbjct: 126 TISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVT 185

Query: 208 SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR-ESKPVATINGTKP 266
               EP+  + + HSDIVNDC+WHNF +++FG+VSEDS+LQ+HD R     V  +   KP
Sbjct: 186 GKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKP 245

Query: 267 FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326
           +NTL+FS HS NL A  G +S VYLYDRR   +PLH+M GH DAVTSL+F  Q+DG+++S
Sbjct: 246 YNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLIS 305

Query: 327 AGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEE 386
           AG+D+R I+WD+ +IGAEQV +DA+D + EVMMIHAGHRS INDF++NP+IPWL A+AEE
Sbjct: 306 AGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEE 365

Query: 387 ENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
           ENIVQ+WK S KLPRI GTP V   +L+
Sbjct: 366 ENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  495 bits (1275), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/429 (55%), Positives = 325/429 (75%), Gaps = 22/429 (5%)

Query: 4   SDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTV 63
           +DP +LA   QLT  + +    DEN+ L   EEYDLWKSNVP+MYDFVSET+L WP+LTV
Sbjct: 14  ADPSMLA---QLTNQE-ETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTV 69

Query: 64  QWLPHS-APNPVT-RQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSN-----------L 110
           +WLP S +  PV+ RQELILGTHTS EE NYLKIA +DLP EV   S             
Sbjct: 70  EWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDED 129

Query: 111 TESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI 170
            +  +++ RSNI++ +KFKH+ E+TRAR+MPQ+ +I+ATI+G+GTV+IY++SN++ +A I
Sbjct: 130 EDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALI 189

Query: 171 -TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR---NEPVQKWENIHSDIVN 226
            TL++H +NGYGL+FNP  KG LLSGSDD  +ALWD+  +     +P++ W+++H+DIVN
Sbjct: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVN 249

Query: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA-TINGTKPFNTLSFSHHSENLLATGGV 285
           DC+W+ F  ++F +VSEDS+LQ+HD RE   +  +I  T PFNTL+FS HS+ L+A  G 
Sbjct: 250 DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309

Query: 286 NSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345
           +S VYLYD R +  PL+ M+GH D++T+L+FS   DG+++S+G D+RVI+WDINDIGAEQ
Sbjct: 310 DSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQ 369

Query: 346 VLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGT 405
           + +DAED   EV+MIHAGHRS +NDF+INP+IPWL+ASAEEENI+Q+WKCSHKLP + GT
Sbjct: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGT 429

Query: 406 PPVRVDMLQ 414
           P V V +L+
Sbjct: 430 PEVSVSILE 438

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  489 bits (1260), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/400 (58%), Positives = 302/400 (75%), Gaps = 16/400 (4%)

Query: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNP---VTRQELILGT 83
           + +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP     P     +QELI+GT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTE----SDEEQV---RSNIRVTRKFKHDSEVTR 136
           HTS EE+NYLK A ++LP EV +  N  E     DE  +   RSNIR+T K++H+ E+TR
Sbjct: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196
           ARYMPQDPN++ATI+G GTV++Y RS   D    TL++H DNGY L+F+PLIKGHLLSGS
Sbjct: 124 ARYMPQDPNMVATINGQGTVFLYSRS---DGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 197 DDSNVALWDVT--SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR- 253
           DD +VALWDV+  SD   P++ W+++HSDIVND +WHNF K LFGTVSEDS L+I+D R 
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 254 ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
           E+  + T    +PFNTL+FSHHS N+LA  G++S VYLYD R ++EPLH MSGH DAVT+
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373
           L+FS   DG+++S+G+D R+I+WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF +
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413
           N  +PWL+AS EEENI+Q+WKCSH LP + G P +  D++
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  482 bits (1240), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 298/404 (73%), Gaps = 12/404 (2%)

Query: 20  LQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPH----SAPNPVT 75
           +Q    D N+ L   EEY+LW+SNVP+MYDFVSETRL WPSL+++WLP      APN   
Sbjct: 11  VQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN--- 67

Query: 76  RQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTE---SDEEQVRSNIRVTRKFKHDS 132
           RQELI+GTHTS EE NYLKIA +DLP ++  ++   E     E   +SNI++ +KFKH+ 
Sbjct: 68  RQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEE 127

Query: 133 EVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGH 191
           E+TRARYMPQ+ N++ATI+G+G V++YDRS ++ +  + T +YH +NGYGL+FN    G 
Sbjct: 128 EITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK 187

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           LLSGSDD  +ALW+V +  + P+  W ++HSDIVNDC+W NF  ++FG+VSEDS+LQ+HD
Sbjct: 188 LLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247

Query: 252 TRESKPVAT-INGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
            RE     +      PFNTL+FS HS+ L A  G +S VYL+DRR +  PLH M+GH  A
Sbjct: 248 QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGA 307

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPIND 370
           VT+++FS   DGI++++G D+R IIWDI DIG EQ+ +DAED   EV+MIHAGHRS IND
Sbjct: 308 VTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAIND 367

Query: 371 FAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
           F++NP+IPWL+AS+EEENI+Q+WKCSHKLPR+ GTP V V  L+
Sbjct: 368 FSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  479 bits (1234), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 221/391 (56%), Positives = 290/391 (74%), Gaps = 6/391 (1%)

Query: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHT 85
           ++  PL   +EY+LWK+NVP+MYDFVSETRL WPSLT QWLP S  +  TRQ +ILGTHT
Sbjct: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED--TRQYMILGTHT 63

Query: 86  SDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPN 145
           S EE +YLK+A +DLP EV   +     D  + +SNI++ +KF+HD E+ RARYMP+D N
Sbjct: 64  SGEEVDYLKVAALDLPDEVV--TGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSN 121

Query: 146 ILATISGTGTVYIYDRSNER-DTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALW 204
           I+ATI+G G V IYDRS  R D    TL+YH +NGYGL+FNP +   L+SGSDD  +ALW
Sbjct: 122 IIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALW 181

Query: 205 DVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE-SKPVATING 263
           D+ S    P   W+NIHSDIVNDC WH+F ++LFG+VSEDS+L++HD R  SK + TI  
Sbjct: 182 DIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA 241

Query: 264 TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI 323
              FNTL+FS HS NL A  G+++ +YLYDRR   +PLH+M+GH DA+T L F  ++DGI
Sbjct: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301

Query: 324 ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVAS 383
           ++S GAD+RVI+WD+ +IGAEQ  ++A+D + E++MIHAGHRS INDF ++P+IPWL AS
Sbjct: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361

Query: 384 AEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
            EE+N+VQ+WKCS  L R+ GTP +   MLQ
Sbjct: 362 VEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  479 bits (1232), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 298/401 (74%), Gaps = 16/401 (3%)

Query: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP---HSAPNPVTRQELILG 82
           ++ +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP           +QELI+G
Sbjct: 3   NQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIG 62

Query: 83  THTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQV-------RSNIRVTRKFKHDSEVT 135
           THTS EE+NYLK A ++LP E+    +  E   E+        RSNIR+T K++H+ E+T
Sbjct: 63  THTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEIT 122

Query: 136 RARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSG 195
           RARYMPQDPNI+ATI+G GTV++Y RS   +    TL++H DNGY L+F+ L+KG LLSG
Sbjct: 123 RARYMPQDPNIVATINGQGTVFLYSRS---EGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179

Query: 196 SDDSNVALWDVTS--DRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR 253
           SDD  VALW+V S  D  +PV+ W ++HSDI+ND +WHNF K LFGTVSEDS L+I+D R
Sbjct: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239

Query: 254 ESKP-VATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVT 312
            +   + T+   +PFNTL+FSHHS NLLA  G++S VYLYD R ++EPLH MSGH DAV 
Sbjct: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299

Query: 313 SLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFA 372
           +L+FS+  DG+++S+G+D R+++WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF 
Sbjct: 300 NLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359

Query: 373 INPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413
           +NP IPWLVASAEEENI+Q+WKCSH LP + G P V  D++
Sbjct: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  477 bits (1227), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 230/400 (57%), Positives = 297/400 (74%), Gaps = 16/400 (4%)

Query: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNP---VTRQELILGT 83
           + +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP     P     +QELI+GT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGT 63

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTE--SDEEQV-----RSNIRVTRKFKHDSEVTR 136
           HTS EE+NYLK A ++LP E+ +  +  E   ++++V     RSNI++T K+KH+ E+TR
Sbjct: 64  HTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITR 123

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196
           ARYMPQ+P  +ATI+G GTV+IY RS    +   TL++H +NGY L+F+PL++G LLSGS
Sbjct: 124 ARYMPQNPGTVATINGQGTVFIYSRSEGLQS---TLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 197 DDSNVALWDVT--SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR- 253
           DD  VALWDV   SD   P++ W ++HSDIVND +WHNF K LFGTVSEDS L+I+D R 
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 254 ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
           E+    T    +PFNTL+FSHHS NLLA  G +S VYLYD R ++EPLH MSGH DAVT+
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373
           L+FS   DG+++S+G+D R+I+WD+  IGAEQ  +DAED   E++M+HAGH+S +NDF +
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413
           N  IPWLVAS EEENI+Q+WKCSH LP + G P V +DM+
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  474 bits (1220), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 292/389 (75%), Gaps = 5/389 (1%)

Query: 28  NRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSD 87
           ++PL   EEY+LW+SNVP+MYDFVSET L WP+LT++WLP ++ +   RQELILGTHTS+
Sbjct: 7   DKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHS--NRQELILGTHTSE 64

Query: 88  EEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNIL 147
           EE NYLKIA +DLP E+       E D    +SNI++ +KFKH+ EVTRARYMPQD N++
Sbjct: 65  EEPNYLKIAAIDLPDEIVPGKEDRERDG-FTKSNIKIIKKFKHEQEVTRARYMPQDSNLI 123

Query: 148 ATISGTGTVYIYDRSNERDTASIT-LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           ATI+G+GTV++YDRS + D   ++ L +H DNGYGL+FNP+ KG LLSGSDDS +ALWD+
Sbjct: 124 ATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDI 183

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA-TINGTK 265
           T++  +PV  WE+ H D VNDC+WH    + FG+VSED +LQ+HD R    V   I    
Sbjct: 184 TTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT 243

Query: 266 PFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIIL 325
            FNT++FS HS NL A  G +S +YLYD R     LH MSGH   VT+L+F +  DGI++
Sbjct: 244 AFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVM 303

Query: 326 SAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAE 385
           S+G D+RVI+WD+ +IGAEQV +DA+D + EV+MIHAGHRSP+NDF++NP+IPWL+ASAE
Sbjct: 304 SSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAE 363

Query: 386 EENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
           EENIVQ+WKCS KLPR+ G P V   +L+
Sbjct: 364 EENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  468 bits (1203), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/400 (55%), Positives = 292/400 (73%), Gaps = 16/400 (4%)

Query: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP---HSAPNPVTRQELILGT 83
           + + L   EEYDLWKSNVP+MYDFVSETRL WPSL+VQWLP     A     RQELI+GT
Sbjct: 30  QEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGT 89

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEE-------QVRSNIRVTRKFKHDSEVTR 136
           HTS EE+NYLK A +++P E+ +  +  E  EE         +SNIR+T K+ H+ E+TR
Sbjct: 90  HTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITR 149

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196
           ARYMPQ+P+ +AT++G GTV++Y RS    +   TL++H DNGY L+FN L++G LLSGS
Sbjct: 150 ARYMPQNPDFVATLNGQGTVFLYSRSGGLQS---TLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 197 DDSNVALWDVTSDRNE--PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE 254
           DD  VALW+V S+     PV+ W ++HSDIVND +WHNF + LFGTVSEDS L+I+D R 
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 255 SK-PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
               +  +   +PFNTL+FSHHS NLLA  G++S VYLYD R + EPLH MSGH DAVT+
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373
           ++FS+  DG+++S+G+D R+I+WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF +
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413
           N  IPWLVAS+EEENI+Q+WKCSH LP + G P V  D++
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/385 (55%), Positives = 290/385 (75%), Gaps = 5/385 (1%)

Query: 24  PSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGT 83
           P +E R L   EEY LWKSNVP+MYDFVSET+L WPSLTV+WLPH    P+T+QE+I+GT
Sbjct: 3   PQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGT 62

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143
           HTSD+E NY+KIA ++LP EV D  N++++    V+SN+R+T+KFK + E+TR+RYM QD
Sbjct: 63  HTSDQEPNYVKIASIELPNEVIDPHNVSDA---PVKSNVRITKKFKLEKEITRSRYMVQD 119

Query: 144 PNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVAL 203
           PNI++TI G GTV I+DR N  D+   T  YH DNGYGL+FNP+ KG LLS +DD  +A+
Sbjct: 120 PNIISTIDGNGTVSIFDR-NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178

Query: 204 WDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSED-SSLQIHDTRESKPVATIN 262
           +D+ ++  +PV+ W++  + I+ND +WH+F  +LFGTVSE+ ++L I+D R    V +I 
Sbjct: 179 YDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIE 238

Query: 263 GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG 322
             +PFN+L+FS HS+NL +  G +  VYLYD R   + LH MSGH   VT+L+F    DG
Sbjct: 239 MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG 298

Query: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVA 382
           I++S+  D+R+IIWD+ +IG+EQV EDA+DAT E+MMIHAGHRS +NDF++N SIPWL+A
Sbjct: 299 ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIA 358

Query: 383 SAEEENIVQLWKCSHKLPRISGTPP 407
           S EEENI+Q+WK S +LPRIS + P
Sbjct: 359 STEEENIIQVWKSSSRLPRISNSKP 383

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  457 bits (1175), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/396 (56%), Positives = 297/396 (75%), Gaps = 12/396 (3%)

Query: 28  NRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPV---TRQELILGTH 84
           N P+   EEY+LWKSNVPM+YDFVSETRL WP+LTV+WLP    N V   TRQ+LILGTH
Sbjct: 25  NEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQK--NLVAARTRQQLILGTH 82

Query: 85  TSDEEQNYLKIAVVDLPTEVTDTSN----LTESDEEQVRSNIRVTRKFKHDSEVTRARYM 140
           TS EEQNYLKI  VDLP EVT+ S     + E DE+ V SN+++ +KF HD E+TRARYM
Sbjct: 83  TSGEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYM 142

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDS 199
           PQD NI+ATI+G G ++IYDRS     A + TL+YHT+NGYGLAFN   K  LLSGSDDS
Sbjct: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202

Query: 200 NVALWDVTS-DRN-EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKP 257
           N+ALWD+++ ++N +P   +E+ H+DI+ND +WH+ +  +FG+VSEDS++++ D R S+ 
Sbjct: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQI 262

Query: 258 VATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS 317
           +  IN  KP+NTL+FS  S NL A  G ++ VYLYD R V  PL+ M+GH DAVT+++F 
Sbjct: 263 IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFD 322

Query: 318 SQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSI 377
             +DGI+ S+G+D+R I+WD+ +IGAEQ  ++ ED   EV+MIHAGH++ IND A+NP+I
Sbjct: 323 PNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNI 382

Query: 378 PWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413
            WLVASAEE+NIVQ+WKCS  +PRI G P V + +L
Sbjct: 383 NWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  451 bits (1160), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/391 (55%), Positives = 286/391 (73%), Gaps = 9/391 (2%)

Query: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTS 86
           +  PL   +EYDLWKSNVP++YDFVSETRL WPSLT+QWLP    +  TRQ LILGT TS
Sbjct: 7   QEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS--TRQHLILGTLTS 64

Query: 87  DEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNI 146
             E +YLKIA +DLP E+     + +  ++ V+SN++V +KF HD E+ RARYMPQ+ NI
Sbjct: 65  GAETDYLKIAALDLPDEII----IGKKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNI 120

Query: 147 LATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD 205
           +AT++G GT++IYD S ++ +A + TL+YH DN YGLAFNP  +G L+SGSDDS +ALWD
Sbjct: 121 IATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWD 180

Query: 206 VTSDR-NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES-KPVATING 263
            T+D+  +P+Q+W   HSDIVNDCQWH F  ++FG+VSEDS+LQ+ D R   K    I+ 
Sbjct: 181 ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISS 240

Query: 264 TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI 323
              +N+++FS  SENL A  G  + +YLYD R   + LH M+GH + VTSL+FS+  DGI
Sbjct: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300

Query: 324 ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVAS 383
           ++S  +D+RVI+WD+ +IGAEQ  ++A+D   EVMMIHAG RS IND + +PSIPWL AS
Sbjct: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360

Query: 384 AEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414
            EE NIVQ+WKCS KLPRISGTP V +  L+
Sbjct: 361 VEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  447 bits (1151), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 289/398 (72%), Gaps = 9/398 (2%)

Query: 18  IDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPN-PVTR 76
           ++ +++  DE+ PL   +EY+LWKSNV +MYDFVSET+L WPSL++QWLP    N P+ +
Sbjct: 2   MEYEEIEHDES-PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60

Query: 77  QELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTR 136
           QE+ILGTHTS +E NYLKIA +DLP EV    +  ++  E V+S I+VT+KF+H+ EV R
Sbjct: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPD-EDNSSEPVKSMIKVTKKFEHEDEVIR 119

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSG 195
           ARYMP++  I+ATI+G G ++IYDRS  +      TL YH DNGYGLAFNP I+G LLS 
Sbjct: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE- 254
           SDD+ VALWD+ S  + PV    N H+DIVND +WH F +++FGTVSED +LQ+HD R  
Sbjct: 180 SDDTTVALWDINS-TDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSL 237

Query: 255 SKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSL 314
           S     +   KP N L+FS HS+NL+A  G ++ VYLYD R + EPLH M+GH DAVTS+
Sbjct: 238 SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSI 297

Query: 315 DFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAIN 374
           +FSS  DGI+ S+G+D+R+ IWD+  IGAEQ  EDA+D   E+MM+HAGHRS INDF+ N
Sbjct: 298 EFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357

Query: 375 PSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDM 412
           P +PWL+ASAEE+N+VQ+WK S KL  +S   P   D+
Sbjct: 358 PQVPWLIASAEEDNVVQVWKISKKL--VSNIIPEYTDL 393

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  445 bits (1144), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 216/397 (54%), Positives = 286/397 (72%), Gaps = 14/397 (3%)

Query: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP-HSAPNPV-----TRQELILG 82
           +P   +EEYDLW SNVPMMYDFVSETRL WPSLTVQWLP    P  V      RQEL++G
Sbjct: 9   QPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIG 68

Query: 83  THTSDEEQNYLKIAVVDLPTEVTDTS-----NLTESDEEQVRSNIRVTRKFKHDSEVTRA 137
           T T+D E NYLKIA +DLP  VT +      +  E++    +S I++ RKFKH+ EVTRA
Sbjct: 69  TLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRA 128

Query: 138 RYMPQDPNILATISGTGTVYIYDRS-NERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSG 195
           RYMPQ PNI+AT++G G VYI+DR+  E+D  +I +  YH +NGYGLAFNP + G LLS 
Sbjct: 129 RYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSA 188

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES 255
           SDD  VALWDVTS  N+   +  ++H+DIVNDC+WH FQ SLFGTVSED++L IHDT   
Sbjct: 189 SDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSD 248

Query: 256 KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLD 315
           + +  ++ +  FNTL+FS  SENLLA  G +S VYLYD R +++PLH M+GH D+VTSL+
Sbjct: 249 RAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLE 308

Query: 316 FSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINP 375
           FS   DG++ S+G+D+R+I+WD+ +IGAEQ  +DA D   E+ M+H GHRSP+N+F+ N 
Sbjct: 309 FSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNS 368

Query: 376 SIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDM 412
           ++PWL+ S EEEN++Q+WK ++K+ R    PP   D+
Sbjct: 369 NVPWLMCSVEEENVLQIWKPANKIVR-PPQPPADFDI 404

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  433 bits (1113), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/382 (53%), Positives = 274/382 (71%), Gaps = 11/382 (2%)

Query: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHT 85
           +EN+ L   EEY+LWK+NVP+MYDFVSET+L WPSLT+QWLP ++ +  T+QE+ILGTHT
Sbjct: 5   EENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS--TKQEMILGTHT 62

Query: 86  SDEEQNYLKIAVVDLPTEV-------TDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRAR 138
           S E+ NYLKIA ++LP ++       T  S      +  V+S I++T+K KH+ E+TRAR
Sbjct: 63  SGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRAR 122

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDTASITLQ-YHTDNGYGLAFNPLIKGHLLSGSD 197
           +MPQDPN +ATI+G G V+++DRS +++ A ++   +H DNGYGL+FNP  KG LLS SD
Sbjct: 123 FMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSD 182

Query: 198 DSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKP 257
           D  +ALW+V      P  K    H DIVNDC WH F ++LFG+VSED +LQIHD R +  
Sbjct: 183 DGTIALWNVMGTNTSP-SKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNST 241

Query: 258 VATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS 317
           V  +  + PFNTL FS HS+NL A  G +S VYLYD R   + LH MSGH D+VTSL+FS
Sbjct: 242 VHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFS 301

Query: 318 SQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSI 377
              DGI+ S+G+D+RV++WD+  IG+EQ  EDA D   E+MM+HAGH+S +NDF+ N +I
Sbjct: 302 PHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNI 361

Query: 378 PWLVASAEEENIVQLWKCSHKL 399
           PWL+AS EE+NIV +WK S KL
Sbjct: 362 PWLMASVEEDNIVHVWKVSKKL 383

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  434 bits (1115), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/382 (54%), Positives = 271/382 (70%), Gaps = 14/382 (3%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLK 94
           EEY+LW SNVP+MY+FVSET+L WPSLT+QWLP    +P   Q LI GTHT+ EE NYLK
Sbjct: 46  EEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP--EQSLIFGTHTAGEEVNYLK 103

Query: 95  IAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTG 154
           +A ++LP  +       E DE    S+  +  KF H  EV RARYMP + NI+ATI+G G
Sbjct: 104 VATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKG 163

Query: 155 TVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEP 213
           T+ I+DR+ E   A + TL +H +NGYGLAFNP I G LLSGSDD+ VALWD+     E 
Sbjct: 164 TISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDI-----EA 218

Query: 214 VQKWENI---HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR-ESKPVATINGTKPFNT 269
            +K ++I   H DIVND +WH F+ ++FGTVSED +LQ+HD R   +PV  +    PFNT
Sbjct: 219 AKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT 278

Query: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329
           LSFS HS NLLA  GV+S++YLYD R +  PLH+MSGH D+VT+++FS   DGII S+G+
Sbjct: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338

Query: 330 DKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENI 389
           D+R IIWD+  IGAEQ  +DA+D   E+MM+HAGHRSP+N+F+ NP IPWL+AS EE+N+
Sbjct: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398

Query: 390 VQLWKCSHKLPRISGTPPVRVD 411
           +Q WK S KL  ++ +PP   D
Sbjct: 399 IQAWKVSMKL--VNASPPAISD 418

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/373 (55%), Positives = 274/373 (73%), Gaps = 11/373 (2%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLK 94
           EEYDLWKSNVP+MYDFVSET+L+WPSLT+QWLP +  +    QELILGTHTS  EQNYLK
Sbjct: 14  EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSN--DRSNEQELILGTHTSGTEQNYLK 71

Query: 95  IAVVDLPTEVTD-------TSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNIL 147
           IA V LP EV         +++ ++    Q +S I++ RKF+H  EVTRARY P +PN++
Sbjct: 72  IASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLI 131

Query: 148 ATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           ATISG+G V++YDRS + D+A +    +H +NGYGL F+ +  G LLS SDD ++A+WDV
Sbjct: 132 ATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV 191

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKP 266
            S +N PV K +  H++IVN+C+WH     LFG+VS+DS+L IHD R  KPV  I  ++P
Sbjct: 192 CSGKNTPV-KVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEP 250

Query: 267 FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326
           +NTL+FS HS NL A  G +S+V LYD R  E P+H MSGH D+VTSL+F+   DGI+ S
Sbjct: 251 YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS 310

Query: 327 AGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEE 386
             +D+RV+IWD+  IGAEQ  EDA+D   E++M+HAGH+SP+NDF+ +P+IPWL+AS EE
Sbjct: 311 GSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEE 370

Query: 387 ENIVQLWKCSHKL 399
           EN+VQ+WK S KL
Sbjct: 371 ENVVQIWKASKKL 383

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  407 bits (1047), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/377 (53%), Positives = 271/377 (71%), Gaps = 9/377 (2%)

Query: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE 88
           R L   +EYDLWKSNVP+MYDFVSETRL+WPSLT+QWLP +  +  T QEL++GTHTSD 
Sbjct: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS--TEQELLVGTHTSDS 65

Query: 89  EQNYLKIAVVDLPTEVTDT-----SNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143
           EQNYLKIA ++LP E+         N     +EQV S I++ +KFKH++EVTRARY P D
Sbjct: 66  EQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFD 125

Query: 144 PNILATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVA 202
            N++ATISGTGTV++YDR+ + + A      YH +NGYGL F+    G L+S SDD ++A
Sbjct: 126 SNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIA 185

Query: 203 LWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATIN 262
           +WD+ S +  P     ++HSDIVN+C+WH    +++G+VSEDS L IHD R  KP+  + 
Sbjct: 186 IWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPLQKLL 244

Query: 263 GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG 322
             +PFNT++FS HS NL A  G ++ VYL+D R   E LH MSGH +AVTSL+F+   DG
Sbjct: 245 QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDG 304

Query: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVA 382
           I+ S G+D+RV++WD+  IG EQ  EDA+D   E++M+HAGH+S INDF+ +P++PWL+A
Sbjct: 305 ILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMA 364

Query: 383 SAEEENIVQLWKCSHKL 399
           S EEENIVQ+WK S KL
Sbjct: 365 SVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 268/386 (69%), Gaps = 17/386 (4%)

Query: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPN--PVTRQELILGT 83
           +E  PL   +EY+LWKSNVP++YDFVSET+LVWPSLTV+WLP +     P   Q L+LGT
Sbjct: 15  EEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGT 74

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143
           HTS EEQNYLKIA + LP ++ +      SD+  V+SNIR+ +KFKH+ EVTRA YMPQD
Sbjct: 75  HTSGEEQNYLKIAEITLPDQIINEKTEDNSDK-HVKSNIRIIKKFKHELEVTRAHYMPQD 133

Query: 144 PNILATISGTGTVYIYDRS---NERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
             I+ATI+G GTV+IYD S   N+ +     L +H +NGYGLAFNPL KG LLS SDD +
Sbjct: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES----K 256
           VA W++   ++ P+   +   + I+ND +W+ F ++LFG V+E S L + D R +    K
Sbjct: 194 VAYWNI--QKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249

Query: 257 PVAT--INGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSL 314
            V+   I     FN ++FS HSE L+A  G +S +YLYD R + +PLH M GH D+VTSL
Sbjct: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309

Query: 315 DFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-TSEVMMIHAGHRSPINDFAI 373
           DF + +DGI++S G+DKRV +WD+  IG EQ  ++ ED    E++MIHAGHRSPINDF++
Sbjct: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369

Query: 374 NPSIPWLVASAEEENIVQLWKCSHKL 399
           + ++ WL AS EE+NIVQ+WK ++ L
Sbjct: 370 SNNLNWLCASIEEDNIVQVWKMNNSL 395

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  145 bits (367), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 111/413 (26%), Positives = 189/413 (45%), Gaps = 65/413 (15%)

Query: 32  DPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQN 91
           D  + Y  WK N  ++YD+++     WPSLT Q+ P    +  T + L+L T TS +  +
Sbjct: 12  DLQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHR-LLLSTFTSSQIPD 70

Query: 92  YLKIAVVDLPT-EVTDTSNLT--ESDEEQVRSNIRVTRKFKH----------DSEVTRAR 138
              I +  + T    D S+L   + DE + + + R+    K+          + +  +AR
Sbjct: 71  DESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKAR 130

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNG------------------- 179
           YMPQ+P+I+   S  G +YI+DR+      S T      +G                   
Sbjct: 131 YMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDG 190

Query: 180 --------YGLAFNPLIKGHLLSGSDDSNVALWDVT---SDRNEPVQK--WENIHSDI-V 225
                     +A+NP  +G LLS   + N+ LWD     S +N  +    W+    D+  
Sbjct: 191 TKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGC 250

Query: 226 NDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI---NGTKPFNTLSFSHHSENLLAT 282
           N+  W N   S+F T  E++ + + DTR+   V +I   N     N+  F++ +  LLA+
Sbjct: 251 NEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLAS 310

Query: 283 GGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDI 341
           G  N  + L+D R + +P+  +  H  +++++++S   + +I S G  D  V +WDI++ 
Sbjct: 311 GDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISN- 368

Query: 342 GAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                         E + IH GH   IND + +   PWL+ S   +N +Q+WK
Sbjct: 369 ------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  136 bits (342), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/426 (26%), Positives = 195/426 (45%), Gaps = 62/426 (14%)

Query: 18  IDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPH-SAPNPVTR 76
           +D Q        P +  + Y  WK N  ++Y++++     WPSLT Q+ P  +  N   R
Sbjct: 6   MDEQPFEQSSAIPKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHR 65

Query: 77  QELILGTHTS-----DEEQNYLKIAVVD-LPTEVTDTSNLTESDEEQVRSNIRVTRK--- 127
             ++L + TS     DE     +I+ +  L     +  +L E + +   SNI++  K   
Sbjct: 66  --ILLSSFTSSLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLT 123

Query: 128 ------FKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDT-----ASITLQYHT 176
                 F  + +  RARY+PQ+P+++A  S  G+VYI+DR+          +  T  Y  
Sbjct: 124 TELVIRFP-NGDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQA 182

Query: 177 D----------NGYGLA----FNPLIKGHLLSGSDDSNVALWDVTS-DRNEPVQKWENIH 221
                      NG   A    +N   +GHL+    D +V  WD+T   R++PV K    +
Sbjct: 183 KLAVNNNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYN 242

Query: 222 SDI----VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT---KPFNTLSFSH 274
             +     ND  W     SLF   SED+ L + DTR+   +  I+ +      N   F+ 
Sbjct: 243 YKLDESGCNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNP 302

Query: 275 HSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI 334
            +  LLA+G     + L+D R  E P++++  H  ++++++++     ++ SAG D  ++
Sbjct: 303 RNSLLLASGDSIGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLV 361

Query: 335 -IWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
            +WD                + + + IH GH   +ND + N   PWL+ S  ++N +Q+W
Sbjct: 362 KLWDA--------------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIW 407

Query: 394 KCSHKL 399
           K +H L
Sbjct: 408 KPAHNL 413

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  132 bits (333), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 96/395 (24%), Positives = 184/395 (46%), Gaps = 43/395 (10%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE------ 88
           + Y  WK N  ++YD+++     WPSL+ Q+ P        +Q ++L + TS +      
Sbjct: 22  QRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTN-DKQRILLSSFTSQQLPQDES 80

Query: 89  -------EQNYLK---IAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRAR 138
                    N++K   I   D+        N  + +++ +   +R+T     D +  R R
Sbjct: 81  IYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGDCNRCR 137

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT----------DNGYGLAFNPLI 188
           YMPQ+P+I+ T S  G+VYI+DR+   +  S   ++            D    LA+N  +
Sbjct: 138 YMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQL 197

Query: 189 KGHLLSGSDDSNVALWDVT-----SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           +G L +   +  V +WD+T       R E  ++   + ++ VND  W     S+  +  E
Sbjct: 198 EGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGE 257

Query: 244 DSSLQIHDTRESKPVATINGTK---PFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
            + + + D R+   + T++ T      N + F++ ++ +L TG    ++ ++D R  +EP
Sbjct: 258 SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFKEP 317

Query: 301 LHLMS-GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMM 359
           +     G  D ++++ ++ Q   I+  A AD++  +  I D   EQ  ED+    + ++ 
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQIL--ATADQQSGLVKIWDASGEQ--EDSNAENNMLLF 373

Query: 360 IHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
           +H GH   +ND + +   PW + S   +N + +WK
Sbjct: 374 VHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWK 408

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  127 bits (319), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 107/412 (25%), Positives = 185/412 (44%), Gaps = 55/412 (13%)

Query: 30  PLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE- 88
           P D  + Y  WK N  ++YD+++     WPSLT Q+ P       T + LI  + TS + 
Sbjct: 14  PNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILI-SSFTSSQL 72

Query: 89  -EQNYLKIAVVDLPTEVTDTS-NLTESDEEQVRSNIRVTRKFKH----------DSEVTR 136
            E   + I+ +     +   S N  + DE + + +  +    KH          + +  R
Sbjct: 73  PEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFPNGDCNR 132

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNE-----RDTASIT---------------LQYHT 176
           ARY+PQ+P+++A  S  G+VYI+DR+       R + ++                L  +T
Sbjct: 133 ARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHENT 192

Query: 177 DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSD-RNEPV--QKWENIHSDI--VNDCQWH 231
           +    LA+N   +G L S      V +WD+     + PV  +   NI  D   VND  W 
Sbjct: 193 NEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALGVNDVSWM 252

Query: 232 NFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK---PFNTLSFSHHSENLLATGGVNSE 288
               SLF    E  +L + D R  K V+ I   +     N+  F++ +  LLA+      
Sbjct: 253 PSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLASADSEGL 312

Query: 289 VYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIGAEQVL 347
           V ++D R +++       H  ++++++++   D II +AG  D  V +WD+         
Sbjct: 313 VNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDV--------- 363

Query: 348 EDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
               +  +E++ +H GH   +ND + +    WL+ S   +N +Q+WK +H L
Sbjct: 364 ---SNTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  127 bits (318), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 105/396 (26%), Positives = 177/396 (44%), Gaps = 51/396 (12%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTS----DEEQ 90
           + Y  WK N  ++Y++++     WPSLT Q++P        +  ++L + TS    ++E 
Sbjct: 23  QRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP-DMDIASDKHRILLSSFTSAQLPEDEA 81

Query: 91  NYLK-------IAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKH-DSEVTRARYMPQ 142
            Y+        IA   L     +       ++ ++  N+  T K +  + +  RARYMPQ
Sbjct: 82  IYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRARYMPQ 141

Query: 143 DPNILATISGTGTVYIYDR----SNERDTASITLQYHTD----------NGYGLAFNPLI 188
           +P+++A+ S  G+VYI+DR    SN       T +Y  +              LA+N   
Sbjct: 142 NPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAWNYQR 201

Query: 189 KGHLLSGSDDSNVALWDVTSDRNE------PVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
            G L +   D +V +WD+T           P  +W+ +  +  N+  W     S+     
Sbjct: 202 SGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQ-VDKEGANEVSWMVHHSSILAVCG 260

Query: 243 EDSSLQIHDTRESKPVATIN---GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEE 299
           E + L I DTR     +T      T   N + F++ ++ LL +      + + D R +E 
Sbjct: 261 EGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQLEH 320

Query: 300 PLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIGAEQVLEDAEDATSEVM 358
           P+   S H DAV+++ ++ +   +I SAG  D  V IWD+         ED       ++
Sbjct: 321 PVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-------AQED-----DPLV 367

Query: 359 MIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
            IH GH   +ND A N   PW++ S   +N V +WK
Sbjct: 368 FIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  127 bits (318), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 190/422 (45%), Gaps = 59/422 (13%)

Query: 17  GIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR 76
           G+DL  +P +          Y  WK N  ++YD+++     WPSLT Q+ P        +
Sbjct: 20  GLDLPTIPEE------VQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTNDQ 72

Query: 77  QELILGTHTSDEEQNYLKIAVVDLPT-EVTDTSNLTESDEEQVRSNIRVTRKFKHDS--- 132
             L+L + TS +      I V  + T +    S+L   D +++   +  + K    +   
Sbjct: 73  HRLLLSSFTSSQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIK 132

Query: 133 ---------EVTRARYMPQDPNILATISGTGTVYIYDRSN---------------ERDTA 168
                    +   ARY+PQ+P+++A  S  G++Y++DR+                E +  
Sbjct: 133 ELNISFPMGDCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQ 192

Query: 169 SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTS-DRNEPV-QKWENIHS---D 223
           S +L+ H +    LA+N   +G L +     +V +WDV    RN PV  K +  H+    
Sbjct: 193 SSSLEEHQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPR 251

Query: 224 IVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA-----TINGTKPFNTLSFSHHSEN 278
             ND  W     S+     E +S+ + DTR  K V      T + ++  N+  F++H++ 
Sbjct: 252 GCNDVSWMVNHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDM 311

Query: 279 LLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWD 337
           LL +G     V L+D R +E PL  +  H  +++   ++     I+ +A  +D  V +WD
Sbjct: 312 LLCSGDSTGRVNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWD 370

Query: 338 INDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSH 397
           I           A++   E++ +H GH   +ND + N   PWL+ S   +N VQLW+ + 
Sbjct: 371 I-----------AQEPGEELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPAR 419

Query: 398 KL 399
            L
Sbjct: 420 NL 421

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  126 bits (317), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 107/404 (26%), Positives = 181/404 (44%), Gaps = 52/404 (12%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE--EQNY 92
           + Y  WK N  ++YD+++     WPSLT Q++P     P  +  L+L + TS +  E   
Sbjct: 23  QRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP-DLEVPTDKHRLLLSSFTSSQLPEDEA 81

Query: 93  LKIAVVDLPTEVTDTS-NLTESDEEQVR---------SNIRVTRKFKHDS-EVTRARYMP 141
           + I+ +     V  +S N  + DE + +          N+  T + +  S +  RA YMP
Sbjct: 82  VYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYMP 141

Query: 142 QDPNILATISGTGTVYIYDRSNER--------DTASITLQYHTDNGYG---------LAF 184
           Q+P+I+  I+ TG V I+DR+             AS  +Q +     G         LA+
Sbjct: 142 QNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLAW 201

Query: 185 NPLIKGHLLSGSDDSNVALWDVTS-DRNEPVQKWENIH----SDIVNDCQWHNFQKSLFG 239
           N    G + S   +  + +WD+T   +++P      +         ND  W     S+  
Sbjct: 202 NWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSILA 261

Query: 240 TVSEDSSLQIHDTRES---KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRY 296
              E +++ + DTR     KP      T   N L F++ ++ LL     N  + L+D R 
Sbjct: 262 ACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCRA 321

Query: 297 VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWDINDIGAEQVLEDAEDATS 355
             +PL + + H D+V++L ++     I+ +AG  D  + IWD +         + ED+  
Sbjct: 322 FSKPLSVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTS--------REPEDS-- 370

Query: 356 EVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
            ++ +H GH   +ND A N   PWL+ S   +N V +WK +  L
Sbjct: 371 -LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  123 bits (308), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/414 (26%), Positives = 182/414 (43%), Gaps = 65/414 (15%)

Query: 30  PLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEE 89
           P+D  E Y  WK N  ++YD+++     WPSLT Q+ P           ++L + TS ++
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTSDEHRILLSSFTSSQK 74

Query: 90  QNYLKIAVVDLPT-EVTDTSNLTESDEEQVRSNIRVTRKF--KH----------DSEVTR 136
                I +  + T      S+L   D +++      + +F  KH          + E  R
Sbjct: 75  PEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNR 134

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDT----ASITLQYHT---------------- 176
           ARY+PQ+P+I+A  S  G +YI+DR+    T    + I+  + T                
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMD 194

Query: 177 ------DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-PVQKWE--NIHSD--IV 225
                 +    LA+N   +  LLS   +  V +WD+    +E P+      +I+SD   V
Sbjct: 195 TSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAV 254

Query: 226 NDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK---PFNTLSFSHHSENLLAT 282
           ND  W     SLF   +E +++ + D R  K     N  K     N+  F++ +  +LA+
Sbjct: 255 NDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILAS 314

Query: 283 GGVNSEVYLYDRRYV-EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDIND 340
              N  + L+D R + + P+  M  H  +V++L++S   D ++ +AG  D  V +WD   
Sbjct: 315 ADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT-- 371

Query: 341 IGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                       +  E +  H GH   +ND + +   PWL+ S   +N V +WK
Sbjct: 372 ------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 192/429 (44%), Gaps = 63/429 (14%)

Query: 15  LTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPV 74
           ++ I+ + +P   + P D  + Y  WK N  ++YD+++     WPSLT Q+  H      
Sbjct: 1   MSAIEEEHVPQ-SSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF-HDLDTTS 58

Query: 75  TRQELILGTHTSDEEQNYLKIAVVDLPT----EVTDTSNLTESDEEQVR--SNIR----- 123
               ++L   TS +      I +  L T    E    +N  + DE + +  +NI+     
Sbjct: 59  DTHRILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNF-DMDEMEFKPENNIKLPSKN 117

Query: 124 ----VTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNE---RDTASITLQYH- 175
               ++ +F  D +   ARY+PQ+P+++A  S  G++YI+DR+     R   S  L+ + 
Sbjct: 118 LTNDISIRFP-DGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYE 176

Query: 176 ---------------TDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQK---W 217
                          T+    +++N   +G L S      + LWD+    N  ++     
Sbjct: 177 AALYCPPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPL 236

Query: 218 ENIHSDI--VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATIN---GTKPFNTLSF 272
            N+  D   VND  WH    S+     E + + + D R    +   N        N+  F
Sbjct: 237 LNVDFDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKF 296

Query: 273 SHHSENLLATGGVNSEVYLYDRRYVE-EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADK 331
           + H ++LL +G     + L+D R ++ EP+  +  H  ++++L+++   + I+ SAG D 
Sbjct: 297 NSHCDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDD 355

Query: 332 RVI-IWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIV 390
            ++ +WD+              +T E++  H GH   +ND + N    WL+ S   +N V
Sbjct: 356 GLVKLWDV--------------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSV 401

Query: 391 QLWKCSHKL 399
           Q+WK +H L
Sbjct: 402 QVWKPAHNL 410

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  120 bits (302), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 112/426 (26%), Positives = 186/426 (43%), Gaps = 64/426 (15%)

Query: 32  DPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQN 91
           D    Y  WK N  ++YD+++     WPSLT Q+ P    N  T + ++L ++TS +   
Sbjct: 14  DLQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHR-ILLSSYTSCQLPE 72

Query: 92  YLKIAVVDLPTEV-TDTSNLTESDEEQVRSNIRVTRKFKHDSEVT------------RAR 138
              + V  + T    D ++L   D +++      T KF   +  T            RAR
Sbjct: 73  DENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGDCNRAR 132

Query: 139 YMPQDPNILATISGTGTVYIYDRSN--------------ERDTASITLQYHTD------- 177
           YMPQ+P+++A  S  G VY+++R+               E+D      +++ +       
Sbjct: 133 YMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARR 192

Query: 178 -----NGYGLAFNPLIKGHLLSGSDDSNVALWDV----TSDRNEPVQKWE--NIHSDIVN 226
                    LA+N   +G L        V +WD+      +      +WE  N  S  VN
Sbjct: 193 TPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVN 252

Query: 227 DCQWHNFQKSLFGTVSEDS-SLQIHDTRESKPVATING---TKPFNTLSFSHHSENLLAT 282
           D  W +   S+     E S SL + DTR    VA I     ++  N   F+  +  LLA+
Sbjct: 253 DVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLAS 312

Query: 283 GGVNSEVYLYD-RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWDIND 340
                   L+D R+   EP+ +   H  +V++L+++  D  ++ +AG +D  + IWD + 
Sbjct: 313 TDSTGRTNLWDVRKLSAEPI-VHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTS- 370

Query: 341 IGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLP 400
                 LE  ED T   + +H+GH   +ND A +   PWL+ S   +N V +WK +  L 
Sbjct: 371 ------LE-IEDKT---IFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLV 420

Query: 401 RISGTP 406
           +   +P
Sbjct: 421 QRCTSP 426

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  119 bits (298), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/410 (24%), Positives = 182/410 (44%), Gaps = 53/410 (12%)

Query: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTS 86
           E  P D  + Y LWK N  ++YD+++     WPSL+ Q+ P    +  T + L     +S
Sbjct: 2   ETIPEDRQQRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSS 61

Query: 87  DEEQN-YLKIAVVDLPTEVTDTS-NLTESDEEQVRSN-----------IRVTRKFKHDSE 133
              Q+  + IA +     V  +S N  + DE + + +           I++T  F H  +
Sbjct: 62  QLPQDENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GD 120

Query: 134 VTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQ-------YHTDNG------Y 180
             RA Y+PQ+P++++T S  G+VYI+DR+    +    L+          +NG       
Sbjct: 121 CNRATYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETV 180

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTS--DRN----EPVQKWENIHSDIVNDCQWHNFQ 234
            L +N  I+G L S   +  + +WD+     RN    +P   + +  S   ND  W    
Sbjct: 181 ALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSH 240

Query: 235 KSLFGTVSEDSSLQIHDTRESKPVA----TINGTKPFNTLSFSHHSENLLATGGVNSEVY 290
             L     ED+ + + DTR +  +A    + N     N   F+     L+AT   +  V 
Sbjct: 241 DCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQ 300

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIGAEQVLED 349
           L+D R +  P+  ++  +  +++L+++ Q   ++ + G  D  V +W+ ++         
Sbjct: 301 LWDIRKLHNPIKTINCES-PLSALEWNPQLPTVLATGGQEDGLVKLWNASN--------- 350

Query: 350 AEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
                 +++  H GH   +ND A +P   WL+ S   +N   LWK + +L
Sbjct: 351 -----GQLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 105/419 (25%), Positives = 193/419 (46%), Gaps = 66/419 (15%)

Query: 30  PLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE- 88
           P D  E Y  WK N  ++Y +++     WPSLT Q+ P       T + ++L T TS + 
Sbjct: 13  PDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHR-ILLSTFTSSQL 71

Query: 89  -EQNYLKIAVVDLPTEVTDTS-NLTESDEEQVRS-----------NIRVTRKFKHDSEVT 135
            E   L IA +     +  +S N  + DE + +            N+ ++  F  + +  
Sbjct: 72  PEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFP-NGDCN 130

Query: 136 RARYMPQDPNILATISGTGTVYIYDR---------SNERDTASITLQYHTDN-------- 178
           RARY+PQ+P++LA  S  G++YI++R         SN+R   +    Y TD         
Sbjct: 131 RARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEA--RLYSTDKMDENFTNS 188

Query: 179 --GYGLAFNPLIKGHLLSGSDDSNVALWDVTS-DRNEPVQKWEN-----IHSDIVNDCQW 230
                +A+N    G L S     ++ +WD+T    ++P  + EN        +  N+  W
Sbjct: 189 NEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLR-ENELTIPFDPEGCNEVTW 247

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATIN---GTKP--FNTLSFSHHSENLLATGGV 285
                S+F   SE + L + D R  + +  +    GT     N+  F+++++ LLA+   
Sbjct: 248 MVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADS 307

Query: 286 NSEVYLYD-RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI-IWDINDIGA 343
             ++ ++D R+  +EP+   + H  ++++L+++   + I+++AG D  ++ IWD      
Sbjct: 308 TGKINMWDIRKLDKEPIKSFN-HNSSISTLEWNPNLETILVTAGQDDGLVKIWDT----- 361

Query: 344 EQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRI 402
                    A  + + +H GH   +ND + +   PWL++S   +N + +WK +  L  I
Sbjct: 362 ---------ANGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNLVDI 411

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  118 bits (296), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 178/421 (42%), Gaps = 65/421 (15%)

Query: 28  NRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSD 87
           N P+D  E Y  WK N  ++YD+++     WPSLT Q+ P      +    ++L + TS 
Sbjct: 14  NIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTLDEHRILLSSFTSS 72

Query: 88  EEQNYLKIAVVDLPT-EVTDTSNLTESDEEQVRSNIRVTRK------------FKHDSEV 134
           ++     I +  + T      S+L   D +++      T +            F  + + 
Sbjct: 73  QKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDC 132

Query: 135 TRARYMPQDPNILATISGTGTVYIYDRSNERDT--------------------------A 168
            RARY+PQ+P+I+A  S  G +YI+DR+    T                          A
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEA 192

Query: 169 SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-PV--QKWENIHSDI- 224
             T     +    LA+N   +  LLS   +  V +WD+    +E P+      +I SD  
Sbjct: 193 MDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDAS 252

Query: 225 -VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING---TKPFNTLSFSHHSENLL 280
            VND  W     SLF   +E + + + D R  K     N    T   N+  F++ +  +L
Sbjct: 253 GVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVL 312

Query: 281 ATGGVNSEVYLYD-RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWDI 338
           A+   N  + L+D R+  E P+  M  H  ++++L+++     ++ +AG  D  V +WD 
Sbjct: 313 ASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWDT 371

Query: 339 NDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
                         A  E +  H GH   +ND + +   PWL+ S   +N V +WK +  
Sbjct: 372 --------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAEN 417

Query: 399 L 399
           L
Sbjct: 418 L 418

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 32  DPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSD--EE 89
           D  E Y  WK N  ++YD+++     WPSL+ Q+             ++L + TS    E
Sbjct: 22  DLQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF-QDVNTKNDSHRILLSSFTSGLMPE 80

Query: 90  QNYLKIAVVDLPTEVTDTS-NLTESDEEQVR--SNIRVTRKFKH--------DSEVTRAR 138
           Q  + I  +     V   S N  + DE + +  +N+++  K  H        + +  RAR
Sbjct: 81  QESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRAR 140

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT-------------------DNG 179
           Y+PQ+ +I+A  S  GTVYI++R+    T   T  + +                   +  
Sbjct: 141 YLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEA 200

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-------------VN 226
             + +N   +G L +   D  +  WD+        +K+ N ++ I              N
Sbjct: 201 LSIDWNVQREGLLAASYSDGEIKTWDL--------KKFSNANTTITTPTVSIMMDTNGAN 252

Query: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT---KPFNTLSFSHHSENLLATG 283
           D  W     SL     E + L I+D R S+   TI+        N   F++ +  ++A+ 
Sbjct: 253 DVTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASA 312

Query: 284 GVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI-IWDINDIG 342
                V+++D R   E +  +  H  ++++++++   D I+ +AG D  ++ +WD+ D  
Sbjct: 313 DTVGNVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD-- 369

Query: 343 AEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
                       SE++  H GH   +ND + N   PWL+ S   +N VQ+W+ +H L
Sbjct: 370 ------------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  116 bits (290), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/407 (23%), Positives = 176/407 (43%), Gaps = 57/407 (14%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE--EQNY 92
           + Y  WK N  + YD+++     WPSLT Q  P           ++L + TS +  E   
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP-DLDLATDEHRILLSSFTSSQVPEDES 81

Query: 93  LKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDS------------EVTRARYM 140
           L +A +     +   S+L   D E+    +  + K    S            +  +ARY 
Sbjct: 82  LYVARLSSMKHIP-WSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYC 140

Query: 141 PQDPNILATISGTGTVYIYDRSNER----------DT-------ASITLQYHTDNGYGLA 183
           P +P+++ + S  G++Y++DR+             DT        S +L+ H +    LA
Sbjct: 141 PSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLA 200

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTS-DRNEPVQ----KWENIHSDIVNDCQWHNFQKSLF 238
           +N   +G L +      V +WD+   D+N P          +     N+  W     SL 
Sbjct: 201 WNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLL 260

Query: 239 GTVSEDSSLQIHDTRESKPVATINGTKP-----FNTLSFSHHSENLLATGGVNSEVYLYD 293
              SED+ + I D R  +   + +G+ P      NT  F++H + LL +      + L+D
Sbjct: 261 AYCSEDNLVGIMDIRNPEKGQS-SGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWD 319

Query: 294 RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI-IWDINDIGAEQVLEDAED 352
            R   +PL  +  H D+++ L ++ ++  ++ + G D  ++ IWD+           ++ 
Sbjct: 320 IRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDL-----------SQP 367

Query: 353 ATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
              E++  H GH   +ND + +P   W++ S   +N +Q+W+ S+ L
Sbjct: 368 EGQELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  115 bits (288), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 105/412 (25%), Positives = 175/412 (42%), Gaps = 65/412 (15%)

Query: 32  DPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE--E 89
           D  E Y  WK N  ++YD+++     WPSLT Q+ P      +    ++L + TS +  E
Sbjct: 18  DLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTLNEHRILLSSFTSSQKPE 76

Query: 90  QNYLKIAVVDLPTEVTDTS-NLTESDEEQVRSNIRVTRKFKH----------DSEVTRAR 138
              + I+ +     +   S N  + DE + +     T   KH          + E  RAR
Sbjct: 77  DETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRAR 136

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDT----ASITLQYH------------------- 175
           Y+PQ+P+I+A  S  G +YI+DR+    T    + I+  +                    
Sbjct: 137 YLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTS 196

Query: 176 ---TDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTS-DRNEPV--QKWENIHSD--IVND 227
               +    LA+N   +  LLS   +  + +WD+     + P+      +I SD   VND
Sbjct: 197 LVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVND 256

Query: 228 CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT---KPFNTLSFSHHSENLLATGG 284
             W     SLF   +E +++ + D R  K     N        N+  F++ +  +LA+  
Sbjct: 257 VTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILASAD 316

Query: 285 VNSEVYLYDRRYV-EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIG 342
            N  + L+D R + E P+  M  H  +V++L++S   D ++ +AG  D  V +WD     
Sbjct: 317 SNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDT---- 371

Query: 343 AEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                        E +  H GH   +ND + +   PWL+ S   +N V +WK
Sbjct: 372 ----------TREESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 97/412 (23%), Positives = 180/412 (43%), Gaps = 57/412 (13%)

Query: 30  PLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE- 88
           P D  + Y  WK N  ++Y++++     WPSLT Q  P           ++L + TS + 
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP-DLDLAGDEHRILLSSFTSSQL 76

Query: 89  -EQNYLKIAVVDLPTEVTDTS-NLTESDEEQVR---------SNIRVTRKFKHDS-EVTR 136
            E   + +A +     +  +S N  ++DE + +          NI    + K  + +  +
Sbjct: 77  PEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNK 136

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTA-----------------SITLQYHTDNG 179
           ARY P +P+++++ S  G+VY++DR+                       S +L+   +  
Sbjct: 137 ARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEA 196

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTS-DRNEPVQKWENIHSDIV------NDCQWHN 232
             LA+N   +G L +      V +WD+   D+  P     + HS ++      ND  W  
Sbjct: 197 LNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLI--DPHSSLLADPQGSNDISWMV 254

Query: 233 FQKSLFGTVSEDSSLQIHDTRESK----PVATINGTKPFNTLSFSHHSENLLATGGVNSE 288
              SL     E ++L + DTR +K      +  + +   N   F+++ + LL +      
Sbjct: 255 NHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGR 314

Query: 289 VYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI-IWDINDIGAEQVL 347
           + L+D R    P+  +  H  +V++L ++     I+ +AG D  ++ IWD+         
Sbjct: 315 INLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDL--------- 364

Query: 348 EDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
             ++    E+   H GH   +ND + +P+ PW++ S   +N +QLWK S  L
Sbjct: 365 --SQPVDQELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  114 bits (286), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 181/416 (43%), Gaps = 65/416 (15%)

Query: 28  NRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSD 87
           N P +  E Y  WK N  ++Y++++     WPSLT Q+ P      +    ++L + TS 
Sbjct: 14  NIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP-DLDTTLDEHRILLSSFTSS 72

Query: 88  E--EQNYLKIAVVDLPTEVTDTS-NLTESDEEQVRSNIRVTRKFKH----------DSEV 134
           +  E   + I+ +     +  +S N  + DE + +         KH          + E 
Sbjct: 73  QKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGEC 132

Query: 135 TRARYMPQDPNILATISGTGTVYIYDRSNERDT----ASITLQYHT-------------- 176
            RARY+PQ+P+I+A  S  G +YI+DR+    T    + I+  +                
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVET 192

Query: 177 --------DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-PVQKWE--NIHSDI- 224
                   +    +A+N   +  LLS   +  V +WD+    +E P+      +I+SD  
Sbjct: 193 MDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGS 252

Query: 225 -VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING---TKPFNTLSFSHHSENLL 280
            VND  W     SLF   +E +++ + D R  K     N        N+  F++ +  +L
Sbjct: 253 GVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLIL 312

Query: 281 ATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDI 338
           A+   N ++ L+D R + + PL  M  H  +V++L++S   D ++ +AG  D  V +WD 
Sbjct: 313 ASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDT 371

Query: 339 NDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                         +  E +  H GH   +ND + +   PWL+ S   +N V +WK
Sbjct: 372 --------------SREENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  112 bits (280), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 99/408 (24%), Positives = 176/408 (43%), Gaps = 61/408 (14%)

Query: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE--EQNY 92
           + Y  WK N  ++YD+++     WPSLT ++ P           L+L + TS +  E   
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP-DLDTTTDSHRLLLSSFTSSQLPEDES 75

Query: 93  LKIAVVDLPTEVTDTS-NLTESDEEQVR---SNIRVTRKFKHDSEV-------TRARYMP 141
           + I+ +     +  +S N  + DE + +   S     R    D  +        RARY+P
Sbjct: 76  IYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYLP 135

Query: 142 QDPNILATISGTGTVYIYDRSNERDTAS-----------------ITLQYHTDNGYGLAF 184
           Q+P++++  S  G++YI+DR+    T S                 + L    +    L +
Sbjct: 136 QNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLDW 195

Query: 185 NPLIKGHLLSGSDDSNVALWDVTSDRNE------PVQKWENIHSDIVNDCQWHNFQKSLF 238
           N   +G L S      + +WD++   +       P+   ++      ND  W     SL 
Sbjct: 196 NKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSLL 255

Query: 239 GTVSEDSSLQIHDTRESKPVATI-----NGTKPFNTLSFSHHSENLLATGGVNSEVYLYD 293
               E +++ I+DTR    V+ I     NG    N+  F+ H++ LLA+      V+++D
Sbjct: 256 AACGESNTVAIYDTRSKSQVSKIQPGLHNGG--INSCDFNAHNDYLLASADSIGTVHMWD 313

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIGAEQVLEDAE 351
            R+  ++P+  +S H  +++++ ++     II  AG  D  V +WD              
Sbjct: 314 IRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWDA------------- 359

Query: 352 DATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
            +  +++  H GH   +ND A N   PWL+ S   +N + LW+ S  L
Sbjct: 360 -SNGQLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 101/408 (24%), Positives = 179/408 (43%), Gaps = 59/408 (14%)

Query: 30  PLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE- 88
           P D    Y  WK N  ++YD+++     WPSLT Q+ P        +  L+L + TS + 
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTSSDQHRLLLSSFTSSQL 76

Query: 89  -EQNYLKIAVVDLPTEVTDTS-NLTESDEEQVRSNIRVTRKFKH----------DSEVTR 136
            E   + I+ +     +  +S N  + DE + + +  V    K+          + +  R
Sbjct: 77  PEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNR 136

Query: 137 ARYMPQDPNILATISGTGTVYIYDRSNE-----RDTASITLQYHTDNG------------ 179
           +RY+PQ+P+++A  S  G+VYI++++       R  +S   Q    +G            
Sbjct: 137 SRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNE 196

Query: 180 -YGLAFNPLIKGHLLSGSDDSNVALWDVT--SDRNEPVQKWE---NIHSDIVNDCQWHNF 233
              L++N   +G L          +WDV   S  N  + + E      S+  ND  W   
Sbjct: 197 AVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPM 256

Query: 234 QKSLFGTVSEDSSLQIHDTR--ESKPVATINGTK---PFNTLSFSHHSENLLATGGVNSE 288
             S+F    E + L + D R    K V +I+  K     NT  F+  +  L+A+      
Sbjct: 257 HDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGR 316

Query: 289 VYLYD-RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA-DKRVIIWDINDIGAEQV 346
           + L+D R+  +EP+  M  H  ++++++++     +  SAG  D  V +WD + +G E  
Sbjct: 317 INLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWDAS-VGKE-- 372

Query: 347 LEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                      + +H GH   +ND + +   PWL+AS   +N +Q+W+
Sbjct: 373 -----------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWR 409

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 96/419 (22%), Positives = 168/419 (40%), Gaps = 66/419 (15%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    + WP LT+  +P +  +      Q ++L T
Sbjct: 101 SRPLGPDEVLEAD------PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLAT 154

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143
            T    +   ++ V+ L       SNLT++  +          +      V     MP  
Sbjct: 155 ATQSSRKRENELMVLAL-------SNLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLK 207

Query: 144 PN----------------ILATISGTGTVYIYDRSNERDTASI--------------TLQ 173
                             + AT+S  G VYIYD + +    S               T++
Sbjct: 208 DTTNRLKVSPFAASNQEVLTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVK 267

Query: 174 YHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDVTSDR-NEPVQKWENIHSDIVNDCQW 230
            H +  GYGL ++PLIK G LLSG     +      + R     Q +   ++  + D QW
Sbjct: 268 SHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW 327

Query: 231 HNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNS 287
              + ++F T   D  ++I DTR  + KP  ++  +    N +S+S     LLA+G  N 
Sbjct: 328 SRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNG 387

Query: 288 EVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
              ++D R          +P+     H  A+TS+ F+  D+ I+     D  V +WD++ 
Sbjct: 388 TWGVWDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 447

Query: 341 IGAEQVLEDAEDATSEV-----MMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              ++ ++     T E+      ++    +  + D   +  IP  + S   + +  +WK
Sbjct: 448 EADDEEIKQQTAETKELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 99/423 (23%), Positives = 178/423 (42%), Gaps = 71/423 (16%)

Query: 27  ENRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILG 82
           ++RPL P E  E D      P +Y+ +    + WP LT+  +P +         Q ++L 
Sbjct: 100 KSRPLGPDEVLEAD------PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLT 153

Query: 83  THTSDEEQNYLKIAVVDLPTEVTDTSNLTES-----------------DEEQVRSNIRVT 125
           T T    +   ++ V+ L       SNLT++                 D + V  N  + 
Sbjct: 154 TATQSSRKKENELMVLAL-------SNLTKTLLKDDNEEDDEEGEDEEDVDPVIENENIP 206

Query: 126 RKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI--------------T 171
            +   +        +     + AT+S  G VYIYD + +    S               T
Sbjct: 207 LRDTTNRLKVSPFAVSNQEVLTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHT 266

Query: 172 LQYHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDVTSDR-NEPVQKWENIHSDIVNDC 228
           ++ H +  GYGL ++PLIK G LLSG     + L    + R     Q +   +++ + D 
Sbjct: 267 VKNHGNVEGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDI 326

Query: 229 QWHNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGV 285
           QW   + ++F T + D  ++I DTR  + KP  ++  +    N +S+S     LLA+G  
Sbjct: 327 QWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD 386

Query: 286 NSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           N    ++D R          +P+     H  A+TS+ F+  D+ I+     D  V +WD+
Sbjct: 387 NGTWGVWDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDL 446

Query: 339 N-DIGAEQVLEDA------EDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQ 391
           + +   E++ + A      +D   +++ +H   +  + D   +  IP  + S   + +  
Sbjct: 447 SVEADDEEIKQQAAETKELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-N 503

Query: 392 LWK 394
           +WK
Sbjct: 504 VWK 506

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 98/425 (23%), Positives = 175/425 (41%), Gaps = 76/425 (17%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +YD +    + WP LT+  +P +  +      Q L++ T
Sbjct: 106 SRPLGPDEVLEAD------PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTT 159

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSN-----------IRVTRKFKHDS 132
            T    +   ++ V+ L    +  +     D+++V S+           I          
Sbjct: 160 ATQASRKKENELMVLSL----SQLAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRD 215

Query: 133 EVTRARYMP---QDPNIL-ATISGTGTVYIYD----------------RSNERDTASITL 172
              R R  P    +  +L AT+S  G VYI+D                +S++R   +I  
Sbjct: 216 TTNRLRVSPFAQSNKEVLTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKN 275

Query: 173 QYHTDNGYGLAFNPLIK-GHLLSGSDDSNVALWDVTSDRNEPVQKWEN-------IHSDI 224
             + + GY L ++PLIK G LL+G     + L    + RN    KW          ++  
Sbjct: 276 HGNVE-GYALDWSPLIKTGALLTGDCSGQIYL----TQRN--TSKWVTDKQPFTVGNNKS 328

Query: 225 VNDCQWHNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLA 281
           V D QW   + ++F +   D  ++I DTR  + KP  ++  +    N +S++     LLA
Sbjct: 329 VEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLA 388

Query: 282 TGGVNSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI 334
           +G  N    ++D R          +P+     H  A+TS+ F+  ++ II  A  D  V 
Sbjct: 389 SGDDNGSWGVWDLRQFTPDNINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVT 448

Query: 335 IWDINDIGAEQVLEDAEDATSEV-----MMIHAGHRSPINDFAINPSIPWLVASAEEENI 389
           +WD++    ++ ++     T E+      ++    +  + D   +  IP  + S   + +
Sbjct: 449 LWDLSVEADDEEIKQQAAETKELESIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL 508

Query: 390 VQLWK 394
             +WK
Sbjct: 509 -NIWK 512

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 178/419 (42%), Gaps = 67/419 (15%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    + WP L++  +P +  +      Q +++ T
Sbjct: 106 SRPLGPDEVLEAD------PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTT 159

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTES---------------DEEQVRSNIRVTRKF 128
            T   ++   ++ V+ L       SNLT++               D E +  N  +  + 
Sbjct: 160 ATQASKKKENELMVLSL-------SNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALR- 211

Query: 129 KHDSEVTRARYMPQDPNIL-ATISGTGTVYIYDRSNERDTASI--------------TLQ 173
              + +  + +  Q   +L AT+S  G VYI+D   +    +               T++
Sbjct: 212 DTTNRIKVSPFASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIR 271

Query: 174 YHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQW 230
            H +  GYGL ++PLIK G LLSG     + L    TS      Q +   ++  + D QW
Sbjct: 272 NHGNVEGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQW 331

Query: 231 HNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNS 287
              + ++F T   D  +++ DTR  + KP  ++  +    N +S++     LLA+G  N 
Sbjct: 332 SKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNG 391

Query: 288 EVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
              ++D R          +P+   + H  A+TS+ F+  ++ I+     D  V +WD++ 
Sbjct: 392 SWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSV 451

Query: 341 IGAEQVLEDAEDATSEV-----MMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              ++ ++   + T E+      ++    +  I D   +  IP  + S   + +  +WK
Sbjct: 452 EADDEEIKQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCLVSTGTDGL-NIWK 509

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 152/354 (42%), Gaps = 48/354 (13%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    L WP +T+  +P    +      Q +++ T
Sbjct: 107 SRPLGPDEVLEAD------PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTT 160

Query: 84  HT--SDEEQNYLKIAVVD-----LPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTR 136
            T  S +++N L +  +      L     D     +SDEE     I      K +    R
Sbjct: 161 ATQASKKKENELMVLSLSQLNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNR 220

Query: 137 ARYMP---QDPNIL-ATISGTGTVYIYDRSNERDTASI--------------TLQYHTD- 177
            +  P    D  +L AT+S  G VYI+D + +    S               T++ H + 
Sbjct: 221 LKVSPFASTDKEVLTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNV 280

Query: 178 NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQK 235
            GY L ++P+IK G LL+G     +      TS      Q +   ++  V D QW   + 
Sbjct: 281 EGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTES 340

Query: 236 SLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLY 292
           ++F +   D  ++I DTR  + KP  ++  +    N +S+S     LLA+G  N    ++
Sbjct: 341 TVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVW 400

Query: 293 DRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           D R          +P+     H  A+TS++F+  DD II  A  D  V +WD++
Sbjct: 401 DLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLS 454

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 96/419 (22%), Positives = 169/419 (40%), Gaps = 66/419 (15%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    + WP LT+  +P +  +      Q ++L T
Sbjct: 101 SRPLGPDEVLEAD------PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTT 154

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTES------------DEEQVRSNIRVTRKFKHD 131
            T    +   ++ V+ L       SNLT++            +++     I         
Sbjct: 155 ATQSSRKKENELMVLAL-------SNLTKTLLKDENEEEDEEEDDDDIDPIIENENIPLR 207

Query: 132 SEVTRARYMP----QDPNILATISGTGTVYIYDRSNERDTASI--------------TLQ 173
               R +  P        + AT+S  G VYIYD + +    +               T++
Sbjct: 208 DTTNRLKVSPFAVSNQEVLTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVK 267

Query: 174 YHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDVTSDR-NEPVQKWENIHSDIVNDCQW 230
            H +  GYGL ++PLIK G LLSG     V      + R     Q +   ++  + D QW
Sbjct: 268 NHGNVEGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW 327

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESK--PVATINGTKP-FNTLSFSHHSENLLATGGVNS 287
              + ++F T   D  ++I DTR  K  P  ++  +    N +S+S     LLA+G  N 
Sbjct: 328 SRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNG 387

Query: 288 EVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
              ++D R          +P+     H  A+TS+ F+  D+ I+     D  V +WD++ 
Sbjct: 388 TWGVWDLRQFTPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 447

Query: 341 IGAEQVLEDAEDATSEV-----MMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              ++ ++     T E+      ++    +  + D   +  IP  + S   + +  +WK
Sbjct: 448 EADDEEIKQQTAETKELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 94/376 (25%), Positives = 158/376 (42%), Gaps = 50/376 (13%)

Query: 29  RPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGTH 84
           RPL P E  E D+       +Y+ +    L WP +++  +P S  N      Q ++L T 
Sbjct: 115 RPLGPDEVLEPDM------SVYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTA 168

Query: 85  T--SDEEQNYLKI-AVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVT------ 135
           T  S ++ N L I  +  L   +    +    DE+      R +     D+ V       
Sbjct: 169 TQASKKKDNELMILQLSQLTKTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTN 228

Query: 136 RARYMPQDPN-----ILATISGTGTVYIYDRSNERDTASI--------------TLQYHT 176
           R +  P   N     + AT+S  G VYI+D  N+  +  I              T++ H 
Sbjct: 229 RLKVTPFATNNNQEILTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHG 288

Query: 177 D-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNF 233
           +  G+GL ++PLIK G LL+G     + L    TS      Q +   ++  + D QW   
Sbjct: 289 NVEGFGLDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKT 348

Query: 234 QKSLFGTVSEDSSLQIHDTRESK---PVATINGTKPFNTLSFSHHSENLLATGGVNSEVY 290
           ++++F T   D  ++I DTR  K    ++T       N +S++   E LLA+G       
Sbjct: 349 EQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWG 408

Query: 291 LYDRRYVE------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAE 344
           ++D R          P+     H  A+TS+ F+  D+  +  A  D  V +WD++    +
Sbjct: 409 VWDLRQFSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADD 468

Query: 345 QVLEDAEDATSEVMMI 360
           + ++     T E+  I
Sbjct: 469 EEIKQQTHETKELEQI 484

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 160/386 (41%), Gaps = 71/386 (18%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    + WP LT+  +P           Q +++ T
Sbjct: 105 SRPLGPDEVLEAD------PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMAT 158

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDT--------------------SNLTESDEEQVR--SN 121
            T   ++   ++ V+ L +++  T                      + E++E  +R  +N
Sbjct: 159 ATQASKKKENELMVLKL-SQLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTN 217

Query: 122 IRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYD-----RSNERDTASI------ 170
                 F    EV           + AT+S  G VYI+D     ++ E     I      
Sbjct: 218 RLKISPFASSQEV-----------LTATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKK 266

Query: 171 ---TLQYHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDI 224
              T++ H +  GYGL ++PLIK G LL+G     V L    TS      Q +   ++  
Sbjct: 267 PLHTIRNHGNVEGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKS 326

Query: 225 VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK---PVATINGTKPFNTLSFSHHSENLLA 281
           + D QW   + ++F T   D  ++I DTR  K    ++T       N +S++     LLA
Sbjct: 327 IEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLA 386

Query: 282 TGGVNSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI 334
           +G  +    ++D R +        +P+     H  A+TS+ F+  D+ II  A  D  V 
Sbjct: 387 SGDDDGRWGVWDLRQLSPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVT 446

Query: 335 IWDINDIGAEQVLEDAEDATSEVMMI 360
           +WD++    ++ ++     T E+  I
Sbjct: 447 LWDLSVEADDEEIKQQAAETKELQQI 472

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 97/412 (23%), Positives = 168/412 (40%), Gaps = 52/412 (12%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP--HSAPNPVTRQELILGT 83
           +RPL P E  E D      P +Y+ +    L WP +T+  +P  + +      Q +++ T
Sbjct: 107 SRPLGPDEVLEAD------PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTT 160

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEV------TRA 137
            T   ++   ++ V+ L           E +EE   ++   +     D  V       R 
Sbjct: 161 ATQAAKKKDNELMVLKLSQLSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRL 220

Query: 138 RYMPQDPN----ILATISGTGTVYIYD---RSNERDTASI-----------TLQYHTD-N 178
           R  P   +    + AT+S  G VYI+D   +S   DT              T++ H +  
Sbjct: 221 RVSPFASSGQEVLTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVE 280

Query: 179 GYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKS 236
           GY L ++PLI+ G LL+G     V      TS      Q +   ++  + D QW   + +
Sbjct: 281 GYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEAT 340

Query: 237 LFGTVSEDSSLQIHDTRESK---PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYD 293
           +F T   D  +++ DTR  K    ++T       N +S++     LLA+G  N    ++D
Sbjct: 341 VFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWD 400

Query: 294 RRYVE------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI-----NDIG 342
            R         +P+     H  A+TS+ F   D+ I+  A  D  V +WD+     ++  
Sbjct: 401 LRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEI 460

Query: 343 AEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
            +Q  E  E A     ++    +  + D   +  IP  + S   + +  +WK
Sbjct: 461 KQQTAETKELAQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 511

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 99/422 (23%), Positives = 173/422 (40%), Gaps = 70/422 (16%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP-------HSAPNPVTRQE 78
           +RPL P E  E D      P +Y+ +    L WP LT+  +P        + P  +    
Sbjct: 106 SRPLGPDEVLEAD------PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTT 159

Query: 79  LILGTHTSDEEQNYLKIAVVD---LPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVT 135
               +   D E   LK++ +    +  +    +   + D+++    I             
Sbjct: 160 ATQASKKKDNELMVLKLSHLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTN 219

Query: 136 RARYMP----QDPNILATISGTGTVYIYD-----RSNERDTASI---------TLQYHTD 177
           R R  P    Q   + +T+S  G V+IYD     R+ E     I         T++ H +
Sbjct: 220 RLRISPYATVQQEILTSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGN 279

Query: 178 -NGYGLAFNPLIK-GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-------VNDC 228
             GYGL ++PLIK G LL+G     V L    + R+    KW    +         + D 
Sbjct: 280 VEGYGLDWSPLIKTGALLTGDCSGMVYL----TQRH--TSKWVTDKTPFTVGNNKSIEDI 333

Query: 229 QWHNFQKSLFGTVSEDSSLQIHDTR--ESKPV-ATINGTKPFNTLSFSHHSENLLATGGV 285
           QW   + ++F T   D  ++I DTR  + KPV +T+      N +S++     LLA+G  
Sbjct: 334 QWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDD 393

Query: 286 NSEVYLYDRRYVEE------PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
                ++D R          P+     H  A+TS+ F+  D+ I+  A  D  V +WD++
Sbjct: 394 KGTWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 453

Query: 340 ------DIGAEQV-LEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
                 +I  ++  +++ E    +++ +H   +  + D   +  IP  + S   + +  +
Sbjct: 454 VEADDEEIKQQKAEIKELEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NV 510

Query: 393 WK 394
           WK
Sbjct: 511 WK 512

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 108/242 (44%), Gaps = 27/242 (11%)

Query: 146 ILATISGTGTVYIYDRSNERDTASI--------------TLQYHTD-NGYGLAFNPLIK- 189
           + AT+S  G VYIY+ + +    S               T++ H +  GYGL ++PLIK 
Sbjct: 228 LTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKT 287

Query: 190 GHLLSGSDDSNVALWDVTSDR-NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           G LLSG     +      + R     Q +   ++  + D QW   + ++F T   D  ++
Sbjct: 288 GALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIR 347

Query: 249 IHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVE------- 298
           I DTR  + KP  ++  +    N +S+S     LLA+G  N    ++D R          
Sbjct: 348 IWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAV 407

Query: 299 EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVM 358
           +P+     H  A+TS+ F+  D+ I+     D  V +WD++    ++ ++     T E+ 
Sbjct: 408 QPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQ 467

Query: 359 MI 360
            I
Sbjct: 468 EI 469

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 106/245 (43%), Gaps = 33/245 (13%)

Query: 146 ILATISGTGTVYIYDRSNERDTASI--------------TLQYHTD-NGYGLAFNPLIK- 189
           + AT+S  G VYI+D +++                    T++ H +  GY L ++PLIK 
Sbjct: 237 LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKT 296

Query: 190 GHLLSGSDDSNVALWDVTSDR----NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDS 245
           G LL+G     V L    + +     EP     N     V D QW   + ++F +   D 
Sbjct: 297 GALLTGDCSGQVYLTQRHTSKWISDKEPFTVANN---QSVEDIQWSRTESTVFASCGCDG 353

Query: 246 SLQIHDTRESK--PVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVE---- 298
            +++ DTR  K  P  ++  +    N +S+S     LLA+G  N    ++D R       
Sbjct: 354 YIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNS 413

Query: 299 ---EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATS 355
               P+     H  A+TS+ F+  D+ I+  A  D  V +WD++    ++ ++     T 
Sbjct: 414 NNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETK 473

Query: 356 EVMMI 360
           E+  I
Sbjct: 474 ELQQI 478

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 112/254 (44%), Gaps = 36/254 (14%)

Query: 139 YMPQDPNILA-TISGTGTVYIYD----------------RSNERDTASITLQYHTDNGYG 181
           +  + P +LA T+S  G  YIYD                ++ ++   SI    + + GYG
Sbjct: 231 FAAESPEVLAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVE-GYG 289

Query: 182 LAFNPLIK-GHLLSGSDDSNVALWDVTSDR----NEPVQKWENIHSDIVNDCQWHNFQKS 236
           L ++PLIK G +L+G     V L   T+ R     +P     N     + D QW   + +
Sbjct: 290 LDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKS---IEDIQWSRAEMT 346

Query: 237 LFGTVSEDSSLQIHDTRESK---PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYD 293
           +F T   D  ++I DTR  K    ++ +      N +S++     LLA+G  +    ++D
Sbjct: 347 VFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGVWD 406

Query: 294 RRYVEE-------PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346
            R           P+   + H  A+TS+ F+  D+ II  A  D  V +WD++    ++ 
Sbjct: 407 LRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEE 466

Query: 347 LEDAEDATSEVMMI 360
           ++     T+E+  I
Sbjct: 467 IKQQTAETAELQQI 480

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/369 (23%), Positives = 142/369 (38%), Gaps = 77/369 (20%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP-------HSAPNPVTRQE 78
           +RPL P E  E D      P +Y+ +    + WP +T+  +P        S P  +    
Sbjct: 105 SRPLGPDEVLEAD------PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTT 158

Query: 79  LILGTHTSDEEQNYLKIAVVD---------------------LPTEVTDTSNLTESDEEQ 117
               T   D E   LK++ +                          + +  N+   D   
Sbjct: 159 ATQATRKKDNELMVLKLSQLSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKD--- 215

Query: 118 VRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDT---------- 167
             + ++V+    H  EV           + AT+   G VY++D   +             
Sbjct: 216 TTNRLKVSPFATHGQEV-----------LTATMCENGEVYVFDLGAQTKAFETPGYQVPK 264

Query: 168 ----ASITLQYHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENI 220
               A  T++ H +  GYGL ++PLIK G LL+G     + L    TS      Q +   
Sbjct: 265 TSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAA 324

Query: 221 HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK---PVATINGTKPFNTLSFSHHSE 277
           ++  V D QW   + ++F T   D  ++I DTR  K    ++T       N +S++    
Sbjct: 325 NNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLG 384

Query: 278 NLLATGGVNSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGAD 330
            LLA+G  N    ++D R          +P+     H   +TS+ F+  DD ++  A  D
Sbjct: 385 YLLASGDDNGSWGVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASED 444

Query: 331 KRVIIWDIN 339
             V +WD++
Sbjct: 445 NTVTLWDLS 453

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 105/242 (43%), Gaps = 27/242 (11%)

Query: 146 ILATISGTGTVYIYDRSNERDTASI--------------TLQYHTD-NGYGLAFNPLIK- 189
           + AT+S  G VYI+D   +    S               T++ H +  GY L ++PL K 
Sbjct: 228 LAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKT 287

Query: 190 GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           G LL+G     +      TS      Q +   ++  + D QW   + ++F +   D  ++
Sbjct: 288 GALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIR 347

Query: 249 IHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVE------- 298
           I DTR  + KP  ++  +    N +S+S     LLA+G  N    ++D R          
Sbjct: 348 IWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSV 407

Query: 299 EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVM 358
           +P+     H  A+TS+ F+  D+ II     D  V +WD++    ++ ++     T E+ 
Sbjct: 408 QPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQ 467

Query: 359 MI 360
            I
Sbjct: 468 QI 469

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 116/262 (44%), Gaps = 38/262 (14%)

Query: 109 NLTESDEEQVRSNIRVTRKFK-----HDSEVTRARYMPQDPNILATISGTGTVYIYDRSN 163
           +L  +D E+  ++++V  KF      H++E            I+A     GT+ +Y  + 
Sbjct: 46  SLLATDSEKPLASLQVDSKFNDLDWSHNNE------------IIAGALDNGTLELYSTNE 93

Query: 164 ERDTASITLQY--HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV-----TSDRNEPVQK 216
             DT S T ++  H+ +   + FN      L SG ++  + +WD+     +     P+  
Sbjct: 94  ANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTP 153

Query: 217 WENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLS---- 271
            +++ S D VN   W+     +F +    +   I D +  K V  ++ T P + +     
Sbjct: 154 GQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPSSGIKQQLS 213

Query: 272 -FSHHSEN----LLATGGVN-SEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGII 324
               H +N      ATG  N   + ++D R    P+  L  GH   + SLD+  QD+ ++
Sbjct: 214 VVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDENLL 273

Query: 325 LSAGADKRVIIWDINDIGAEQV 346
           LS+G D  V++W  N   AEQ+
Sbjct: 274 LSSGRDNTVLLW--NPESAEQL 293

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 16/170 (9%)

Query: 239 GTV----SEDSSLQIHD---TRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYL 291
           GTV    S DSSL++     T   KP+A++     FN L +SH++E ++A    N  + L
Sbjct: 30  GTVDANFSTDSSLELWSLLATDSEKPLASLQVDSKFNDLDWSHNNE-IIAGALDNGTLEL 88

Query: 292 YDRRYVEEPLH---LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348
           Y      + +        H+ +V ++ F+++ D ++ S G +  + IWD+N     +  E
Sbjct: 89  YSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMN-----KCTE 143

Query: 349 DAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
                T             +N  A N S+  + ASA   N   +W    K
Sbjct: 144 SPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADR108C
          Length = 311

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 95/214 (44%), Gaps = 29/214 (13%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG--HLLSGSDDSNVALWDVTSDRN 211
           G V I+D + E        QY  D+G       L +G   LL+G  +  V ++DV + R 
Sbjct: 35  GKVGIWDVTGE------GAQYEIDSGVVNTCVRLWQGSSQLLAGCANGKVCIYDVETGR- 87

Query: 212 EPVQKWENIHSDIVND----CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPF 267
             +++W   H  +VN+    C+ H     LFG+VS+D +L   D+R  KPV  + G  P 
Sbjct: 88  -KMRQWGGGHKRVVNEIVGLCEEH-----LFGSVSDDGTLCWWDSRVRKPVGRVVGEFPL 141

Query: 268 NTLSFSHHSEN-----LLATGGVNSEVYLYD-RRYVEEPLHLMSGHTDAVTSLDFSSQDD 321
            TL+     +       L T GV   V  YD R+  +      + H   V+SL  SS   
Sbjct: 142 LTLALGRRGDGDERSPFLYTSGVEPVVRCYDLRKNTDLIAECETTHATGVSSLCVSSNGS 201

Query: 322 GIILSAGADKRVIIWDINDIGAEQVLEDAEDATS 355
             + S G D  +     +DI A   L++ +D  +
Sbjct: 202 -RVCSLGFDDNL---QFHDIDASGKLKNRQDGAT 231

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAE 344
           E    L   H  A  S D SS+D  +++S+G D +V IWD+   GA+
Sbjct: 3   ESVCRLAGLHEGAALSCD-SSRDGKMVISSGIDGKVGIWDVTGEGAQ 48

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 89/181 (49%), Gaps = 17/181 (9%)

Query: 178 NGYGLAFNPLIKGH--LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNF 233
           N + L   PL  G+  LL+   +  V   D ++     +QK+ NI    +ND Q   HN 
Sbjct: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTT--IQKY-NISETSINDLQLINHNP 72

Query: 234 QKSLFGTVSEDSSLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNS 287
             S   T +  +S++I D   +K VATI+  G  PF +L   H    LLA G    GV++
Sbjct: 73  TSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRH---GLLACGTELKGVDA 129

Query: 288 EVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346
            +Y+YD R  ++P+  L+  H D VT L +   D  I+LS   D    ++D+++   E  
Sbjct: 130 AIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEEDS 189

Query: 347 L 347
           L
Sbjct: 190 L 190

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 98/392 (25%), Positives = 168/392 (42%), Gaps = 50/392 (12%)

Query: 12  AAQLTGIDLQQLP-SDENRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPH 68
           AA+L+  + QQL     +RPL P E  E D      P +Y+ +    L WP L++  +P 
Sbjct: 97  AAELSAQESQQLYLPHMSRPLGPDEVLEAD------PTVYEMLHNVNLPWPCLSLDIVPD 150

Query: 69  SAPNPVTR--QELILGTHT-----SDEEQNYLKIA-----VVDLPTEVTDTSNLTESDEE 116
              +      Q L+L T T      D E   LK++     +V    +  +  +  + D++
Sbjct: 151 RLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQLTKTLVKEDEDDDEEDDDEDEDQD 210

Query: 117 QVRSNIRVTRKFKHDSEVTRARYMPQDPNIL-ATISGTGTVYIYD-----RSNERDTASI 170
            +  N  +  +    + +  + +  + P  L A++S  G VYI+D     +  E     I
Sbjct: 211 PIVENENIPLR-DTTNRLKVSPFASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQI 269

Query: 171 ---------TLQYHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWE 218
                    T++ H +  GY L ++PL K G LL+G     V L    TS        + 
Sbjct: 270 PKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFS 329

Query: 219 NIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK--PVATINGTKP-FNTLSFSHH 275
             ++  + D Q+   + ++F T   D  ++I DTR  K  P  ++  +    N +S++  
Sbjct: 330 AGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEK 389

Query: 276 SENLLATGGVNSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
              LLA+G  N    ++D R           P+   S H  A+TS+ F+  DD II  A 
Sbjct: 390 IGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVAS 449

Query: 329 ADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
            D  V +WD++    ++ ++     T E+  I
Sbjct: 450 EDNTVTLWDLSVEADDEEIKQQAAETKELQQI 481

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 98/220 (44%), Gaps = 26/220 (11%)

Query: 146 ILATISGTGTVYIYDRSNERDT----------ASITLQYHTDN-----GYGLAFNPLIK- 189
           + AT+S  G  +I+D   +             A+   QY   N     GYGL ++PLIK 
Sbjct: 239 LAATMSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKT 298

Query: 190 GHLLSGSDDSNVALWDVTSDR-NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           G LL+G     V L   TS +     Q +   ++  + D +W   + ++F T   D  ++
Sbjct: 299 GALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVR 358

Query: 249 IHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVE------E 299
           I D R  + KP  ++  +    N +S++     LLATG  N    ++D R          
Sbjct: 359 IWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVS 418

Query: 300 PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           P+     H  A+TS+ F+  D+ II  A  D  V +WD++
Sbjct: 419 PVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 458

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 118/253 (46%), Gaps = 25/253 (9%)

Query: 129 KHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLI 188
           KH S+V     + +D   LAT    G++ +          SI   +    G GL ++P  
Sbjct: 173 KHVSQVA----VHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIG-GLDWHP-D 226

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
             HLLSG  D+ V LWD+TS+  E ++     H+  V+  + H   + L  + S D +  
Sbjct: 227 GNHLLSGGGDNLVKLWDMTSNSFEELRG----HAGRVSRVKVHPSGR-LAASASFDLTWI 281

Query: 249 IHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
           + D      +    G +K   T++F      LLA+ G+++   ++D R   EP+  + GH
Sbjct: 282 LWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRS-GEPIMKLEGH 339

Query: 308 TDAVTSLDFSSQDDGIILS-AGADKRVIIWDINDIGAEQVLEDAEDATSEV--------M 358
             A++ +D+S   +G  L+ AGAD  V +WDI ++G E  L   + A  +V         
Sbjct: 340 AGAISGVDWSP--NGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTF 397

Query: 359 MIHAGHRSPINDF 371
           ++  GH   +N F
Sbjct: 398 LVSCGHDRLVNIF 410

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 90/389 (23%), Positives = 160/389 (41%), Gaps = 74/389 (19%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    + WP LT+  +P S  +      Q L++ T
Sbjct: 100 SRPLGPDEVLEAD------PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTT 153

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTES--------------------DEEQVRSNIR 123
            T   ++   ++ V+ L       SNLT++                    D++ V  N  
Sbjct: 154 ATQASKKKENELMVLSL-------SNLTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENEN 206

Query: 124 V-----TRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI-------- 170
           +     T + K       ++ +     + AT+S  G VYI+D   +    S         
Sbjct: 207 IPLRDTTNRLKVSPFANSSKEV-----LTATMSENGEVYIFDLGPQSKAFSTPGYKIPKT 261

Query: 171 ------TLQYHTD-NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIH 221
                 T++ H +  GY L ++P I+ G LL+G     +      TS      Q +   +
Sbjct: 262 AKRPIHTIKSHGNVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSN 321

Query: 222 SDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSEN 278
           +  + D QW   + ++F +   D  ++I DTR  + KP  ++  +    N +S+S     
Sbjct: 322 NKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGY 381

Query: 279 LLATGGVNSEVYLYDRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADK 331
           LLA+G  N    ++D R          +P+     H  A+TS+ F+  D+ I+  A  D 
Sbjct: 382 LLASGDDNGVWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDN 441

Query: 332 RVIIWDINDIGAEQVLEDAEDATSEVMMI 360
            V +WD++    ++ ++     T E+  I
Sbjct: 442 TVTLWDLSVEADDEEIKQQAAETKELQQI 470

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 64/140 (45%), Gaps = 11/140 (7%)

Query: 260 TINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEE--PLHLMSGHTDAVTSLDFS 317
           T++  K    + +S     + A+ G +  + ++D R  +    + + + +TD V  + +S
Sbjct: 318 TVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTD-VNVISWS 376

Query: 318 SQDDGIILSAGADKRVI-IWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPS 376
            +  G +L++G D  V  +WD+      Q   D  ++   V   +  H+  I   + NP 
Sbjct: 377 DKL-GYLLASGDDNGVWGVWDL-----RQFSPDTANSVQPVAQ-YDFHKGAITSISFNPL 429

Query: 377 IPWLVASAEEENIVQLWKCS 396
              +VA A E+N V LW  S
Sbjct: 430 DESIVAVASEDNTVTLWDLS 449

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 76/158 (48%), Gaps = 3/158 (1%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K H +  + +    +W+++   ++ V+   + H   + D  +H  Q  +  T S D+   
Sbjct: 81  KHHWVISTSNQKAIVWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYAL 140

Query: 249 IHDTRESKP--VATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R  K     T N       + ++H + N+LAT   N  VY++D R    PL ++ G
Sbjct: 141 AWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEG 199

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAE 344
           H+ +V S+DF+  ++  I+S+G D  V  WD N +  E
Sbjct: 200 HSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 132 SEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGH 191
           S   + ++  ++ N+LAT S +  VY++D        S+ L+ H+ +   + FNP  +  
Sbjct: 159 SGAAQVKWNHKNSNVLAT-SHSNIVYVWDVRKGTSPLSV-LEGHSGSVNSIDFNPFNETE 216

Query: 192 LLSGSDDSNVALWDVTSDRNE 212
           ++S  +D  V  WD     +E
Sbjct: 217 IMSSGNDGTVKFWDYNKVEDE 237

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 96/414 (23%), Positives = 172/414 (41%), Gaps = 55/414 (13%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           +RPL P E  E D      P +Y+ +    L WP L++  +P    +      Q L+L T
Sbjct: 113 SRPLGPDEVLEAD------PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTT 166

Query: 84  HT-----SDEEQNYLKIA-----VVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSE 133
            T      D E   LK++     +V       +  +  + D++ +  N  +  K    + 
Sbjct: 167 ATQASKKKDNELLLLKMSQLAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLK-DTTNR 225

Query: 134 VTRARYMPQDPNIL-ATISGTGTVYIYDRSNERDTASI--------------TLQYHTD- 177
           +  + +  + P  L AT+S  G VYI+D   +     I              T++ H + 
Sbjct: 226 LKVSPFASESPEKLTATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNV 285

Query: 178 NGYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQK 235
            GY L ++PL K G LL+G     V L    TS        +   ++  + D Q+   + 
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 345

Query: 236 SLFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLY 292
           ++F +   D  ++I DTR  + KP  ++  +    N +S++     LLA+G  N    ++
Sbjct: 346 TVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVW 405

Query: 293 DRRYVE-------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345
           D R           P+   + H  A+TS+ F+  DD II  A  D  V +WD++    ++
Sbjct: 406 DLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDE 465

Query: 346 VLEDAEDATSEV-----MMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
            ++     T E+      ++    +  + D   +  IP  + S   + +  +WK
Sbjct: 466 EIKQQAAETRELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 518

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 87/173 (50%), Gaps = 17/173 (9%)

Query: 182 LAFNPLIKGHLLSGSD-DSNVALWDVTS-DRNEPVQKWENIHSDIVNDCQWHNFQKSLFG 239
           L FN      L+SGSD +  + +WD+ + D+           ++ +    W+     +F 
Sbjct: 117 LKFNTKQSNLLVSGSDKNGEILIWDLNNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFS 176

Query: 240 TVSEDSSLQIHDTRESKPVATINGTKPFNTLS--FSH---HSEN--LLATGGVNSE---- 288
             S  S++ I D +  K V  +N T P N +   FS    H +N   +AT  +N++    
Sbjct: 177 CSSNTSNVSIFDLKAKKEVIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTES 236

Query: 289 --VYLYDRRYVEEPLHLMS--GHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
             ++++D R    PL ++S  GH++ + SLD+ S D+ ++LS+G D  V++W+
Sbjct: 237 DSIFIWDLRNSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 14/172 (8%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           +NP+    L+S S D+   +WD+ S      Q     H   V D ++      LF +   
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIA--HDSEVYDVRFLTQSTQLFASCGG 297

Query: 244 DSSLQIHDTRE--------SKPVATIN-GTKPFNTLSF--SHHSENLLATGGVNS-EVYL 291
           D S+++ D R           PV+ +N  T  F  L    S H  N++AT   +S ++ +
Sbjct: 298 DGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILI 357

Query: 292 YDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGA 343
            D R  E PL ++ GH+ +V  + +      ++LS G D +V+ WD+N   A
Sbjct: 358 LDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTA 409

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 25/143 (17%)

Query: 88  EEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRS----NIRV--TRKFKHDS--------- 132
           +  NY+K  ++   +EV D   LT+S +         ++RV   R   H +         
Sbjct: 263 QSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSD 322

Query: 133 --------EVTRARYMPQDPNILATISG-TGTVYIYDRSNERDTASITLQYHTDNGYGLA 183
                    + R    P DPN++AT +  +  + I D  N      I L+ H+ +   + 
Sbjct: 323 LNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMI-LEGHSASVNQIK 381

Query: 184 FNPLIKGHLLSGSDDSNVALWDV 206
           ++P+ +  LLSG DD  V  WD+
Sbjct: 382 WHPIKRNVLLSGGDDCQVLYWDL 404

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 64/156 (41%), Gaps = 19/156 (12%)

Query: 120 SNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNG 179
           SN   T+   HDSEV   R++ Q   + A+  G G+V ++D    R  A  T+ Y     
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDL---RSLAHSTIIYEPPVS 321

Query: 180 -----------YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC 228
                        L  +P     + + + DSN  L     +   P+   E  HS  VN  
Sbjct: 322 DLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEG-HSASVNQI 380

Query: 229 QWHNFQKSLFGTVSEDSSLQIHD----TRESKPVAT 260
           +WH  ++++  +  +D  +   D    T  S PVAT
Sbjct: 381 KWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDPVAT 416

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 154/374 (41%), Gaps = 47/374 (12%)

Query: 28  NRPLDPSE--EYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTR--QELILGT 83
           ++PL P E  E D      P +Y+ +    + WP +T+  +P +  +      Q L++ T
Sbjct: 114 SKPLGPDEVLEAD------PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMAT 167

Query: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVT------RA 137
            T   ++N  ++ V+ +           E + E    +   T     +  ++      R 
Sbjct: 168 ATQASKKNQNELMVLKMSQLAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRL 227

Query: 138 RYMP----QDPNILATISGTGTVYIYDRSNERDTASI--------------TLQYHTD-N 178
           +  P        + +T+S  G VYI+D +++                    T++ H    
Sbjct: 228 KVSPFANAAQEVLCSTMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVE 287

Query: 179 GYGLAFNPLIK-GHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKS 236
           GY   ++P+IK G +LSG     V L    TS      Q +   ++  + D QW   + +
Sbjct: 288 GYANDWSPIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTEST 347

Query: 237 LFGTVSEDSSLQIHDTR--ESKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYD 293
           +F +   D  ++I DTR  + KP  ++  +    N +S+S     LLA+G  +    ++D
Sbjct: 348 VFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWD 407

Query: 294 RRY-------VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346
            R           P+     H  A+TS+ F+  D+ II  A  D  V +WD++    ++ 
Sbjct: 408 LRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEE 467

Query: 347 LEDAEDATSEVMMI 360
           ++     T E+  I
Sbjct: 468 IKQQAAETKELQQI 481

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 112/288 (38%), Gaps = 69/288 (23%)

Query: 116 EQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYH 175
           E++RS  +V    KH + V   R+  +  N+L +    G +Y++D      T  I  Q +
Sbjct: 92  EELRSVAKVK---KHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWD------TNKIATQGY 142

Query: 176 TDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQK 235
           +  G G+A  P+                                   + V    W+    
Sbjct: 143 SPFGPGVAMTPI-----------------------------------EEVQSLAWNQTLA 167

Query: 236 SLFGTVSEDSSLQIHDTRESKPVATINGTKPF----NTLSF-----SHHSENLLATGGVN 286
            +F +        I D +  K V  ++ T P     N LS      S+ ++   ATG  N
Sbjct: 168 HVFASAGSSGFASIWDLKAKKEVIHLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDN 227

Query: 287 SEVYL-YDRRYVEEPLHLMS-GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAE 344
             V L +D R    PL ++S GH+  + SLD+  QDD +++S+G D   I+W        
Sbjct: 228 EPVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILW-------- 279

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
               + E+A         G+      FA  P  P L ASA  +N VQ+
Sbjct: 280 ----NPEEAQKLTQFPTRGNWCFKTKFA--PEAPDLFASASFDNKVQV 321

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 93/192 (48%), Gaps = 20/192 (10%)

Query: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD---VTSDRNEPVQKWENIHSD 223
           T   T+ + +DN + L   PL    LLS   + +V L D   +TS ++ PV         
Sbjct: 4   TKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALK 62

Query: 224 IV-NDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLL 280
           ++ ND    N     F T SEDS ++I D R ++ VAT+   K  PF +L   H    +L
Sbjct: 63  VLDNDVDSGN----TFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLDSRH---GML 114

Query: 281 ATG----GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
           A G    G ++E++LYD + ++ P+      H D +T + F + D  ++LS   D  V +
Sbjct: 115 ACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNV 174

Query: 336 WDINDIGAEQVL 347
           +D+     E+ L
Sbjct: 175 YDLKQQEEEEAL 186

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 96/211 (45%), Gaps = 22/211 (10%)

Query: 149 TISGT---GTVYIYDRSNERDTASITLQY--HTDNGYGLAFNPLIKGHLLSGSDDSNVAL 203
           TI+G    GT+ +Y   +  DT   T ++  H+ +   + FN      L SG ++  + +
Sbjct: 76  TIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFI 135

Query: 204 WDV-----TSDRNEPVQKWENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKP 257
           WD+     +     P+   +++ S D VN   W+     +F +    +   I D +  K 
Sbjct: 136 WDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE 195

Query: 258 VATINGTKPFNTLS-----FSHHSEN----LLATGGVN-SEVYLYDRRYVEEPLHLMS-G 306
           V  ++ T P + +         H +N      ATG  N   + ++D R    PL  +S G
Sbjct: 196 VIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQG 255

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           H   + SLD+  QD+ ++LS+G D  V++W+
Sbjct: 256 HQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 16/170 (9%)

Query: 239 GTV----SEDSSLQIHD---TRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYL 291
           GTV    S DSSL++     T   KP+A++     FN L +SH+++ + A    N  + L
Sbjct: 30  GTVDANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTI-AGALDNGTLEL 88

Query: 292 YDRRYVEEPL---HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348
           Y      + +      S H+ +V ++ F+S+ D ++ S G +  + IWD+N     +  E
Sbjct: 89  YSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMN-----KCTE 143

Query: 349 DAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
                T             +N  A N S+  + ASA   N   +W    K
Sbjct: 144 SPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 17/171 (9%)

Query: 178 NGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHN---FQ 234
           N + L   P+    LL+   +  V L D  + ++  + + +  H+  VND    N     
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKS--ILQIQT-HATSVNDMVIINNDRMN 89

Query: 235 KSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSE 288
            SL  T +ED+ ++I+D + +  VAT+   K  PF +L   H    LL  G    GV++E
Sbjct: 90  GSLIATAAEDA-VKIYDLKSNDCVATLKNGKSAPFLSLDSRH---GLLGCGTELSGVDAE 145

Query: 289 VYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           +++YD R  ++PL  L+  H D +TS+ F   D  ++LS   D  V I+D+
Sbjct: 146 LHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL 196

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 30/202 (14%)

Query: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTS----DRN 211
           +++YD  + +      +  H D+   + F+P     LLSGS D  V ++D+T     D  
Sbjct: 146 LHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEEDDAL 205

Query: 212 EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH---DTR----ESKPVATINGT 264
             V  + +IHS     C W + ++    T+S   +  IH   D R    E KPV   +  
Sbjct: 206 HQVINFASIHS-----CGWLSPKR--IYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVR 258

Query: 265 KPFNTLSFSHHSENLLATGGV---NSEVYL----YDRRYVEEPLHLMSGHTDAVTS---L 314
           KP++           +ATG       E+ L    +++  ++  + + S H D V     +
Sbjct: 259 KPWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLV 318

Query: 315 DFSSQDDGIILSAGADKRVIIW 336
            F  +D  ++ S G D  + +W
Sbjct: 319 PFQHED--LLYSCGEDGSLKVW 338

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERD 166
           H  ++T  ++ P DPN+L + S  G V IYD + + +
Sbjct: 165 HHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEE 201

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 18/178 (10%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD-VTSDRNEPVQKWENIHSDIV--ND 227
           ++ +  DN + L   PL    LL+   + +V L D V + +   +Q      SD+V  N+
Sbjct: 8   SINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMVVLNN 66

Query: 228 CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG-- 283
            + + F   L  T +EDS ++I D R S  VAT+   K  PF +L   H    +LA G  
Sbjct: 67  DRNNGF---LIATAAEDS-VKIFDLRSSDTVATLKNEKSAPFLSLDSRH---GMLACGTE 119

Query: 284 --GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
             GV++E+++YD +   +PL  L+  H D +T++ F   D  ++LS   D  V I+D+
Sbjct: 120 LSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDL 177

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSN-ERDTA 168
           H  ++T  ++ P DPN+L + S  G V IYD +  E D A
Sbjct: 146 HHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPEEDDA 185

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 72/135 (53%), Gaps = 18/135 (13%)

Query: 237 LFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSEVY 290
           LF + S+DS ++I D R S  VAT++  K  PF +L   H   ++LA G    GV++E++
Sbjct: 73  LFASASKDS-VKIFDVRTSSCVATLHNDKSAPFLSLDSRH---DMLACGTELSGVDAELH 128

Query: 291 LYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLED 349
           +YD + + +PL   +  H D +T   F   D G+++S   D  V I+D+ +        D
Sbjct: 129 IYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN-------SD 181

Query: 350 AEDATSEVMMIHAGH 364
            EDA  +V+   + H
Sbjct: 182 EEDALHQVINFASVH 196

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVT-SDRNEPV 214
           ++IYD           +  H D+     F+P   G L+SGS D  V ++D+T SD  + +
Sbjct: 127 LHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSDEEDAL 186

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH-------DTRESKPV 258
            +  N  S  V+ C W         T+S   +  IH       D RE KPV
Sbjct: 187 HQVINFAS--VHSCGW--LAPRRIYTLSHMETFAIHELNDKSDDLREPKPV 233

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSN 163
           H  ++T  ++ P DP +L + S  G V IYD +N
Sbjct: 146 HHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN 179

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 85/221 (38%), Gaps = 46/221 (20%)

Query: 129 KHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLI 188
           KH   VT+AR+     NILAT    G + I+D +         L      G    + P++
Sbjct: 108 KHAGAVTQARFHSLQSNILATGDSKGGILIWDTNK-------CLTKAQGGGVVSTYTPML 160

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC-QWHNFQKSLFGTVSEDSSL 247
                                  EPVQ            C  W+  Q  +F + +  S  
Sbjct: 161 PA---------------ANKSSEEPVQ------------CLAWNKKQAHIFASTNSTSFA 193

Query: 248 QIHDTRESKPVATINGTKPFNTLS-------FSHHSENLLATGGVNSE---VYLYDRRYV 297
            I D +  K V  ++ T P   L        +       +ATG  N     V ++D R  
Sbjct: 194 SIWDLKAKKDVLHLSYTSPLTGLKPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRNA 253

Query: 298 EEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
             PL  L  GH+  + SLD+  QD+ ++LS+G D  V++W+
Sbjct: 254 NTPLQELTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWN 294

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 203 LWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV---A 259
           LW+++ + ++ ++   + HS  + D  +H     +  T S D+ +   D R  +     A
Sbjct: 95  LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSA 154

Query: 260 TINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ 319
           ++  +   + + +++ + N++A+   N +VY++D R    PLH++ GH ++V S+DFS  
Sbjct: 155 SV-WSAGASQVKWNYKNSNVMASAHSN-DVYIWDLRKGCTPLHVLQGHVNSVNSIDFSKF 212

Query: 320 DDGIILSAGADKRVIIWD 337
           D+  I+S+  D  V  WD
Sbjct: 213 DETEIMSSSNDGTVKFWD 230

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 101/250 (40%), Gaps = 59/250 (23%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA---FNPLIKGHLLSGSDDSNV 201
           N LAT SG G +  ++ S   + +S    Y    G  +     +P  +  +LS  DD  V
Sbjct: 81  NKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDDKTV 140

Query: 202 ALWDVTSDRNEPVQKWENIHSD--IVNDCQW--------HNFQKSLFGTVSEDSSLQIHD 251
            LW V SD    V+    +++D  I+             H+ QKS F  V+  + +++ D
Sbjct: 141 KLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQKSNF--VTGGAQIELWD 198

Query: 252 TRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEV--------------------- 289
           T  SKP++ ++ G    N + F+ +  ++LA+ G ++ V                     
Sbjct: 199 TNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTN 258

Query: 290 ---------------------YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
                                Y YD R + + LH+   H  AV  +DFS   D ++ +  
Sbjct: 259 SICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEVV-TGS 317

Query: 329 ADKRVIIWDI 338
            DK + I+ +
Sbjct: 318 YDKTIRIYQV 327

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 79/183 (43%), Gaps = 25/183 (13%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC------ 228
           H D  Y +A N  +   L + S D  +  W++++   E +  ++  +  +   C      
Sbjct: 66  HRDGVYTIAKNYNVLNKLATASGDGVIKYWNMST--REELSSFKAHYGMVTGLCVTPSYL 123

Query: 229 --QWHNFQKS--------LFGTVSEDSSLQIHDTR---ESKPVATINGTKPFNTLSFSHH 275
             Q  NF  S        L+   S+D S    DTR   +   + T +G   F +L   H 
Sbjct: 124 SPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLD-HHR 182

Query: 276 SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
            ++   TGG   E++  +R    +P+  +S   D +  + F+  +  I+ S G+D  V++
Sbjct: 183 QKSNFVTGGAQIELWDTNR---SKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVL 239

Query: 336 WDI 338
           +D+
Sbjct: 240 YDL 242

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 91/207 (43%), Gaps = 18/207 (8%)

Query: 149 TISGT---GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD 205
           TI+G    G + ++  SN++ T+   L  HT +   L FN   +  L+SGS+   + +WD
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWD 135

Query: 206 VTSDRNE---PVQKWENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI 261
               +     P+     +   + +    W+     +F +        I D +  K V  +
Sbjct: 136 TNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKEVIHL 195

Query: 262 NGTKPFNTLS-----FSHHSEN----LLATGGVN-SEVYLYDRRYVEEPLHLM-SGHTDA 310
           + T P   L         H  N      ATG  N   + ++D R    PL ++  GH+  
Sbjct: 196 SYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHSKG 255

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIWD 337
           + SLD+  +D+ ++LS+G D  V++W+
Sbjct: 256 IISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 256 KPVATINGTKPFNTLSFSHHSENLLAT--GGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
           KPVA+I+    FN L +S+ ++ +      G+    YL + +     +  ++ HT +V +
Sbjct: 54  KPVASISTDTKFNDLDWSYDNKTIAGALDNGIIELFYLSNDQLTS--VAKLTTHTSSVKT 111

Query: 314 LDFSSQDDGIILSAGADKRVIIWDIN 339
           L F+S+ + +++S      + +WD N
Sbjct: 112 LKFNSKQENVLVSGSNKGEIFVWDTN 137

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 96/199 (48%), Gaps = 28/199 (14%)

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWE----NIHS-DIVN 226
           + +  DN + L   PL    LL  S + +V L D  S     ++K+E    NI+S  ++N
Sbjct: 9   ITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSP--SIIKKFEVGETNINSLRVIN 65

Query: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRES-KPVATINGTKPFNTLSF-SHHSENLLATG- 283
           +    +F+       +  +S++I+D R    PVATI   K    LS  S H  ++L  G 
Sbjct: 66  N----DFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRH--DMLVCGT 119

Query: 284 ---GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
              GV++E+++YD RY  +P+   +  H D +T + F   D  I+LS   D    I+D+ 
Sbjct: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL- 178

Query: 340 DIGAEQVLEDAEDATSEVM 358
                   ED ++A  +V+
Sbjct: 179 ------AQEDEDEALHQVI 191

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 76/172 (44%), Gaps = 14/172 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENI-HSDIVNDCQWHN 232
           +HTD    LA N L +  L S S DS V LWD+ S      +    + H   V+  QWH 
Sbjct: 291 HHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNS--GTAARSLNQVHHGSRVSSSQWHQ 348

Query: 233 FQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLS------FSHHSENLLATGGVN 286
              S+  T   DS + + D R S      N +K +N +S       S  ++  +  G  N
Sbjct: 349 TDGSILLTAGYDSKIALTDVRISDEK---NMSKYWNVMSGEEIETASFINDYTVLAGTDN 405

Query: 287 SEVYLYDRRYVE-EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI-IW 336
             VY +D R VE +PL  +  H   +  L       G++L+    ++VI +W
Sbjct: 406 GNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 43/101 (42%), Gaps = 16/101 (15%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-------- 353
           H+ + HTDAV SL  +     I+ S  AD  V +WD+N   A + L              
Sbjct: 287 HVTTHHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVHHGSRVSSSQW 346

Query: 354 --TSEVMMIHAGHRSPI--NDFAI----NPSIPWLVASAEE 386
             T   +++ AG+ S I   D  I    N S  W V S EE
Sbjct: 347 HQTDGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEE 387

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 101/244 (41%), Gaps = 24/244 (9%)

Query: 109 NLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTA 168
           +L  +D E+ + +I  + KF          + P D +ILA     G V  +     +  A
Sbjct: 46  SLLSADVEKPQGSITASAKFND------LDWSP-DNSILAGALDNGIVEFFSPKELKSVA 98

Query: 169 SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV---TSDRNEPVQKWENIHS-DI 224
            I+   HT     L FN      L SG     + +WD+   TS    P      +   D 
Sbjct: 99  KIS--KHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDE 156

Query: 225 VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPF----NTLSF-----SHH 275
           V    W+     +F +        I D +  K V  ++ T P     N LS      S+ 
Sbjct: 157 VYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNS 216

Query: 276 SENLLATGGVNSEVYL-YDRRYVEEPLHLMS-GHTDAVTSLDFSSQDDGIILSAGADKRV 333
           ++   ATG  N  V L +D R  + PL  MS GH+  + SLD+  QD+ ++LS+G D   
Sbjct: 217 TKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTC 276

Query: 334 IIWD 337
            +W+
Sbjct: 277 ALWN 280

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 256 KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLD 315
           KP  +I  +  FN L +S  + ++LA    N  V  +  + ++  +  +S HT  V +L 
Sbjct: 54  KPQGSITASAKFNDLDWSPDN-SILAGALDNGIVEFFSPKELKS-VAKISKHTTPVNTLK 111

Query: 316 FSSQDDGIILSAGADKRVIIWDINDI 341
           F+++ D ++ S  +   + IWDIN I
Sbjct: 112 FNAKQDNVLCSGDSRGEIFIWDINKI 137

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 78/201 (38%), Gaps = 39/201 (19%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGY-----GLAFNPLI-KGHLLSGSDD 198
           N LAT SG G +  ++ S   +  S    Y    G      GL+   L  + H+LS  DD
Sbjct: 81  NKLATASGDGVIKYWNMSTREEYVSFKGHYGLVTGLCVTPEGLSVGGLSNQNHMLSCGDD 140

Query: 199 SNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
             + LW + +D                            F  +  D  L          +
Sbjct: 141 KTIKLWSINNDD---------------------------FANIKSDEELITKTNGSGALL 173

Query: 259 ATINGTKPFNTLSFSHHSEN-LLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS 317
            T  G   F  +   HH E  L  TGG   E++  +R     PL  +S   D +TSL F+
Sbjct: 174 KTFYGEHAFQGI--DHHREKPLFVTGGAKIELWDNNR---STPLTNLSWGADNITSLKFN 228

Query: 318 SQDDGIILSAGADKRVIIWDI 338
             +  I+ SAG+D  V+++D+
Sbjct: 229 QSETDIVASAGSDNSVVLYDL 249

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 67/190 (35%), Gaps = 49/190 (25%)

Query: 150 ISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSD 209
           ++G   + ++D  N R T    L +  DN   L FN      + S   D++V L+D+ + 
Sbjct: 195 VTGGAKIELWD--NNRSTPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRT- 251

Query: 210 RNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNT 269
            N P QK   + S   N   W                               N  +PFN 
Sbjct: 252 -NSPTQKI--VQSMRTNAICW-------------------------------NPMEPFN- 276

Query: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329
                           +   Y YD R +   L++   H  AV  +DFS   D I+ +   
Sbjct: 277 ----------FVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFSPTGDEIV-TGSY 325

Query: 330 DKRVIIWDIN 339
           DK + I+  N
Sbjct: 326 DKTIRIFKTN 335

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 105/232 (45%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           GLAF+P  +  +L     S++ LWD        + K+E+ H   V    +H  Q  LF +
Sbjct: 16  GLAFHP-SRPWVLVALFSSSIQLWDYR--MGTLLHKFED-HEGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++      K + T+NG   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           +  ++GH   V   DF   +D +++SA  D+ V +WDI                + I A+
Sbjct: 130 IACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV 214
           T+ I++  N ++ A +T   H        F+P  +  ++S S D  V +WD++  R    
Sbjct: 118 TIRIWNWQNRKEIACLT--GHNHFVMCADFHP-TEDLVVSASLDETVRVWDISGLRKRHS 174

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSH 274
                   D +   Q  N     FG       L+ H             ++  N  SF H
Sbjct: 175 APSTYTLEDQIAAQQ--NLLDGGFGDCVVKFILEGH-------------SRGVNWASF-H 218

Query: 275 HSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
            +  L+ +GG + +V L+     +   +    GHT+ V S+ F    + +I+S G DK V
Sbjct: 219 PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTV 277

Query: 334 IIWDINDIGAEQVLEDAED------ATSEVMMIHAGHRSPINDFAINPSIPWLV 381
            +WD++     +  +   D      A   + +  A H S I  F ++   P  V
Sbjct: 278 RVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSV 331

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 66/156 (42%), Gaps = 30/156 (19%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT-----------DN 178
           H+  V  A + P + +++ + S   TV ++D S  R   S    Y             D 
Sbjct: 136 HNHFVMCADFHPTE-DLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SG DD  V LW ++S +   V      H+
Sbjct: 195 GFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + V+   +H  Q +L  +V ED ++++ D  +  PV
Sbjct: 254 NNVDSVIFHPHQ-NLIISVGEDKTVRVWDLDKRTPV 288

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 105/232 (45%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           GLAF+P  +  +L     S++ LWD        + K+E+ H   V    +H  Q  LF +
Sbjct: 16  GLAFHP-SRPWVLVALFSSSIQLWDYR--MGTLLHKFED-HEGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++      K + T+NG   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           +  ++GH   V   DF   +D +++SA  D+ V +WDI                + I A+
Sbjct: 130 IACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 91/231 (39%), Gaps = 27/231 (11%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV 214
           T+ I++  N ++ A +T   H        F+P  +  ++S S D  V +WD++  R    
Sbjct: 118 TIRIWNWQNRKEIACLT--GHNHFVMCADFHP-TEDLVVSASLDETVRVWDISGLRKRHS 174

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSH 274
                   D +   Q  N     FG       L+ H              +  N  SF H
Sbjct: 175 APSTYTLEDQIAAQQ--NLLDGGFGDCVVKFILEGH-------------ARGVNWASF-H 218

Query: 275 HSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
            +  L+ +GG + +V L+     +   +    GHT+ V S+ F    + +I+S G DK +
Sbjct: 219 PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTI 277

Query: 334 IIWDINDIGAEQVLEDAED------ATSEVMMIHAGHRSPINDFAINPSIP 378
            +WD++     +  +   D      A   + +  A H S I  F ++   P
Sbjct: 278 RVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERP 328

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 66/156 (42%), Gaps = 30/156 (19%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT-----------DN 178
           H+  V  A + P + +++ + S   TV ++D S  R   S    Y             D 
Sbjct: 136 HNHFVMCADFHPTE-DLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SG DD  V LW ++S +   V      H+
Sbjct: 195 GFGDCVVKFILEGHARGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + V+   +H  Q +L  +V ED ++++ D  +  PV
Sbjct: 254 NNVDSVIFHPHQ-NLIISVGEDKTIRVWDLDKRTPV 288

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 116/276 (42%), Gaps = 31/276 (11%)

Query: 79  LILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRAR 138
           L+ GT +   + N+   + ++L        +L  SD  + ++++ V  KF +D + +   
Sbjct: 23  LVTGTASGTVDANFSSESALEL-------WSLLASDPSKPKASLAVDAKF-NDLDWSN-- 72

Query: 139 YMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDD 198
               D  I+A    +G V ++  + +   +    Q H      + FN      L SG   
Sbjct: 73  ----DDKIIAGALDSGVVELFSSTGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSK 128

Query: 199 SNVALWDVT-----SDRNEPVQKW-ENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDT 252
             + +WD+      S+   P+     +   + V    W+     +F +    S   I D 
Sbjct: 129 GEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDL 188

Query: 253 RESKPVATINGTKPFNTLS--------FSHHSENLLATGGVNSE--VYLYDRRYVEEPLH 302
           +  K V  ++   P   L            +S  +    G ++E  + ++D R    PL 
Sbjct: 189 KAKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQ 248

Query: 303 LMS-GHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           ++S GH+  + SLD+ SQD+ ++LS+G D  +++W+
Sbjct: 249 VLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRS 366
           H  A  ++ F+S+ + ++ S G+   + IWD+N       L+++E  T     + +    
Sbjct: 105 HQGAAKTVKFNSKQNNVLASGGSKGEIYIWDLN-----TCLKNSEGYTPLTPGVASTPIE 159

Query: 367 PINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
            +   A N S+  + ASA   +   +W    K
Sbjct: 160 EVTSLAWNQSLAHVFASAGSTSYASIWDLKAK 191

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 87/187 (46%), Gaps = 15/187 (8%)

Query: 170 ITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229
           I L     N + L F PL    LL+   +  +++ D  +++   ++    I    +ND +
Sbjct: 6   INLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQ---IKDKIKIGETSINDFE 62

Query: 230 W--HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG-- 283
              +N+        + + S++I+D + +  + TI   K  PF +L   H   N++A G  
Sbjct: 63  IVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTE 119

Query: 284 --GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
             GV++E+Y+YD R  + P+   +  H D +T + F   D  +++S   D    I+D+ +
Sbjct: 120 LSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179

Query: 341 IGAEQVL 347
              E  L
Sbjct: 180 TEEEDSL 186

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 76/153 (49%), Gaps = 3/153 (1%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K H +  + +    +W++    +  ++   + HS  + D  +++    +  T S D+ + 
Sbjct: 82  KPHWIVSTSNQKAIIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVH 141

Query: 249 IHDTRE-SKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R   +P  T +  +   + + ++    N+LA+   N +V+++D R+   PLH ++G
Sbjct: 142 AWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHGN-DVFIWDLRHGSTPLHKLTG 200

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           H   V S+DFS  ++  I+S+  D  V  WD++
Sbjct: 201 HNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLS 233

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 86/207 (41%), Gaps = 28/207 (13%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYD-RSNERDTASITLQYHTDNGYGLAFNPLI 188
           H   +T   +  Q P+ILAT S    V+ +D RS  R   + +    + +     F    
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFK--- 170

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
             ++L+ S  ++V +WD+    + P+ K    H+  VN   +  F+++   + S D +++
Sbjct: 171 DSNILASSHGNDVFIWDLRHG-STPLHKLTG-HNSGVNSIDFSRFEENKIMSSSNDGTVK 228

Query: 249 IHD-TRESKPVATINGTKPF---NTLSFSHHSENLLATGGVNSEVYLYDRRYVEE----- 299
             D ++E K    I    P      L F H    +   GG NS VYL D    +E     
Sbjct: 229 FWDLSKEEKCQQAITTEFPIWRGRYLPFGHGYCVMPMIGGNNS-VYLMDLDVYDEEKELE 287

Query: 300 ----------PLHLMSGHTDAVTSLDF 316
                     P+    GH+D V  +DF
Sbjct: 288 NPESRIEKLKPVQTFKGHSDRV--IDF 312

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 101/227 (44%), Gaps = 26/227 (11%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW 230
           TL  H +      F+P  K ++ S S D+   LWDV + +   +Q+    HS  V     
Sbjct: 261 TLGGHENRVVNTVFHPSDK-YVASASFDTTWRLWDVETAQELQLQEG---HSKEVYSL-- 314

Query: 231 HNFQ--KSLFGTVSEDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNS 287
            +FQ   +L  +   DS   + D R  K + T+ G  KP   + +S +S  L ATGG + 
Sbjct: 315 -SFQPDGALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQL-ATGGGDG 372

Query: 288 EVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
            V ++D R +E+P   +  H   V+SL F      +++S G D+ + ++  ++      L
Sbjct: 373 VVNVWDLRKLEQPATKLLAHKSIVSSLRFERNRGDVLVSGGYDRALNVYSSDNWNKICCL 432

Query: 348 EDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
           E              GH   +    +     +LV+S  + + V+LWK
Sbjct: 433 E--------------GHTDKLLGVDVAGDCKYLVSSGWDRS-VKLWK 464

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 102/266 (38%), Gaps = 31/266 (11%)

Query: 142 QDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNV 201
           +D  +LA     G V  +     R  A +    HT     + FN       +SG     +
Sbjct: 71  RDGAMLAGALENGVVEFFCARERRSVARVA--RHTTGVRAVRFNAKQANVAVSGGSQGEI 128

Query: 202 ALWD---VTSDRNEPVQKWENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKP 257
            +WD   +++    P      +   D V    W+     +F +        I D +  K 
Sbjct: 129 FVWDTNKISAAGYSPFGPGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKE 188

Query: 258 VATINGTKPFNTLSF---------SHHSENLLATGGVNSEVYL-YDRRYVEEPLHLMS-G 306
           V  ++ T P + L           S+ +    ATG  N  V L +D R    PL +MS G
Sbjct: 189 VIHLSYTSPHSGLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQG 248

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRS 366
           H+  + SLD+   D+ ++LS+G D   I+W            + E+A         G+  
Sbjct: 249 HSKGILSLDWCKHDEKLMLSSGRDNTCILW------------NPEEAQKLTQYPTRGNWC 296

Query: 367 PINDFAINPSIPWLVASAEEENIVQL 392
               FA  P  P L ASA  +N +Q+
Sbjct: 297 FKTKFA--PEAPDLFASASFDNKIQV 320

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 107/252 (42%), Gaps = 36/252 (14%)

Query: 110 LTESDEEQVRSNIRVTRKFK-----HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNE 164
           L  SD E+  ++++V  KF      H+++            I+A     G++ +Y  +  
Sbjct: 47  LLASDSEKPIASLQVDSKFNDLDWSHNNK------------IIAGALDNGSLELYSTNEV 94

Query: 165 RDTASITLQY--HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEP-----VQKW 217
            D  S   ++  H+ +   + FN      L SG ++  + +WD+      P     +   
Sbjct: 95  NDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPANYTPLTPG 154

Query: 218 ENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLS----- 271
           +++ S D VN   W+     +F +    +   I D +  K V  +  T P + +      
Sbjct: 155 QSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCYTSPNSGIKQQLSV 214

Query: 272 FSHHSEN----LLATGGVN-SEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIIL 325
              H +N      ATG  N   + ++D R    PL  L  GH   + SLD+  QD+ ++L
Sbjct: 215 VEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQGHQKGILSLDWCHQDENLLL 274

Query: 326 SAGADKRVIIWD 337
           S+G D  V++W+
Sbjct: 275 SSGRDNTVLLWN 286

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 16/170 (9%)

Query: 239 GTV----SEDSSLQIHDTRES---KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYL 291
           GTV    S DSSL++     S   KP+A++     FN L +SH+++ ++A    N  + L
Sbjct: 30  GTVDANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWSHNNK-IIAGALDNGSLEL 88

Query: 292 YDRRYVEEPLHLM---SGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348
           Y    V + +  M   S H+ +V ++ F+++ D ++ S G +  + IWD+N     +  E
Sbjct: 89  YSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMN-----KCTE 143

Query: 349 DAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
              + T             +N  A N S+  + ASA   N   +W    K
Sbjct: 144 SPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 25/206 (12%)

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           +LLS S+D  V LW V  D+  P+  ++  H   V D ++     +LF T S D + ++ 
Sbjct: 588 YLLSASEDKTVRLWSVQDDK--PLVSYKG-HEKPVWDVEFSPSCNNLFATASNDQTARLW 644

Query: 251 DTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTD 309
                 P+  + G     + +SF H +   + TG  +  V ++D     + + L  GH  
Sbjct: 645 SCDRVYPLRVMAGHLNDVDCVSF-HSNGRYIFTGSSDKTVRMWDIN-TGDSVRLFMGHNS 702

Query: 310 AVTSLDFSSQDDGIILSAGADKRVI-IWDINDIGAEQVLEDAEDATSEVMMIHAGH-RSP 367
            VTSL  S   DG  +S G+D  +I IW   DIG+ + L++             GH +S 
Sbjct: 703 TVTSLSVSP--DGKWISTGSDDGIITIW---DIGSGRKLKNMR-----------GHGKSS 746

Query: 368 INDFAINPSIPWLVASAEEENIVQLW 393
           I+  + NP    LV+   +++ V++W
Sbjct: 747 IHSLSYNPEGTLLVSGGADQS-VRVW 771

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 306 GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHR 365
           GH+  V S  FS+ D+  +LSA  DK V +W + D               + ++ + GH 
Sbjct: 572 GHSGTVYSTSFSAGDE-YLLSASEDKTVRLWSVQD--------------DKPLVSYKGHE 616

Query: 366 SPINDFAINPSIPWLVASAEEENIVQLWKCSHKLP 400
            P+ D   +PS   L A+A  +   +LW C    P
Sbjct: 617 KPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYP 651

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 99/251 (39%), Gaps = 62/251 (24%)

Query: 149 TISGT---GTVYIYDRSNERDTAS----ITLQYHTDNGYGLAFNPLIKGHLLSGSDD--- 198
           TI+G    G++ I+  + E D+      I    HT     + FNP     LLSG +    
Sbjct: 76  TIAGALDNGSIEIFKFNQENDSIQSNELIKNNRHTGPIRSITFNPRQDNLLLSGGEGIIN 135

Query: 199 ------------------SNVALWDVTS-DRNEPVQKWENI---HSDIVNDCQWHNFQKS 236
                             S + ++D+   D  E +    N+     + ++   W+     
Sbjct: 136 SSNSAKTLPTINNIQNTTSEIFIYDLNDVDNPETLPMSPNMTMNRFETISSLAWNKSLSH 195

Query: 237 LFGTVSEDSSLQIHDTRESKPVATIN------GTK---------PFNTLSFSHHSEN--- 278
           +F      S++ I D +  K V  +N      G K         P N+   +  + N   
Sbjct: 196 VFSAAGNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIATATSNNIS 255

Query: 279 --LLATGGVNSEVYLYDRRYVEEPLHLMS----------GHTDAVTSLDFSSQDDGIILS 326
             L AT      +Y++D R    PL ++S          GHTD + SLD+ +QD+  +LS
Sbjct: 256 NPLNATANAGDSIYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQDETFLLS 315

Query: 327 AGADKRVIIWD 337
           +G D  +++W+
Sbjct: 316 SGRDNSIMLWN 326

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 26/240 (10%)

Query: 156 VYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV 214
           V+ Y+++   D  SI TL+ H      +  +PL K +L S S D+   LWD+   +   +
Sbjct: 257 VFGYEKN---DLTSIDTLKGHQGRVSDVKLHPLGK-YLGSSSFDNTWRLWDIEKKKEILL 312

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING-TKPFNTLSFS 273
           Q+    HS  +    +H    SL  T   DS   I D R  K +  + G  KP  +L ++
Sbjct: 313 QEG---HSKEIFSLAFHT-DGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWA 368

Query: 274 HHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
            +   L ATG  +  + ++D R  E     +  H + VTS+ +   + G + SAG DK +
Sbjct: 369 PNGYQL-ATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLI 427

Query: 334 IIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
            I D                T E +    GH   I     +P I  L+ S+  +  V++W
Sbjct: 428 KIHD--------------SKTYESVATLEGHTEKILTLDTSP-ISNLIVSSGWDRTVKIW 472

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 12/57 (21%)

Query: 147 LATISGTGTVYIYD-RSNERDTASI--------TLQYHTDNG---YGLAFNPLIKGH 191
           LAT SG GT+ I+D R+ E + ASI        ++QY  +NG   +   ++ LIK H
Sbjct: 374 LATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIH 430

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 106/245 (43%), Gaps = 32/245 (13%)

Query: 110 LTESDEEQVRSNI--RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDT 167
           +T S   QV S+   +V + F    +V  +    QD  +L     TG V IYD  N R+ 
Sbjct: 57  VTSSTRVQVFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLVAGDATGLVSIYDSYNPRNQ 116

Query: 168 ASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVND 227
             +T Q  +   +   F+P+    L + +DD  V LWD+ S   +P+ +     SD V  
Sbjct: 117 L-VTFQASSHPTHVTKFHPMDSKSLTTANDDRVVRLWDI-SHAYQPILELTGA-SDYVRS 173

Query: 228 CQWHNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKPF-NTLSFSHHSENLLATGG 284
             +      +  + S D  ++++DTR   S+PV T+N   P  +T+S S     L++ GG
Sbjct: 174 ICFLPGTPHMVVSGSYDGVIRLYDTRMESSQPVTTLNHGMPIEDTISMSQ--TQLISCGG 231

Query: 285 VNSEVY-------LYDRRYVEEPLHLMSGHTDAVTSLDF-----SSQDDGIILSAGADKR 332
              +V+       LY R                VT L++      +  D  +L++  D  
Sbjct: 232 SKFKVWDLTGNKLLYSR----------GNFAKTVTCLNYVNMPSDAAMDSCLLASSLDGH 281

Query: 333 VIIWD 337
           V ++D
Sbjct: 282 VKVFD 286

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 88/211 (41%), Gaps = 26/211 (12%)

Query: 152 GTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRN 211
           G G ++I D S E    +       D  + LA++ L +   L    D ++ L+D T D+ 
Sbjct: 36  GNGKLWILDISPEGQMVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDK- 94

Query: 212 EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD-------------TRESKPV 258
            PV  ++  H D V  C W    ++ F +   D  +++               TR +  V
Sbjct: 95  YPVAVYQE-HRDEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAV 153

Query: 259 -------ATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVE---EPLHLMSGHT 308
                   T NG        FS H ++L+     +S V L+D R  +    P H    H+
Sbjct: 154 LDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHS 213

Query: 309 DAVT-SLDFSSQDDGIILSAGADKRVIIWDI 338
            + T S+DF+     +I + G D ++ IWD+
Sbjct: 214 GSETLSVDFNKYRTNVIATGGVDNKIKIWDL 244

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/258 (20%), Positives = 99/258 (38%), Gaps = 57/258 (22%)

Query: 134 VTRARYMPQDP-----------NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           VTR  Y+ QD            N      G G++ ++D + ++   ++  Q H D     
Sbjct: 52  VTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDKYPVAV-YQEHRDEVASC 110

Query: 183 AFNPLIKGHLLSGSDDSNVALWDV----------------TSDRNEPVQKWENIHSDIVN 226
            ++ + +   +S   D  V +W V                T+  + P         D V 
Sbjct: 111 NWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVY 170

Query: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRESKP-------VATINGTKPFNTLSFSHHSENL 279
             ++     SL    S DS++ + D R S+P           +G++   ++ F+ +  N+
Sbjct: 171 QAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETL-SVDFNKYRTNV 229

Query: 280 LATGGVNSEVYLYDRRYVEE-PL--------------------HLMSGHTDAVTSLDFSS 318
           +ATGGV++++ ++D R +   PL                     ++ GH  AV  +++S 
Sbjct: 230 IATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSP 289

Query: 319 QDDGIILSAGADKRVIIW 336
                +LS   D    IW
Sbjct: 290 HSSNYLLSTSYDMTCCIW 307

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 88/189 (46%), Gaps = 24/189 (12%)

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHN---FQKS 236
           + L   P  K  LL+G  +  + L D  + +  P+QK     + I ND +  +      +
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWNTGK--PLQKIRASETAI-NDMKIIDSDFVAGN 73

Query: 237 LFGTVSEDSSLQIHDTRESKPVATING--TKPFNTLSFSHHSENLLATG----GVNSEVY 290
           L  + S DS +++ D R +  VA IN     PF +L   H    LLA G    G+++ ++
Sbjct: 74  LISSASIDS-VKVFDIRSNDCVAKINNETNSPFLSLDSRH---GLLACGTELQGIDAAIH 129

Query: 291 LYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLED 349
           +YD R  + PL  L+  H D VT + F   D  ++LS   D    I+D+         +D
Sbjct: 130 IYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DD 182

Query: 350 AEDATSEVM 358
            EDA  +V+
Sbjct: 183 EEDALHQVI 191

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 86/210 (40%), Gaps = 17/210 (8%)

Query: 143 DPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVA 202
           D  I+A     G V  +D    +  A I    H      L FN      L+SG     + 
Sbjct: 73  DDKIIAGALENGVVEFFDPKALKSVAKI--HKHQGPVKTLKFNAKQNNVLVSGGTQGEIF 130

Query: 203 LWDV----TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           +WD     +SD +       N   D V+   W+     +F + S      + D +  K V
Sbjct: 131 VWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQV 190

Query: 259 ATIN------GTK-PFNTLSFSHHSENLLATGGVNSE---VYLYDRRYVEEPLHLMS-GH 307
             +N      G K P   + +   S  ++AT   +     V  +D R    PL ++S GH
Sbjct: 191 LHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGH 250

Query: 308 TDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           +  V SLD+  QD+ ++LS+G D   ++W+
Sbjct: 251 SKGVLSLDWCKQDENLLLSSGRDNTSVLWN 280

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 255 SKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSL 314
           SKP  ++     FN L +S   + ++A    N  V  +D + ++  +  +  H   V +L
Sbjct: 53  SKPSGSVVADGKFNDLDWSGD-DKIIAGALENGVVEFFDPKALKS-VAKIHKHQGPVKTL 110

Query: 315 DFSSQDDGIILSAGADKRVIIWDINDIGA 343
            F+++ + +++S G    + +WD N IG+
Sbjct: 111 KFNAKQNNVLVSGGTQGEIFVWDSNKIGS 139

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 98/222 (44%), Gaps = 46/222 (20%)

Query: 124 VTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI------TLQYHTD 177
           + +  +H + V   R+  +  N+L +    G +YI+D +N+ +T         T     D
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWD-ANKIETPGYAPFVPGTAMTPMD 155

Query: 178 NGYGLAFNPLIKGHLLSGSDDSNVA-LWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKS 236
             Y LA+N   +GH+ + +  S  A +WD+ + +       E IH          +   S
Sbjct: 156 EIYSLAWN-QNQGHVFASAGSSGFASIWDLKAKK-------EVIH---------LSHTSS 198

Query: 237 LFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRY 296
           + G  ++ S ++ H    ++ +AT +G+                     +  + ++D R 
Sbjct: 199 ITGQKNQLSIVEWHPNNSTR-IATASGSD-------------------SDPSILVWDLRN 238

Query: 297 VEEPLHLMS-GHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
              PL  +S GHT  V SLD+  QD+ ++LS+G D   ++W+
Sbjct: 239 ANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWN 280

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 17/168 (10%)

Query: 185 NPLIKGHLLSG------SDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHNFQKSL 237
           +PL+     SG      S DS + +W + S      Q   ++ +D   ND  W ++  S+
Sbjct: 20  SPLLATGTASGTIDADFSSDSTLEIWSLLSPHEATPQG--SVSADAKFNDLDW-SYDNSV 76

Query: 238 FGTVSEDSSLQIHDTRESKPVATI-NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRY 296
                ++  ++     E K +A +   + P  T+ F+    N+L +GG   E+Y++D   
Sbjct: 77  LTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANK 136

Query: 297 VEEPLH--LMSGHT----DAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           +E P +   + G      D + SL ++     +  SAG+     IWD+
Sbjct: 137 IETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDL 184

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 53/103 (51%), Gaps = 5/103 (4%)

Query: 242 SEDSSLQI---HDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVE 298
           S DS+L+I       E+ P  +++    FN L +S+  +N + TG +++ V  +      
Sbjct: 37  SSDSTLEIWSLLSPHEATPQGSVSADAKFNDLDWSY--DNSVLTGALDNGVVEFFSPSEY 94

Query: 299 EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI 341
           + +  ++ H+  V ++ F+++   ++ S G+   + IWD N I
Sbjct: 95  KSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKI 137

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 102/226 (45%), Gaps = 26/226 (11%)

Query: 129 KHDSEVTRARYMPQDPNILATISGTGTVYIYD-RSNERDTASITLQYHTDNGYGLAFNPL 187
           KH   +T   + PQ P+ILAT S    V+ +D RS +R   + +      +    +FN  
Sbjct: 112 KHFRAITDINFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSGASQVKWSFN-- 169

Query: 188 IKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSL 247
              ++L+ +  ++V +WD+    + P+ K    H   VN   ++ F+++   T S D S+
Sbjct: 170 -DQNVLASAHGNDVCIWDLRKG-STPLGKLVG-HGSSVNSVDFNRFKRTELMTGSNDGSV 226

Query: 248 QIHDTRES--KPVATINGTKPF---NTLSFSHHSENLLATGGVNSEVY---LYDRRYVEE 299
           +  D  +S  +P+ TI    P      L F      + + GG NS VY   L  R  VEE
Sbjct: 227 KFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSVGGFNS-VYVASLAKRDGVEE 285

Query: 300 -------PLHLMSGHTDAVTSLDFSSQDDGIILSAGADK--RVIIW 336
                  P++   GH D VT  DF  +      S G D+  +++ W
Sbjct: 286 VNDSKLQPIYAFKGHDDRVT--DFVWRSRSSCGSDGCDREFQLVTW 329

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 67/151 (44%), Gaps = 3/151 (1%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K + +  + +    +W++    +  ++   + H   + D  +      +  T S D+ + 
Sbjct: 81  KPYWVVSTSNQKAIIWNLAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVH 140

Query: 249 IHDTRE-SKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R   +P  T +G     + + +S + +N+LA+   N +V ++D R    PL  + G
Sbjct: 141 AWDLRSPQRPFYTTSGWLSGASQVKWSFNDQNVLASAHGN-DVCIWDLRKGSTPLGKLVG 199

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           H  +V S+DF+      +++   D  V  WD
Sbjct: 200 HGSSVNSVDFNRFKRTELMTGSNDGSVKFWD 230

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329
           ++FS    ++LAT  +++ V+ +D R  + P +  SG     + + +S  D  ++ SA  
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSGASQVKWSFNDQNVLASAHG 179

Query: 330 DKRVIIWDI 338
           +  V IWD+
Sbjct: 180 ND-VCIWDL 187

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 87/217 (40%), Gaps = 27/217 (12%)

Query: 143 DPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVA 202
           D  I+A     G+V ++  + +   +    Q H        FN      L +G     + 
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKSEAKFQRHKTTAKVARFNAKQFNVLATGGTKGEIF 132

Query: 203 LWDVTSDRNEPVQKWENIHSDI-----------VNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           +WDV      P     N ++ +           +    W+     +F +    S   I D
Sbjct: 133 IWDVNKCLENP-----NDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWD 187

Query: 252 TRESKPVATINGTKPFNTLS-----FSHHSEN----LLATGGVN-SEVYLYDRRYVEEPL 301
            +  K V  ++ T P   L         H +N      ATG  N   + ++D R    PL
Sbjct: 188 LKAKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPL 247

Query: 302 HLMS-GHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
            ++S GH+  V SLD+ +QD+ ++LS+G D  V++W+
Sbjct: 248 QVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWN 284

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 124/298 (41%), Gaps = 47/298 (15%)

Query: 138 RYMPQDPNILATISGT-------GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG 190
           +Y P   N LA  SG+       G ++I D   +    S+      D  Y +A+N L + 
Sbjct: 16  QYSPFFDNRLAVASGSNFGLVGNGNLFILDIDPQGRIHSMNSFMTQDCLYDVAWNELHEN 75

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
            +L    D ++ L+D TS +  P+  ++  HS  V  C W+   K  F + S D +++I 
Sbjct: 76  QVLVAQGDGSLRLFD-TSLQKFPIAIFKE-HSKEVLSCNWNLINKQTFVSSSWDGTVKIW 133

Query: 251 D--------TRESKPV----------ATINGTKPFNTLS----------FSHHSENLLAT 282
                    T + +PV          A  NG++   T+S          FS H ENL+  
Sbjct: 134 TPNRKESLRTLQVQPVMQSQLVDNTIAKTNGSR--GTISANKNCIYQAQFSPHDENLVMC 191

Query: 283 GGVNSEVYLYDRRY---VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
              NS V L+D R      +    ++ +     + DF+     ++ ++G D  + IWDI 
Sbjct: 192 CSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDIR 251

Query: 340 ---DIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              ++G +   +    + + +  I   H   +   A +P  P ++ SA  +    +W+
Sbjct: 252 MLVNLGPQS--QHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 103/239 (43%), Gaps = 44/239 (18%)

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENI--------HSD 223
            +Y  +N + L   PL +  L++   D +V L D           W N+        H+ 
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLD-----------WGNLKTISSIQCHTT 56

Query: 224 IVNDCQWHNFQ---KSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSEN 278
            +ND +  N      ++F T +ED  +++ D R    VA++   K  PF +L   H   N
Sbjct: 57  SINDMKVINSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPFFSLDSRH---N 112

Query: 279 LLATG----GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
           +LA G      ++E+++YD R   +P+   +  H D +T + F   D  +++S   D  V
Sbjct: 113 MLACGTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYV 172

Query: 334 IIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
            I+D+         +D EDA  +V+   + H        + P   W ++  E   I +L
Sbjct: 173 NIYDLTQ-------DDEEDALHQVINFASIHSCG----WLGPKRIWSLSHMETFGIHEL 220

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 9/79 (11%)

Query: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE--- 212
           ++IYD  N        +  H D+   + F+P     L+SGS D  V ++D+T D  E   
Sbjct: 127 LHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDAL 186

Query: 213 -PVQKWENIHSDIVNDCQW 230
             V  + +IHS     C W
Sbjct: 187 HQVINFASIHS-----CGW 200

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 18/175 (10%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD---VTSDRNEPVQKWENIHSDIVNDCQW 230
           + +DN + L F PL    LL+   +  V L D   +   RN  + +       ++N+  +
Sbjct: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINN-DY 68

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----G 284
           +N   SLF T + +S ++I+D + +  +ATI   K  PF +L   H   ++LA G    G
Sbjct: 69  NN--ASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRH---DMLACGTELQG 122

Query: 285 VNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           V++E+Y+YD R    P+   +  H D +T + F   D   +LS   D    ++D+
Sbjct: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQ 215
           +YIYD  N        +  H D+   + F+P     LLSGS D    ++D+T  + E   
Sbjct: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ-QEEDDA 185

Query: 216 KWENIHSDIVNDCQW 230
            ++ I+   ++ C W
Sbjct: 186 LYQVINYASIHSCGW 200

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 16/168 (9%)

Query: 142 QDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG------HLLSG 195
            D N +AT SG G V  ++ S+  +  S    Y    G  L  +P++        ++LS 
Sbjct: 78  HDLNKMATGSGDGVVKFWNMSSSEELCSFKAHYGIVTG--LCVSPVLASKNKNLQYMLSC 135

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNFQ-----KSLFGTVSEDSSLQ 248
            DD  V LW V +D    V+  +N+++  +    +  H+FQ     +S    V+  + +Q
Sbjct: 136 GDDKTVKLWSVDTDDYADVKDDQNLNTRGLLKTFYGDHSFQGIDHHRSNSAFVTGGAQIQ 195

Query: 249 IHDTRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRR 295
           + DT  SK  + ++ G     ++ F+ +  N+LA+ G ++ + LYD R
Sbjct: 196 LWDTSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLR 243

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 74/199 (37%), Gaps = 49/199 (24%)

Query: 148 ATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVT 207
           A ++G   + ++D S  + T++  L +  DN   + FN      L S   D+++ L+D+ 
Sbjct: 186 AFVTGGAQIQLWDTSRSKSTSN--LSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLR 243

Query: 208 SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPF 267
           +  N P QK   +     N   W                               N  +PF
Sbjct: 244 T--NSPTQKI--VQQMRTNSLCW-------------------------------NPMEPF 268

Query: 268 NTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSA 327
           N             TG  +   Y YD R +   L++   H  AV  +DF+   D I+ + 
Sbjct: 269 N-----------FVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGDEIV-TG 316

Query: 328 GADKRVIIWDINDIGAEQV 346
             DK + I+  N   + +V
Sbjct: 317 SYDKTIRIFKTNHGHSREV 335

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 134 VTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLL 193
           +T  ++   D NILA+     ++ +YD      T  I  Q  T++   L +NP+   + +
Sbjct: 215 ITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNS---LCWNPMEPFNFV 271

Query: 194 SGSDDSNVALWDV 206
           +G++D N   +D+
Sbjct: 272 TGNEDHNAYYYDM 284

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 27/184 (14%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC------ 228
           H D  Y +A +      + +GS D  V  W+++S  +E +  ++  +  +   C      
Sbjct: 66  HRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSS--SEELCSFKAHYGIVTGLCVSPVLA 123

Query: 229 -QWHNFQKSLFGTVSEDSSLQI--------HDTRESKPVATINGTKPF-NTLSFS----H 274
            +  N Q  L  +  +D ++++         D ++ + + T    K F    SF     H
Sbjct: 124 SKNKNLQYML--SCGDDKTVKLWSVDTDDYADVKDDQNLNTRGLLKTFYGDHSFQGIDHH 181

Query: 275 HSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVI 334
            S +   TGG  +++ L+D    +   +L  G  D +TS+ F+  D  I+ S G+D  ++
Sbjct: 182 RSNSAFVTGG--AQIQLWDTSRSKSTSNLSWG-ADNITSVKFNQNDSNILASTGSDNSIV 238

Query: 335 IWDI 338
           ++D+
Sbjct: 239 LYDL 242

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 104/232 (44%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  LF +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++      K + T+NG   +    F HH    + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLETKKCLFTLNGHLDYVRTVFFHHELPWIISCSDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG----------------AE 344
           +  ++GH   V    F   +D +++SA  D+ V +WDI+ +                 A+
Sbjct: 130 IACLTGHNHFVMCAQFHPSED-LVVSASLDETVRVWDISGLRKKHSAPGASSFEEQMIAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P L+ S  ++  V++W+ S
Sbjct: 189 QNLLDGGFGECVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKIWRMS 239

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 30/156 (19%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTAS-----------ITLQYHTDN 178
           H+  V  A++ P + +++ + S   TV ++D S  R   S           I  Q   D 
Sbjct: 136 HNHFVMCAQFHPSE-DLVVSASLDETVRVWDISGLRKKHSAPGASSFEEQMIAQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SG DD  V +W +++ +   V      H+
Sbjct: 195 GFGECVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKIWRMSATKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + V+   +H  Q +L  +V ED +++  D  +  PV
Sbjct: 254 NNVDSVIFHPHQ-NLIISVGEDKTIRTWDLDKRTPV 288

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 6/165 (3%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQ 234
           HT+    L F P     LLSG +D+ V +WD    RN  + +    HS  +N   + N  
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRN--LLRDYKGHSKAINSLDF-NDD 210

Query: 235 KSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDR 294
            + F + S D +++I DT + K    ++     N + F   + +    G  NS++Y YD 
Sbjct: 211 GTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDT 270

Query: 295 RYVEEP--LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           R  E    + +   H  ++ +L F   D    +S+  DK V IWD
Sbjct: 271 RISENDGRVQVYDHHMSSILALKFFP-DGSKFISSSEDKTVRIWD 314

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 14/92 (15%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIH 361
           + M GHT+  TSL F      ++LS G D  V +WD        +L D           +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF--YHKRNLLRD-----------Y 195

Query: 362 AGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
            GH   IN    N      ++S+ +  I ++W
Sbjct: 196 KGHSKAINSLDFNDDGTNFISSSFDHTI-KIW 226

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 103/223 (46%), Gaps = 20/223 (8%)

Query: 140 MPQDPNILATISGTGTVYIYDRSN---------ERDTASITLQYHTDNGYGLAFNPLIKG 190
           M Q+P    T++ TG    +  S          + ++  +  Q H D+   LA++P    
Sbjct: 300 MGQNPVNTVTVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSP-DGS 358

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
            +++ SDD  + +WDVTS     +  +E  H+  V   Q+    + +F + S D +++  
Sbjct: 359 RVVTASDDGKIKVWDVTS--GFCLATFEE-HTSSVTAVQFAKRGQVMFSS-SMDGTVRAW 414

Query: 251 DTRESKPVATINGTK--PFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHT 308
           D    +   T  GT+   FN L+     E + A    N +++++  +   + L  +SGH 
Sbjct: 415 DLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDALSGHE 473

Query: 309 DAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAE 351
             V+ L F SQ++ ++ SA  DK + IW I   G  Q +E  E
Sbjct: 474 GPVSCLSF-SQENSVLASASWDKTIRIWSI--FGRSQQVEPLE 513

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 105/232 (45%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGIDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D S+++     +K + T+NG   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYSIKVWSLETNKCLYTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           L  ++GH   V    F   +D +++SA  D+ + +WDI                + + ++
Sbjct: 130 LACLTGHNHFVMCAQFHPTED-LVVSASLDETIRVWDIAGLRKRHSAPGASSFEDQMASQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L DA      V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 95/239 (39%), Gaps = 27/239 (11%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV 214
           T+ I++  N ++ A +T   H        F+P  +  ++S S D  + +WD+   R    
Sbjct: 118 TIRIWNWQNRKELACLT--GHNHFVMCAQFHP-TEDLVVSASLDETIRVWDIAGLRKRHS 174

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSH 274
               +   D +   Q  N   + FG       L+ H             T+  N  SF H
Sbjct: 175 APGASSFEDQMASQQ--NLLDAGFGDCVVKFILEGH-------------TRGVNWASF-H 218

Query: 275 HSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
            +  L+ +GG + +V L+     +   +    GHT+ V S+ F    + +I+S G DK +
Sbjct: 219 PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTL 277

Query: 334 IIWDINDIGAEQVLEDAED------ATSEVMMIHAGHRSPINDFAINPSIPWLVASAEE 386
            +WD++     +  +   D      A   + +  A H S I  F ++   P  V    E
Sbjct: 278 RVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSVTHQNE 336

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 53/120 (44%), Gaps = 17/120 (14%)

Query: 286 NSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345
           +S + L+D R +   LH    H   V  +DF      I +SAG D  + +W +       
Sbjct: 32  SSTIQLWDYR-MGTLLHRFEDHEGPVRGIDFHPTQP-IFVSAGDDYSIKVWSLE------ 83

Query: 346 VLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENI-VQLWKCSHKLPRISG 404
                   T++ +    GH   +     +  +PW++++++++ I +  W+   +L  ++G
Sbjct: 84  --------TNKCLYTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKELACLTG 135

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 99/223 (44%), Gaps = 16/223 (7%)

Query: 123 RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           +V + F    +V  +     D  +LA    TG V +YD  N R+   ++++  T   +  
Sbjct: 72  QVIKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSYNPRNLL-VSIKASTHPAHVT 130

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
            F+PL K  L++ +DD  V +WD+ S   EP  +     SD V    +      +  +  
Sbjct: 131 KFHPLDKQTLVTATDDRVVRVWDI-SHAYEPTLELLGA-SDYVRSVCFVPGAPHMVVSGC 188

Query: 243 EDSSLQIHD--TRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEE 299
            D  +++HD  TR ++PV  +N G    + ++ S     L++ GG   +V+      +  
Sbjct: 189 YDGVVRLHDTRTRSAQPVTQLNHGMSVEDIVAIS--PTQLVSCGGSKFKVWDLTGNKL-- 244

Query: 300 PLHLMSGHTDAVTSLDFSSQDDG-----IILSAGADKRVIIWD 337
            LH        VT LD+ +  DG      +L++  D  V ++D
Sbjct: 245 -LHERGNFAKTVTCLDYVNMPDGGAMNSCLLASSLDGHVKVFD 286

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 57/152 (37%), Gaps = 13/152 (8%)

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           V+  + +Q+  +R  + + T +  K     S       LLA G     V +YD       
Sbjct: 57  VTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSYNPRNL 116

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           L  +   T       F   D   +++A  D+ V +WDI+          A + T E++  
Sbjct: 117 LVSIKASTHPAHVTKFHPLDKQTLVTATDDRVVRVWDIS---------HAYEPTLELL-- 165

Query: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
             G    +      P  P +V S   + +V+L
Sbjct: 166 --GASDYVRSVCFVPGAPHMVVSGCYDGVVRL 195

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 30/235 (12%)

Query: 181 GLAFNP---LIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSL 237
           G+AF+P   L+   L S    S + LWD        + ++E  H   V    +H  Q  +
Sbjct: 16  GIAFHPSRPLVLVALFS----STIQLWDYR--MGTLLHRFEG-HDGPVRGIDFHPTQ-PI 67

Query: 238 FGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYV 297
           F +  +D++++I     +K + T  G   +    F HH    L +   +  + +++ +  
Sbjct: 68  FASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNWQNR 127

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG--------------- 342
           +E +  ++GH   V    F   +D +++SA  D+ V +WDI+ +                
Sbjct: 128 KE-IACLTGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQM 185

Query: 343 -AEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
            A+Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 186 IAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 74/181 (40%), Gaps = 30/181 (16%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTAS-----------ITLQYHTDN 178
           H+  V  A++ P + +++ + S   TV ++D S  R   S           I  Q   D 
Sbjct: 136 HNHFVMCAQFHPTE-DLVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMIAQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SG DD  V LW ++S +   +      H+
Sbjct: 195 GFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEIDSCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLAT 282
           + V DC   + Q++L  +  ED +L++ D  +  PV           L  +H + NL   
Sbjct: 254 NNV-DCVIFHPQQNLIISAGEDKTLRVWDLDKRVPVKQFKRENDRFWLVAAHPTINLFGA 312

Query: 283 G 283
            
Sbjct: 313 A 313

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 83/194 (42%), Gaps = 21/194 (10%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           L + S   T+ I++  N ++ A +T   H        F+P  +  ++S S D  V +WD+
Sbjct: 110 LISASDDQTIRIWNWQNRKEIACLT--GHNHFVMCAQFHP-TEDLVVSASLDETVRVWDI 166

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKP 266
           +  R +          D +   Q  N     FG       L+ H             T+ 
Sbjct: 167 SGLRKKHSAPGAMSMEDQMIAQQ--NLLDGGFGDCVVKFILEGH-------------TRG 211

Query: 267 FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIIL 325
            N  SF H +  L+ +GG + +V L+     +   +    GHT+ V  + F  Q + +I+
Sbjct: 212 VNWASF-HPTLPLIVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHPQQN-LII 269

Query: 326 SAGADKRVIIWDIN 339
           SAG DK + +WD++
Sbjct: 270 SAGEDKTLRVWDLD 283

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 95/252 (37%), Gaps = 60/252 (23%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG----HLLSGSDDSN 200
           N LAT SG G V  ++ S   +  S    Y    G  +    L K     ++LS  DD  
Sbjct: 81  NKLATASGDGVVKYWNMSTREELCSFKAHYGLVTGLCVTPQHLSKNKNENYMLSCGDDKM 140

Query: 201 VALWDVTSDRNEPVQK----------WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           + LW V SD     +            +  H +       H+  KS F  V+  + +++ 
Sbjct: 141 IKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSIDHHRTKSTF--VTGGAQIELW 198

Query: 251 DTRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEV-------------------- 289
           DT  SKPV+ ++ G     ++ F+ +  ++LA+ G ++ V                    
Sbjct: 199 DTGRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT 258

Query: 290 ----------------------YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSA 327
                                 Y YD R +   L++   H  AV  +DFS   D I+ + 
Sbjct: 259 NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV-TG 317

Query: 328 GADKRVIIWDIN 339
             DK V I+ +N
Sbjct: 318 SYDKTVRIYQVN 329

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 74/143 (51%), Gaps = 7/143 (4%)

Query: 203 LWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV---A 259
           +W+++   +  V+   + HS  + D  +H     +  T S D+ +   D R S+     A
Sbjct: 95  VWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSA 154

Query: 260 TINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ 319
           ++  +     + ++  + N++A+   N +++++D R    PLH++ GH ++V S+DFS  
Sbjct: 155 SV-WSAGAAQVKWNFKNPNVMASAHSN-DIFIWDLRKGCMPLHILKGHANSVNSIDFSRF 212

Query: 320 DDGIILSAGADKRVIIWD--IND 340
           ++  I+S+  D  V  WD  +ND
Sbjct: 213 NETEIMSSSNDGTVKFWDYSVND 235

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 85/175 (48%), Gaps = 19/175 (10%)

Query: 58  WPSLTVQWLPH-SAPNPVT----RQELI--LGTHTSDEEQNYL---KIAVVDLPTEVTDT 107
           W    VQW PH S P+ V     ++ L+  L   +S+  ++ L     A+ D+    T+ 
Sbjct: 68  WEVADVQWSPHPSKPSWVVSTSNQKALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNP 127

Query: 108 SNL-TESDEEQVRS-NIRVTRKFKHDSEV-----TRARYMPQDPNILATISGTGTVYIYD 160
             L T S +  V + ++R +R+  + + V      + ++  ++PN++A+ + +  ++I+D
Sbjct: 128 EILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPNVMAS-AHSNDIFIWD 186

Query: 161 RSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQ 215
                    I L+ H ++   + F+   +  ++S S+D  V  WD + +  EP++
Sbjct: 187 LRKGCMPLHI-LKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYSVNDKEPLR 240

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 123/295 (41%), Gaps = 43/295 (14%)

Query: 71  PNPVTRQELILGTHTSDEEQNYLKIAVVDLPTE---VTDTS---------NLTESDEEQV 118
           PN V  +  +L   T+ E++ + + +   L  E   VT+ +          +T S   Q+
Sbjct: 6   PNIVVARGAVLPQQTTPEQRYWRQYSSAQLVKEHNAVTEIAFNPKSPFDFAVTSSTRVQI 65

Query: 119 RSNI--RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT 176
            S+   +V + F    +V        D  +L     TG V +YD  N R+   +++Q  T
Sbjct: 66  FSSRTRQVVKTFSRFKDVVYCANFRADGKLLVAGDATGLVSVYDSYNPRNVL-VSIQAST 124

Query: 177 DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKS 236
              +   F+P+    L++ SDD    LWD+ S   EP  +     +D V           
Sbjct: 125 HPTHVTKFHPMDSKTLITSSDDRVTRLWDI-SHAYEPTLELGGA-TDYVRSLTCVPSAPH 182

Query: 237 LFGTVSEDSSLQIHDTR--ESKPVATINGTKPF-NTLSFSHHSENLLATGGVNSEVY--- 290
           L  T S D  ++++DTR   S P+ ++N  +P  N ++ S     L++ GG N +V+   
Sbjct: 183 LVATGSYDGLVRMYDTRTQSSDPIYSLNHDQPVENVIAIS--PTQLVSCGGPNFKVWDLT 240

Query: 291 ----LYDRRYVEEPLHLMSGHTDAVTSLD----FSSQDDGIILSAGADKRVIIWD 337
               LY+R                VT LD    FSS     +++   D  V ++D
Sbjct: 241 NNKQLYER----------GNFNKTVTCLDHVENFSSPMPQALIAGSLDGHVKVFD 285

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 102/225 (45%), Gaps = 24/225 (10%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K + +  + +    +W++    ++ +    + HS  + D  ++     +  T S D+ + 
Sbjct: 84  KPYWVVSTSNQKALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVH 143

Query: 249 IHDTRE-SKPVATINGTKP-FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R   +P  T +  +   + + +++   N+LA+   N ++Y++D R    PLH + G
Sbjct: 144 AWDMRSPHRPFYTTSAWRSGASQVKWNYKDSNILASAHSN-DIYIWDLRMGSTPLHKLVG 202

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEV---MMIHAG 363
           H  +V S+DF+      I+S+  D  V  WDI+        + +++ TS V     I  G
Sbjct: 203 HDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDIS--------KGSDNCTSTVSTDFPIWRG 254

Query: 364 HRSPI-NDFAINP-----SIPWLVASAEEENIVQLWKCSHKLPRI 402
              P  N F I P     +  +L    E+EN+ +    S+KL ++
Sbjct: 255 RYLPFGNGFCIMPQEGGGNAVYLSTLKEQENLNE----SNKLTKL 295

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 43/223 (19%), Positives = 90/223 (40%), Gaps = 21/223 (9%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           H   +T   + P++P+ILAT S    V+ +D  +       T  + +  G          
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRS--GASQVKWNYKD 173

Query: 190 GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI 249
            ++L+ +  +++ +WD+    + P+ K    H   VN   ++ F+ S   + S D +++ 
Sbjct: 174 SNILASAHSNDIYIWDLRMG-STPLHKLVG-HDSSVNSIDFNRFKSSEIMSSSNDGTVKF 231

Query: 250 HDTRESKPVATINGTKPF-----NTLSFSHHSENLLATGGVNSEVYLYDRRYVE------ 298
            D  +     T   +  F       L F +    +   GG N+ VYL   +  E      
Sbjct: 232 WDISKGSDNCTSTVSTDFPIWRGRYLPFGNGFCIMPQEGGGNA-VYLSTLKEQENLNESN 290

Query: 299 -----EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIW 336
                +P++   GH++ V    + S+    ++    + +++ W
Sbjct: 291 KLTKLQPIYSFKGHSERVIDFLWRSRQPSDLMVNDCEFQLVTW 333

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 104/236 (44%), Gaps = 28/236 (11%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  LF +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRYED-HEGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T++G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLETNKCLYTLDGHLDYVRTVFFHKELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND-------------------- 340
           +  ++GH   V    F   +D +I+SA  D+ V +WDI+                     
Sbjct: 130 IACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHSAPGRSAMPTSFEEK 188

Query: 341 IGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           I A+Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LWK S
Sbjct: 189 IAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 95/240 (39%), Gaps = 41/240 (17%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-- 212
           T+ I++  N ++ A IT   H        F+P  +  ++S S D  V +WD++  R +  
Sbjct: 118 TIRIWNWQNRKEIACIT--GHNHFVMCAQFHP-TEDLIVSASLDETVRVWDISKLREKHS 174

Query: 213 -------PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK 265
                  P    E I +         N     FG  +    L+ H             T+
Sbjct: 175 APGRSAMPTSFEEKIAAQ-------QNLLDGGFGDCTVKFILEGH-------------TR 214

Query: 266 PFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGII 324
             N  SF H +  L+ +GG + +V L+     +   L    GHT+ V S+ F    + +I
Sbjct: 215 GVNWASF-HPTLPLIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQN-LI 272

Query: 325 LSAGADKRVIIWDINDIGAEQVLEDAED------ATSEVMMIHAGHRSPINDFAINPSIP 378
           LS G DK + +WD++     +  +   D      A   + +  A H S I  F ++   P
Sbjct: 273 LSVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 105/232 (45%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGLDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T++G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI----------------GAE 344
           +  ++GH   V    F   DD +I+SA  D+ + IWDI+ +                 A+
Sbjct: 130 IACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQMNAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P +V SA ++  V+LW+ S
Sbjct: 189 QNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIV-SASDDRQVKLWRMS 239

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 91/192 (47%), Gaps = 8/192 (4%)

Query: 146 ILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD 205
           +L T +  G V +Y  ++     +  L+ H        F+P  +  L S S D+   LWD
Sbjct: 233 MLVTGAEDGMVKLYSYTSNEIKETTVLKGHEKRVVATKFHPSTR-FLGSTSFDTTWRLWD 291

Query: 206 VTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING-T 264
           + + +   +Q+    HS  V    +     SL  T   D++  + D R  K + T+NG +
Sbjct: 292 IATSQELLLQEG---HSKEVYSLSFQG-DGSLVCTGGLDNTALLWDIRCGKSIMTLNGHS 347

Query: 265 KPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGII 324
           KP   + +S +  N+ ATGG +  + ++D R     ++ +  H + ++ L F+ QD   +
Sbjct: 348 KPVYCVDWSCNGYNV-ATGGGDGLINIWDIRKTN-LVNTILAHNNIISDLRFAKQDSKCL 405

Query: 325 LSAGADKRVIIW 336
           +S   DK++ I+
Sbjct: 406 VSCSYDKKINIY 417

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 80/186 (43%), Gaps = 24/186 (12%)

Query: 212 EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD--TRESKPVATINGTKPFNT 269
           EP  K +N+HS  +    W N    +  T +ED  ++++   + E K    + G +    
Sbjct: 209 EPTVKIDNVHSGKIGGLDW-NKTGGMLVTGAEDGMVKLYSYTSNEIKETTVLKGHEKRVV 267

Query: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG-IILSAG 328
            +  H S   L +   ++   L+D    +E L L  GH+  V SL F  Q DG ++ + G
Sbjct: 268 ATKFHPSTRFLGSTSFDTTWRLWDIATSQELL-LQEGHSKEVYSLSF--QGDGSLVCTGG 324

Query: 329 ADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSI-PWLVASAEEE 387
            D   ++WDI                 + +M   GH  P+  + ++ S   + VA+   +
Sbjct: 325 LDNTALLWDIR--------------CGKSIMTLNGHSKPV--YCVDWSCNGYNVATGGGD 368

Query: 388 NIVQLW 393
            ++ +W
Sbjct: 369 GLINIW 374

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 84/200 (42%), Gaps = 41/200 (20%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG-----HLLSGSDDS 199
           N LA+ S  G V  ++ S   +  S    Y    G  L  +P   G     ++LS  DD 
Sbjct: 81  NRLASASADGVVKYWNISTREELCSFKAHYGLVTG--LCVSPQHIGNQSDSYMLSCGDDK 138

Query: 200 NVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA 259
            V +W V S                             F  V +D+ + +H +  +  + 
Sbjct: 139 MVKMWSVDSGD---------------------------FNNVKDDTKV-LHPSDGNGLIK 170

Query: 260 TINGTKPFNTLSFSHHSENL-LATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSS 318
           T  G   F  +   HH EN    TGG   E++  +RR   +PL  +S   D +T++ F+ 
Sbjct: 171 TFYGEHAFQGI--DHHKENTSFVTGGAQIELWDINRR---KPLSNLSWGIDNITAVKFNQ 225

Query: 319 QDDGIILSAGADKRVIIWDI 338
            +  ++LS+G+D  V+++D+
Sbjct: 226 NEADLLLSSGSDNSVVLYDL 245

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 64/142 (45%), Gaps = 8/142 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWD+  +R +P+    W     D +   +++  +  L  +   D+S+ ++D R + 
Sbjct: 195 AQIELWDI--NRRKPLSNLSWG---IDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNS 249

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N++ ++        T   +   Y YD R +   LH+   H  A+  +D 
Sbjct: 250 PTQKIVQTMKTNSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDI 309

Query: 317 SSQDDGIILSAGADKRVIIWDI 338
           S   + I+ +   DK + I++I
Sbjct: 310 SPTGEEIV-TGSYDKTIRIFNI 330

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 75/170 (44%), Gaps = 16/170 (9%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           +NP+    L+S S D+   +WD+ S      Q     H   V D ++      LF +   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIA--HDSEVFDVRFLTQSTQLFASCGG 313

Query: 244 DSSLQIHDTR-------------ESKPVATINGTKPFNTLSFSHHSENLLATGGVNS-EV 289
           D S+++ D R             +  P ++   +     L  S H  N++AT   +S ++
Sbjct: 314 DGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKI 373

Query: 290 YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
            + D R  E P+  + GH+ ++  + +   +  I+LS   D +V+ WD+N
Sbjct: 374 IILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDLN 423

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 64/147 (43%), Gaps = 27/147 (18%)

Query: 88  EEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRS----NIRV--TRKFKHDS--------- 132
           E  NY+K  ++   +EV D   LT+S +         ++RV   R   H +         
Sbjct: 279 ESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQM 338

Query: 133 ----------EVTRARYMPQDPNILATISG-TGTVYIYDRSNERDTASITLQYHTDNGYG 181
                      + R    P DPNI+AT +  +  + I D  N  +T  +TLQ H+ +   
Sbjct: 339 DPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNP-ETPVLTLQGHSSSLNQ 397

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTS 208
           + ++P  +  LLS +DD  V  WD+ S
Sbjct: 398 IKWHPTERNILLSCADDCQVLYWDLNS 424

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 103/233 (44%), Gaps = 24/233 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGLDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+ G   +    F HH    + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           +  ++GH   V    F   +D +++SA  D+ V +WDI                + I A+
Sbjct: 130 IACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHSAPGTTSMEDQIAAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSH 397
             L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S 
Sbjct: 189 NNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSQ 240

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 170 ITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229
             L+ HT      +F+P +   ++SGSDD  V LW ++  +   V      H++ V DC 
Sbjct: 203 FILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSQTKAWEVDTCRG-HTNNV-DCV 259

Query: 230 WHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
             +  ++L  +V ED +L+I D  +  PV
Sbjct: 260 IFHPHQNLIISVGEDKTLRIWDLDKRVPV 288

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 104/232 (44%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGLDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+ G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN----------------DIGAE 344
           +  ++GH   V    F   DD +I+SA  D+ + IWDI+                 + A+
Sbjct: 130 IACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQMNAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P +V SA ++  V+LW+ S
Sbjct: 189 QNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIV-SASDDRQVKLWRMS 239

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 96/218 (44%), Gaps = 29/218 (13%)

Query: 192 LLSGSDDSNVALWDVTSDRNE---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           LLS S D  +  W +T D  +   PV+ ++  H+ IV DC       +   + S D +L+
Sbjct: 33  LLSASRDKTLISWKLTGDDKQYGVPVRSFQG-HNHIVQDCS-LTADGAYALSASWDKTLR 90

Query: 249 IHDTRESKPVATINGTKPFNTLSFS-HHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
           + D    +      G K  + +S +     +++ +G  +  V ++  R   + L  M GH
Sbjct: 91  LWDVATGQTYQRFVGHKS-DVMSVAIDRKASMIISGSRDRTVKVWTIR--GQCLATMLGH 147

Query: 308 TDAVTSLDFSSQDDG-----IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHA 362
            D V+ +  +  +D       ++SAG DK V  W++N     Q+  D             
Sbjct: 148 NDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQF---QIEAD-----------FI 193

Query: 363 GHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLP 400
           GH + +N    +P    LVASA ++  + LW  + K+P
Sbjct: 194 GHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADKVP 230

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 105/232 (45%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGLDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T++G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN----------------DIGAE 344
           +  ++GH   V    F   DD +I+SA  D+ + IWDI+                 + A+
Sbjct: 130 IACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPSNNSFEEQLNAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P +V SA ++  V+LW+ S
Sbjct: 189 QNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIV-SASDDRQVKLWRMS 239

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 97/217 (44%), Gaps = 30/217 (13%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           AF P     +++G+ D+   +WD   D   P+   E  HS+ V    W +    +  T S
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDC--DTQTPLATLEG-HSNWVLCVSW-SPDGEVIATGS 201

Query: 243 EDSSLQIHDTRESKPVATINGT--------KPFNTLSFS------HHSENLLATGGVNSE 288
            DS++++ ++ + KPV   NG+        K   +LS+         ++  LA+   +  
Sbjct: 202 MDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGT 261

Query: 289 VYLYD--RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346
           + ++D  RR     L+ +SGH+++V  + +  +  G++ S   DK V +WD+N     + 
Sbjct: 262 IKIWDTARRVC---LYTLSGHSNSVACVKWGGE--GLLYSGSHDKTVRVWDMNSATVGKC 316

Query: 347 LEDAEDATSEVMMI-----HAGHRSPINDFAINPSIP 378
           +   ++    V  +     +A    P +   + PS P
Sbjct: 317 ISILKNHAHWVNHLSLSTDYALRIGPFDHTGVKPSTP 353

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 23/201 (11%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA+ S  GT+ I+D +  R     TL  H+++   + +    +G L SGS D  V +WD+
Sbjct: 253 LASASKDGTIKIWDTA--RRVCLYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVWDM 308

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH-----DTRESKPV-AT 260
            S     V K  +I   + N   W N       ++S D +L+I        + S P  A 
Sbjct: 309 NS---ATVGKCISI---LKNHAHWVNHL-----SLSTDYALRIGPFDHTGVKPSTPAEAK 357

Query: 261 INGTKPFNTLSFSHHS-ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ 319
                 ++ ++  + S E L+ T   +  ++L++ + + +PL  M+GH   V  + F S 
Sbjct: 358 RRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAF-SP 416

Query: 320 DDGIILSAGADKRVIIWDIND 340
           D   I+SA  D  + +WD  D
Sbjct: 417 DGRYIVSASFDNSIKLWDGRD 437

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 110/259 (42%), Gaps = 34/259 (13%)

Query: 110 LTESDEEQVRSNIRVTRKFK-----HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNE 164
           L  +D E+  ++++V  KF      H++++             A  +G+  +Y  + +N 
Sbjct: 47  LLAADSEKPIASLQVDSKFNDLDWSHNNKIIAG----------ALDNGSLELYSTNEANN 96

Query: 165 RDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV-----TSDRNEPVQKWEN 219
              +      H+ +   + FN      L SG ++  + +WD+     +     P+   ++
Sbjct: 97  AINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQS 156

Query: 220 IHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLS-----FS 273
           + S D V    W+     +F +    +   I D +  K V  ++ T P + +        
Sbjct: 157 MSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVE 216

Query: 274 HHSEN----LLATGGVN-SEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSA 327
            H +N      ATG  N   + ++D R    PL  L  GH   + SLD+  QD+ ++LS+
Sbjct: 217 WHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSS 276

Query: 328 GADKRVIIWDINDIGAEQV 346
           G D  V++W  N   AEQ+
Sbjct: 277 GRDNTVLLW--NPESAEQL 293

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 95/208 (45%), Gaps = 26/208 (12%)

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ--WHNFQKSL 237
           + L   P  K  LL+G  +  + L D ++ ++  VQK +   + I ND +    +F    
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKS--VQKIKASETAI-NDMKVIGSDFSAGH 73

Query: 238 FGTVSEDSSLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNSEVYL 291
             + +   ++++ D R +  +A I      PF +L   H    LLA G    G+++ VY+
Sbjct: 74  LVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRH---GLLACGTELQGIDAAVYI 130

Query: 292 YDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDA 350
           YD R  + PL  L+  H D VT + F   D  I+LS   D    I+D+         ++ 
Sbjct: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------DEE 183

Query: 351 EDATSEVM---MIH-AGHRSPINDFAIN 374
           EDA  +V+    IH  G  SP   F ++
Sbjct: 184 EDALHQVINYASIHSCGWLSPKRIFTLS 211

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 81/203 (39%), Gaps = 26/203 (12%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE- 212
             VYIYD           +  H D+   + F+P     LLSGS D    ++D+  D  E 
Sbjct: 126 AAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185

Query: 213 ---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH-------DTRESKPVATIN 262
               V  + +IHS     C W +  K +F T+S   +  IH       + +E +P+   +
Sbjct: 186 ALHQVINYASIHS-----CGWLS-PKRIF-TLSHMETFAIHELNDKSDELKEPQPLDFGD 238

Query: 263 GTKPFNTLSFSHHSENLLATGGVN---SEVYLY----DRRYVEEPLHLMSGHTDAVTSLD 315
             + +N          L+ATG       E+ L     ++   E  + +   H D V    
Sbjct: 239 VREIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDI 298

Query: 316 F-SSQDDGIILSAGADKRVIIWD 337
           F  +Q   ++ S G D  V IW+
Sbjct: 299 FIPAQHSNMLYSCGEDGCVKIWE 321

>SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|Q04305 Saccharomyces cerevisiae
           YMR093W UTP15 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 515

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 98/223 (43%), Gaps = 16/223 (7%)

Query: 123 RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           +V + F    +V  +     D  +L     TG V +YD  N   T  ++++  +   +  
Sbjct: 72  QVIKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPH-TLLLSIKASSHPTHVS 130

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
            F+P+    L+S SDD  V LWD+ S   +PV +       + + C   N Q  L  T S
Sbjct: 131 KFHPMENKTLISASDDRTVRLWDI-SHAYDPVLELSGASDYVRSVCFVPNAQH-LVVTGS 188

Query: 243 EDSSLQIHDTR--ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVY-LYDRRYVEE 299
            D +++I+DTR   S+PV T++   P   +  S     L++ G  N +V+ L   R + E
Sbjct: 189 YDGNVRIYDTRTDSSQPVVTLDHDLPVEDI-ISISPTQLVSCGSSNFKVWDLTSNRLLCE 247

Query: 300 PLHLMSGHTDAVTSLDFSSQDD-----GIILSAGADKRVIIWD 337
                      VT LD+   +        +L++  D  V ++D
Sbjct: 248 ----RGNFAKTVTCLDYVDMNSESPMRNCLLASSLDGHVKLFD 286

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 75/171 (43%), Gaps = 38/171 (22%)

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENI----HSDIVND 227
            + H D    L+F+      L+SGS D  +  WD+T+ +   +Q+ + I    HSDI   
Sbjct: 420 FELHKDEITALSFDS---EALVSGSRDKKIFHWDLTTGK--CIQQLDLIFTPTHSDIKMP 474

Query: 228 CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNS 287
            +  N    L GT                    I   + +N+          LATG  + 
Sbjct: 475 ARSLNNGACLLGT----------------EAPMIGALQCYNSA---------LATGTKDG 509

Query: 288 EVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
            V L+D R V +P+ L+ GHTD +TSL F S+    +++   D  V IWD+
Sbjct: 510 IVRLWDLR-VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 556

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 201 VALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + LWD  S+R+ P+    W    +D V + +++  +  +  +   D+S+ ++D R + P 
Sbjct: 194 IELWD--SNRSNPISNLSWG---ADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPT 248

Query: 259 ATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSS 318
             I  T   N+L ++        T   +   Y YD RY+   L++   H  AV  +DFS 
Sbjct: 249 QKIVQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSP 308

Query: 319 QDDGIILSAGADKRVIIWDI 338
               I+ +   DK + I++I
Sbjct: 309 TGQEIV-TGSYDKTIRIYNI 327

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 103/236 (43%), Gaps = 28/236 (11%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  LF +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HDGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+ G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLETNKCLYTLEGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND-------------------- 340
           +  ++GH   V    F   +D +I+SA  D+ V +WDI+                     
Sbjct: 130 IACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHSAPGGANIPSTFEEK 188

Query: 341 IGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           I A+Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LWK S
Sbjct: 189 IAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 80/188 (42%), Gaps = 21/188 (11%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-P 213
           T+ I++  N ++ A IT   H        F+P  +  ++S S D  V +WD++  R +  
Sbjct: 118 TIRIWNWQNRKEIACIT--GHNHFVMCAQFHP-TEDLIVSASLDETVRVWDISKLREKHS 174

Query: 214 VQKWENIHSDIVND-CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSF 272
                NI S          N     FG  +    L+ H             T+  N  SF
Sbjct: 175 APGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGH-------------TRGVNWASF 221

Query: 273 SHHSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGADK 331
            H +  L+ +GG + +V L+     +   L    GHT+ V S+ F    + +I+S G DK
Sbjct: 222 -HPTLPLIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQN-LIISVGEDK 279

Query: 332 RVIIWDIN 339
            + IWD++
Sbjct: 280 TLRIWDLD 287

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 13/203 (6%)

Query: 151 SGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210
           S  G + +Y+  +E  +  +  Q H D+   LA++P     +++ SDD  + +WD+TS  
Sbjct: 317 SKLGQLLVYEWQSE--SYILKQQGHFDSTNCLAYSP-DGSRVVTASDDGKIKVWDITS-- 371

Query: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFN 268
              +  +E  H+  V   Q+    + +F + S D +++  D    +   T  GT+   FN
Sbjct: 372 GFCLATFEE-HTSSVTAVQFAKRGQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFN 429

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            L+     E + A    N +++++  +   + L  +SGH   V+ L F SQ++ ++ SA 
Sbjct: 430 CLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSF-SQENSVLASAS 487

Query: 329 ADKRVIIWDINDIGAEQVLEDAE 351
            DK + IW I   G  Q +E  E
Sbjct: 488 WDKTIRIWSI--FGRSQQVEPLE 508

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 93/248 (37%), Gaps = 28/248 (11%)

Query: 142 QDPNILATISGTGTVYIYD-RSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           QD   + T S   +  I+   S+E+D A+ T   H D   G AF    +  + + S D  
Sbjct: 156 QDSRFVLTTSKDLSTKIWSVNSDEKDLAATTFNGHRDYVMG-AFFSHDQEKIYTVSKDGA 214

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLF-GTVSEDSSLQIHDTRESKPVA 259
           V +W+ T    +   + E    DI +   W   +K  F    S+   +  H       V 
Sbjct: 215 VFVWEFTRRPTDDDNEEEEEEVDI-SKYSWRITKKHFFYANQSKVKCVTFHPATRLLAVG 273

Query: 260 TIN-------------------GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +                   G  P NT+S +   E L        ++ +Y+ +  E  
Sbjct: 274 FTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNSTGEWLAFGSSKLGQLLVYEWQ-SESY 332

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           +    GH D+   L +S  D   +++A  D ++ +WDI    +   L   E+ TS V  +
Sbjct: 333 ILKQQGHFDSTNCLAYSP-DGSRVVTASDDGKIKVWDIT---SGFCLATFEEHTSSVTAV 388

Query: 361 HAGHRSPI 368
               R  +
Sbjct: 389 QFAKRGQV 396

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 104/230 (45%), Gaps = 24/230 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRSVDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+NG   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  GGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           +  ++GH   V    F   DD +++SA  D+ + +WDI                + + A+
Sbjct: 130 IACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
           Q L D       V  I  GH   +N  + +P++P +V+ +++   V+LWK
Sbjct: 189 QNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQ-VKLWK 237

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 72/181 (39%), Gaps = 30/181 (16%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNER-----------DTASITLQYHTDN 178
           H+  V  A++ P D +++ + S   T+ ++D S  R           D      Q   D 
Sbjct: 136 HNHFVMCAQFHPTD-DLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SGSDD  V LW   S +   V      H+
Sbjct: 195 GFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLAT 282
           + V+   +H  QK +  +V ED +L+I D  +  PV           L  SH + NL   
Sbjct: 254 NNVDCVIFHPTQKFIL-SVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGA 312

Query: 283 G 283
            
Sbjct: 313 A 313

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 13/203 (6%)

Query: 151 SGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210
           S  G + +Y+  +E  +  +  Q H D+   LA++P     +++ SDD  + +WD+TS  
Sbjct: 320 SKLGQLLVYEWQSE--SYILKQQGHFDSTNSLAYSP-DGSRVVTASDDGKIKVWDITS-- 374

Query: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFN 268
              +  +E  H+  V   Q+    + +F + S D +++  D    +   T  GT+   FN
Sbjct: 375 GFCLATFEE-HTSSVTAVQFAKRGQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFN 432

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            L+     E + A    N +++++  +   + L  +SGH   V+ L F SQ++ ++ SA 
Sbjct: 433 CLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSF-SQENSVLASAS 490

Query: 329 ADKRVIIWDINDIGAEQVLEDAE 351
            DK + IW I   G  Q +E  E
Sbjct: 491 WDKTIRIWSI--FGRSQQVEPLE 511

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 75/172 (43%), Gaps = 13/172 (7%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    LA N   +  L S S D  V LWD+ +      +   NIHS+  V+  QWH 
Sbjct: 286 HHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNT--ATAARSLINIHSNTNVSASQWHP 343

Query: 233 FQKSLFGTVSEDSSLQIHDTR-----ESKPVATINGTKPFNTLSFSHHSENLLATGGVNS 287
              S+  T   DS   + D R     +      ++  +    + F+   EN+   G  N 
Sbjct: 344 SNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFA--DENIFICGTDNG 401

Query: 288 EVYLYDRRYVEE--PLHLMSGHTDAVTSLDFSSQDDGIIL-SAGADKRVIIW 336
            VY +D R   E  P+  +  H   V+S++ +     ++L SA  +K V +W
Sbjct: 402 NVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDAT------- 354
           H+ + HTDA+ SL  + Q   ++ S  AD  V +WD+N   A + L +    T       
Sbjct: 282 HVTTHHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSLINIHSNTNVSASQW 341

Query: 355 ---SEVMMIHAGH--RSPINDFAI----NPSIPWLVASAEEENIVQL 392
              +  +++ AG+  R+ ++D  I    + S  W V+S EE   V+ 
Sbjct: 342 HPSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRF 388

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (46%), Gaps = 15/173 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    LA N   +  L S S D  V LWD+ S      +   +IHS+  V+  +WH 
Sbjct: 284 HHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNS--GTAARSIASIHSNKNVSASEWHM 341

Query: 233 FQKSLFGTVSEDSSLQIHDTRES-----KPVATINGTKPFNTLSFSHHSENLLATGGVNS 287
              S+  T   DS L + D R S         ++ G +     +F+  SENL+  G  + 
Sbjct: 342 SHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFA--SENLILCGTDSG 399

Query: 288 EVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILSAGA--DKRVIIW 336
            VY +D R  E  +P+  +  H   +++L+ +    G ++S GA  +K V +W
Sbjct: 400 NVYSFDIRNNEGSKPVWTLKAHDAGISTLNCNKFIPG-MMSTGAMGEKAVKLW 451

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           H+ + HTDAV SL  +     ++ S  AD  V +WD+N
Sbjct: 280 HITTHHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLN 317

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 80/173 (46%), Gaps = 15/173 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    LA N   +  L S S D  V LWD+  +     +   NIHS+  V+  QWH 
Sbjct: 288 HHTDAVLSLAHNRQFRTVLASTSADHTVKLWDL--NNATAARSMANIHSNKNVSSSQWHM 345

Query: 233 FQKSLFGTVSEDSSLQIHDTR------ESKPVATINGTKPFNTLSFSHHSENLLATGGVN 286
              S+  T   DS   + D R       SK  + + G +   T +F+  SEN++  G   
Sbjct: 346 QNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEE-IETATFA--SENIILCGTDA 402

Query: 287 SEVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILS-AGADKRVIIW 336
             VY +D R  E  +P+  +  H   ++SL  +    G++ + A  +K+V +W
Sbjct: 403 GNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEKQVKLW 455

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           H+ + HTDAV SL  + Q   ++ S  AD  V +WD+N+  A + +
Sbjct: 284 HVTTHHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSM 329

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 79/181 (43%), Gaps = 17/181 (9%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHS-DIVNDCQWHN 232
           +HTD    LA N   +  L S S D  V LWD+   R    +  + +HS   V+  QWH 
Sbjct: 269 HHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGR--AARSLDAVHSATAVSSSQWHP 326

Query: 233 FQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTL-------SFSHHSENLLATGGV 285
              S+  T   DS + + D R    +A   G   +  +       S +  SE +   G  
Sbjct: 327 SDGSILLTAGYDSRVALSDVR----IANDAGMSKYWKVMKGEEIESATFVSETVFLAGTD 382

Query: 286 NSEVYLYDRRYVEE--PLHLMSGHTDAVTSLDFS-SQDDGIILSAGADKRVIIWDINDIG 342
           +  VY +D R  E+  PL  ++ H   ++SL  S S  + ++ SA  +K + +W     G
Sbjct: 383 SGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEG 442

Query: 343 A 343
           A
Sbjct: 443 A 443

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATS 355
           H+ + HTDAV SL  +     ++ S  AD  V +WD+N   A + L+    AT+
Sbjct: 265 HVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATA 318

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 90/193 (46%), Gaps = 26/193 (13%)

Query: 178 NGYGLAFNPLIK--GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHN--- 232
           N +   F PL K  G LLS S+   +   D  + +++   +  N+    +ND +  N   
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDFGTCQSKQSIRVSNLS---INDLKILNSDF 72

Query: 233 FQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVN 286
              SLF T + +S         + P+AT++  K  PF +L   H    LLA G    GV+
Sbjct: 73  HCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGVD 129

Query: 287 SEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345
           +++ +YD R  + PL  L+  H D VT+L F   D  ++LS   D    ++D+       
Sbjct: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----- 184

Query: 346 VLEDAEDATSEVM 358
             +D +DA  +VM
Sbjct: 185 --QDEDDALHQVM 195

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 104/232 (44%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRGLDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+ G   +    F H     + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI----------------GAE 344
           +  ++GH   V    F   DD +I+SA  D+ + IWDI+ +                 A+
Sbjct: 130 IACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P +V+ +++   V+LW+ S
Sbjct: 189 QNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQ-VKLWRMS 239

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVN 226
                L+ HT      +F+P +   ++SGSDD  V LW +++ +   V      H++ V+
Sbjct: 200 VVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSATKAWEVDTCRG-HTNNVD 257

Query: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
              +H  Q +L  +V ED +L++ D  +  PV
Sbjct: 258 SVIFHPHQ-NLIISVGEDKTLRVWDLDKRTPV 288

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 103/218 (47%), Gaps = 15/218 (6%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
           + F+P  K  L +G++D  + +WD+T+ R   V   +    DI +   + +  K + G  
Sbjct: 454 VCFSPDGK-FLATGAEDKLIRIWDLTTRR--IVMTLQGHEQDIYSLDYFPSGDKLVSG-- 508

Query: 242 SEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRR--YVEE 299
           S D +++I D R  +   T++      T++ S     L+A G ++  V ++D    ++ E
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 300 PL----HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATS 355
            L     L +GH D+V S+ F+    G++ S   D+ V +W++           A  A S
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLRSANGGSTEGKANTAAS 627

Query: 356 EVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
           EV   + GH+  +   A   +  ++++ +++  ++  W
Sbjct: 628 EV--TYTGHKDFVLSVATTQNDEFILSGSKDRGVL-FW 662

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 110/288 (38%), Gaps = 49/288 (17%)

Query: 136 RARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSG 195
           R+     D   LAT +    + I+D +  R    +TLQ H  + Y L + P     L+SG
Sbjct: 452 RSVCFSPDGKFLATGAEDKLIRIWDLTTRRIV--MTLQGHEQDIYSLDYFP-SGDKLVSG 508

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES 255
           S D  V +WD+ + +       E    D V           L    S D +++I D+   
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSIE----DGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 564

Query: 256 KPVATINGTKPFNT--------LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLH----- 302
             V  ++      T        + F+     ++ +G ++  V L++ R            
Sbjct: 565 FLVERLDSENELGTGHKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLRSANGGSTEGKAN 623

Query: 303 ------LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSE 356
                   +GH D V S+  ++Q+D  ILS   D+ V+ WD                +  
Sbjct: 624 TAASEVTYTGHKDFVLSV-ATTQNDEFILSGSKDRGVLFWDT--------------PSGN 668

Query: 357 VMMIHAGHRSPI------NDFAINPSIPWLVASAEEENIVQLWKCSHK 398
            +++  GHR+ +      ND  + P    + A+   +   ++WK + K
Sbjct: 669 PLLMLQGHRNSVISVAVANDHPLGPEY-GVFATGSGDCKARIWKYTKK 715

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 24/177 (13%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           +NP+    L+S S D+   +WD+ S      Q     H   V D ++      LF +   
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIA--HDSEVFDVRFLTQSTQLFASCGG 300

Query: 244 DSSLQIHDTR------------ESKPVATINGTKPFNTLSFSH---------HSENLLAT 282
           D S+++ D R             S+P    N ++  +T   SH         H  N+LAT
Sbjct: 301 DGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLAT 360

Query: 283 GGVNS-EVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
             + S E+ + D R  + PL +++GH+ ++  + +       ++S   D +V+ WDI
Sbjct: 361 FAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 141 PQDPNILATIS-GTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDS 199
           P DPN+LAT +  +  + I D  N  D+  + L  H+ +   + ++P  K  L+S SDD 
Sbjct: 352 PHDPNVLATFAIASNEILILDMRNP-DSPLVVLNGHSASINQIKWHPTKKNTLISCSDDC 410

Query: 200 NVALWDVTS 208
            V  WD++S
Sbjct: 411 QVLFWDISS 419

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 120 SNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYD 160
           SN   T+   HDSEV   R++ Q   + A+  G G+V ++D
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD 308

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 5/160 (3%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
           + F+P  K  LL G  DS +  +D+  D+ + V +  + H   +N  ++     S F + 
Sbjct: 265 MTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFP-DGSKFISS 323

Query: 242 SEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSE-NLLATGGVNSEVYLYDRR--YVE 298
           S+D S++I + + + P+  I+ T  +       H E N  A   +++ +Y+Y  +  Y  
Sbjct: 324 SDDKSIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKR 383

Query: 299 EPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWD 337
            P     GH  A  +  F    DG  ++AG    R+ IWD
Sbjct: 384 HPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWD 423

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 67/151 (44%), Gaps = 7/151 (4%)

Query: 190 GHL-LSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           GHL LSG +D  + +WD+  +R        +  +         N Q   F + S D +++
Sbjct: 187 GHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQ---FASSSYDKTVK 243

Query: 249 IHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP--LHLMSG 306
           I DT     +  ++     N ++F   ++  L  G  +S++  +D R  ++   + +   
Sbjct: 244 IWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDH 303

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           H  A+ +L +   D    +S+  DK + IW+
Sbjct: 304 HLAAINALRYFP-DGSKFISSSDDKSIRIWE 333

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           LH+  GH    T+L+F  +   + LS G D  + IWD+
Sbjct: 167 LHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDM 204

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            L F   + +L  +GG +  + ++D  +    L    GH  A+++  F S D+    S+ 
Sbjct: 179 ALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSF-SHDNVQFASSS 237

Query: 329 ADKRVIIWD 337
            DK V IWD
Sbjct: 238 YDKTVKIWD 246

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 99/253 (39%), Gaps = 60/253 (23%)

Query: 142 QDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK----GHLLSGSD 197
           ++ N LAT S  G V  ++ S   +  S    Y    G  +    L K      +LS SD
Sbjct: 78  KNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLSKQKNENFMLSCSD 137

Query: 198 DSNVALWDVTSDRNEPVQKWENI----------HSDIVNDCQWHNFQKSLFGTVSEDSSL 247
           D  V LW V S+    ++  E+I          +SD       H+  KS F  V+  + +
Sbjct: 138 DKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRSKSNF--VTGGAKI 195

Query: 248 QIHDTRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEV----------------- 289
           Q+ D+  SKP+  ++ G    +T+ F+ +  ++LA+ G ++ +                 
Sbjct: 196 QLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQT 255

Query: 290 -------------------------YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGII 324
                                    Y YD R +   L++   H  AV  +DFS   D I+
Sbjct: 256 MRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV 315

Query: 325 LSAGADKRVIIWD 337
            +   DK + I++
Sbjct: 316 -TGSYDKTIRIFN 327

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 98/203 (48%), Gaps = 13/203 (6%)

Query: 151 SGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210
           S  G + +Y+  +E  +  +  Q H D+   LA++P     +++ S+D  + +WD+TS  
Sbjct: 322 SKLGQLLVYEWQSE--SYILKQQGHFDSTNSLAYSP-DGSRVVTASEDGKIKVWDITS-- 376

Query: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFN 268
              +  +E  H+  V   Q+    + +F + S D +++  D    +   T  GT+   FN
Sbjct: 377 GFCLATFEE-HTSSVTAVQFAKRGQVMFSS-SLDGTVRAWDLIRYRNFRTFTGTERIQFN 434

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            L+     E + A    N +++++  +   + L  +SGH   V+ L FS Q++ ++ SA 
Sbjct: 435 CLAVDPSGEVVCAGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSFS-QENSVLASAS 492

Query: 329 ADKRVIIWDINDIGAEQVLEDAE 351
            DK + IW I   G  Q +E  E
Sbjct: 493 WDKTIRIWSI--FGRSQQVEPIE 513

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 81/172 (47%), Gaps = 13/172 (7%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    L+ N   +  L S S D  V LWD+  +     +   +IH++  V+  QWH+
Sbjct: 277 HHTDAVLSLSHNRHFRAVLASTSADHTVKLWDL--NNGIAARSIASIHNNKNVSSSQWHS 334

Query: 233 FQKSLFGTVSEDSSLQIHDTRESKPVA-----TINGTKPFNTLSFSHHSENLLATGGVNS 287
              S+  T   DS + + D R +   A     ++   +   ++ F+  SEN++  G  + 
Sbjct: 335 TDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDSG 392

Query: 288 EVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIIL-SAGADKRVIIW 336
            VY +D R  E  +PL  +  H   ++SLD +     ++  SA  +K V +W
Sbjct: 393 NVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 86/184 (46%), Gaps = 24/184 (13%)

Query: 221 HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE---SKPVATINGTKPFNTLSFSHHSE 277
           H+D V     +   +++  + S D ++++ D      ++ +A+I+  K  ++  +     
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIASIHNNKNVSSSQWHSTDG 337

Query: 278 NLLATGGVNSEVYLYDRRYVEEPL-----HLMSGHTDAVTSLDFSSQDDGIILSAGADKR 332
           ++L TGG +S V + D R  ++        +M+G  + + S+ F+S++  +I+       
Sbjct: 338 SILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAG--EEIESVRFASEN--VIMCGTDSGN 393

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVA-SAEEENIVQ 391
           V  +DI +              S+ +     H + I+   +N  +P ++A SA  E +V+
Sbjct: 394 VYSFDIRN-----------GEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVK 442

Query: 392 LWKC 395
           LWKC
Sbjct: 443 LWKC 446

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
           H+ + HTDAV SL  +     ++ S  AD  V +WD+N+
Sbjct: 273 HVTTHHTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNN 311

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 22/188 (11%)

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNFQKSL 237
           + L   P  K  LL+G  +  + L D  S   + +QK +   + I ND +    +F    
Sbjct: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNS--GQSLQKIKASETSI-NDLKVIDSDFAAGH 73

Query: 238 FGTVSEDSSLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNSEVYL 291
             + +   ++++ D R +  VA I+     PF +L   H    LLA G    G+++ VY+
Sbjct: 74  LVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVYI 130

Query: 292 YDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDA 350
           YD R  + PL  ++  H D VT + F   D  ++LS   D    I+D+         ++ 
Sbjct: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DEE 183

Query: 351 EDATSEVM 358
           EDA  +V+
Sbjct: 184 EDALHQVI 191

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 92/231 (39%), Gaps = 27/231 (11%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE- 212
             VYIYD           +  H D+   + F+P     LLSGS D    ++D+  D  E 
Sbjct: 126 AAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEED 185

Query: 213 ---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDT-------RESKPVATIN 262
               V  + +IHS     C W + QK ++ T+S   +  IH+        +E +P    +
Sbjct: 186 ALHQVINYASIHS-----CGWLS-QKRIY-TLSHMETFAIHELNDKSDEFKEPRPADFGD 238

Query: 263 GTKPFNTLSFSHHSENLLATGGVN---SEVYLYDRR----YVEEPLHLMSGHTDAVTSLD 315
             + +N          L+ATG       E+ L   R      E  + +   H D V    
Sbjct: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298

Query: 316 F-SSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHR 365
           F S+    ++ S G D  V IW  N++G     E   D + ++ ++   H+
Sbjct: 299 FISALQSDLLYSCGEDGFVKIWK-NNLGPLNTPESFWDYSEKLNVLDEDHK 348

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 81/207 (39%), Gaps = 17/207 (8%)

Query: 146 ILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD 205
           I+A     G V  +     R  A   L  HT     + FN      L SG     + +WD
Sbjct: 76  IIAGALENGVVEFFAPEEPRSVAK--LAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWD 133

Query: 206 V----TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI 261
                T      V        D +    W+  Q  +F +        I D +  K V  +
Sbjct: 134 ANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDLKAKKEVIHL 193

Query: 262 NGTKPF----NTLSF----SHHSENLLATGGVNSE--VYLYDRRYVEEPLHLMS-GHTDA 310
           +   P     N LS      ++S  +    G +S+  + ++D R    P+ ++S  HT  
Sbjct: 194 SYASPVTGQRNQLSIVEWHPNNSTRIATASGNDSDPSILIWDLRNANVPMQVLSQPHTKG 253

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIWD 337
           V SLD+  QD+ ++LS+G D   ++W+
Sbjct: 254 VLSLDWCKQDETLLLSSGRDNVCVLWN 280

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 32/198 (16%)

Query: 185 NPLIKGHLLSG------SDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHNFQKSL 237
           +PL+     SG      S +S + +W + S      Q   +I +D   ND  W +    +
Sbjct: 20  SPLLATGTASGTIDADFSSESTLEIWSLLSPHEATPQ--ASITADAKFNDLDWSHDNAII 77

Query: 238 FGTVSEDSSLQIHDTRESKPVATI-NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRY 296
            G + E+  ++     E + VA +   T P  T++F+    N+L +GG   E+Y++D   
Sbjct: 78  AGAL-ENGVVEFFAPEEPRSVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANK 136

Query: 297 VEEPLH--LMSGHT----DAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDA 350
           +E P +   + G      D + SL ++     +  SAG+     IWD+            
Sbjct: 137 IETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDLK----------- 185

Query: 351 EDATSEVMMIHAGHRSPI 368
             A  EV  IH  + SP+
Sbjct: 186 --AKKEV--IHLSYASPV 199

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 86/190 (45%), Gaps = 26/190 (13%)

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSD--IVNDCQWHNFQKSL 237
           + L   P  K  LL+G  +  + L D  +      +  +NI +    +ND +  +   S 
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWAT-----CKSLQNIKASETAINDLKVIDSDFSA 71

Query: 238 FGTVSEDS--SLQIHDTRESKPVATIN--GTKPFNTLSFSHHSENLLATG----GVNSEV 289
              VS  S  ++++ D R +  +ATI      PF +L   H    LLA G    G+++ V
Sbjct: 72  GHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAV 128

Query: 290 YLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348
           ++YD R  + PL  L+  H D VT + F   D  I+LS   D    I+D+         +
Sbjct: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------D 181

Query: 349 DAEDATSEVM 358
           + EDA  +V+
Sbjct: 182 EEEDALHQVI 191

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 78/202 (38%), Gaps = 26/202 (12%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE- 212
             V+IYD           +  H D+   + F+P     LLSGS D    ++D+  D  E 
Sbjct: 126 AAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEED 185

Query: 213 ---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH-------DTRESKPVATIN 262
               V  + +IHS     C W + ++    T+S   +  IH       + RE +P+   +
Sbjct: 186 ALHQVINYASIHS-----CGWLSPKR--IYTLSHMETFAIHELNDKSDELREPQPLDFGD 238

Query: 263 GTKPFNTLSFSHHSENLLATGGVNSEV-------YLYDRRYVEEPLHLMSGHTDAVTSLD 315
             K ++          L+ATG             +  ++ Y E+   +   H D V    
Sbjct: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298

Query: 316 F-SSQDDGIILSAGADKRVIIW 336
           F S+    ++ S G D  V IW
Sbjct: 299 FISAHQSDMLYSCGEDGYVKIW 320

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 102/232 (43%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +   L     S + LWD        + ++E  H   V    +H  Q  +F +
Sbjct: 16  GIAFHP-SRPWALVALFSSTIQLWDYR--MGTLLHRFEG-HEGPVRAVDFHPTQ-PIFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D+S+++     ++ + T+ G   +    F H     + +   +  V +++ +  +E 
Sbjct: 71  AGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI----------------NDIGAE 344
           L  ++GH   V    F   +D +++SA  D+ V +WDI                + + ++
Sbjct: 130 LACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D      +V  I  GH   +N  + +P++P +V   ++   V+LW+ S
Sbjct: 189 QNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQ-VKLWRMS 239

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 77/191 (40%), Gaps = 31/191 (16%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGH-----LLSGSDDSNVALWDVTSD 209
           TV I++  N ++ A +T   H        F    + H     ++S S D  V +WD++  
Sbjct: 118 TVRIWNWQNRKELACLTGHNH--------FVMCAQFHQTEDLVVSASLDETVRVWDISGL 169

Query: 210 RNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNT 269
           R +        + D +   Q  N     FG       L+ H             T+  N 
Sbjct: 170 RKKHSAPGVTSYEDSLASQQ--NLLDGAFGDCKVKFILEGH-------------TRGVNW 214

Query: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            SF H +  L+ TGG + +V L+     +   +    GHT+ V  + F   D  +ILS  
Sbjct: 215 ASF-HPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHP-DQNLILSVA 272

Query: 329 ADKRVIIWDIN 339
            DK + IWD++
Sbjct: 273 EDKTLRIWDLD 283

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 3/89 (3%)

Query: 170 ITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229
             L+ HT      +F+P +   +++G DD  V LW ++S++   V      H++ V DC 
Sbjct: 203 FILEGHTRGVNWASFHPTLP-LIVTGGDDRQVKLWRMSSNKAWEVDTCRG-HTNNV-DCV 259

Query: 230 WHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
             +  ++L  +V+ED +L+I D  +  PV
Sbjct: 260 VFHPDQNLILSVAEDKTLRIWDLDKRTPV 288

>KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1212

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 104/232 (44%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +  +L     S + LWD        + ++E+ H   V    +H  Q  LF +
Sbjct: 16  GIAFHP-SRPWVLVALFSSTIQLWDYR--MGVLLHRFED-HEGPVRGIDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T++G   +    F HH    + +   +  + +++ +  +E 
Sbjct: 71  AGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGA----------------E 344
           +  ++GH   V    F   +D +++SA  D+ V +WDI+ +                  +
Sbjct: 130 IACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 80/190 (42%), Gaps = 29/190 (15%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE-- 212
           T+ I++  N ++ A +T   H        F+P ++  ++S S D  V +WD++  R    
Sbjct: 118 TIRIWNWQNRKEIACLT--GHNHFVMCAQFHP-VEDLVVSASLDETVRVWDISGLRKRHS 174

Query: 213 --PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTL 270
               Q +E          Q  N     FG       L+ H             T+  N  
Sbjct: 175 APGTQSFEEQMR------QQQNLLDGGFGDCVVKFILEGH-------------TRGVNWA 215

Query: 271 SFSHHSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329
           SF H +  L+ +G  + +V L+     +   +    GHT+ V S+ F  Q + +I+S G 
Sbjct: 216 SF-HPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQN-LIISVGE 273

Query: 330 DKRVIIWDIN 339
           DK V +WD++
Sbjct: 274 DKTVRVWDLD 283

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 98/238 (41%), Gaps = 28/238 (11%)

Query: 150 ISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSD 209
           +SG G + I + +  R           D  + LA++ +    +L    D  + L+D+T +
Sbjct: 34  LSGQGKLSILNLTGNRQMQESASVITNDCLFDLAWSEINPTQVLVAQGDGTLTLFDLT-N 92

Query: 210 RNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNT 269
           + + +Q ++  +S++ + C W+   +  F + S D  ++I D   S+ V T+   +    
Sbjct: 93  KLQQIQIYKEHYSEVFS-CNWNMLTRRTFISGSWDGKVKIWDCARSESVLTLRNNRSLGH 151

Query: 270 LS----------------------FSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
                                   FS H  N+      NS +  +D R   +   +++  
Sbjct: 152 TGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSILAHS 211

Query: 308 TDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAE--QVLED--AEDATSEVMMIH 361
                S D++     I+ SAG DK + IWD+  I  +   +  D  + + T+EV+  H
Sbjct: 212 GLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKPHNMFADISSYNCTNEVVNAH 269

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 70/177 (39%), Gaps = 22/177 (12%)

Query: 124 VTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA 183
           + R  K+   + +A + P DPN+    SG   +  +D        SI L +         
Sbjct: 161 LQRNSKNKDCIYQALFSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSI-LAHSGLETLSCD 219

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHS-----DIVNDCQ-------WH 231
           +N      + S   D  + +WD+   +N+P   + +I S     ++VN  +       W 
Sbjct: 220 YNKYRSYIVASAGVDKAIRIWDLRMIKNKPHNMFADISSYNCTNEVVNAHELAIRKILWS 279

Query: 232 NFQKSLFGTVSEDSSLQI-----HDTRESKPVATINGTKPFNTL--SFSHHSENLLA 281
               + F T S D + ++     HD   ++ V   N T+P       F+ H+E +L 
Sbjct: 280 PHHSNYFLTTSYDLTCRVWQDLSHDG--TRQVWKTNSTEPGKGCRYKFNKHTEFVLG 334

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 77/161 (47%), Gaps = 3/161 (1%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K H +  + +    +W+++   +  ++   + H   + D  +H     L  T S D+ + 
Sbjct: 81  KPHWVVSTSNQKALVWNLSRTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVH 140

Query: 249 IHDTRE-SKPV-ATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R   +P  +T + +   + + ++  + N+LA+   NS V+++D R    PL+ +SG
Sbjct: 141 AWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHANS-VFIWDIRKGCTPLYKLSG 199

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           +  +V ++DF+   +  I+S+  D  V  WD +    E + 
Sbjct: 200 NNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTEPLF 240

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 134 VTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLL 193
            ++ ++  Q+ N+LA+ S   +V+I+D   +  T    L  +  +   + FN + +  ++
Sbjct: 161 ASQVKWNLQNANVLAS-SHANSVFIWD-IRKGCTPLYKLSGNNSSVNNIDFNKVKENEIM 218

Query: 194 SGSDDSNVALWDVTSDRNEPV 214
           S S+D  V  WD +    EP+
Sbjct: 219 SSSNDGTVKFWDYSKSSTEPL 239

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 81/170 (47%), Gaps = 19/170 (11%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           AF P     +++G+ D+   +WD   D   P        + ++  C  +     +  T S
Sbjct: 150 AFAPNTSSRMVTGAGDNTARIWDC--DTQTPKATLTGHFNWVL--CVSYCPNGEVIATGS 205

Query: 243 EDSSLQIHDTRESKPVA-TING-TKPFNTLSF------SHHSENLLATGGVNSEVYLYD- 293
            D+++++ D+++ KP+   + G  K   +L++             LA+   +  + ++D 
Sbjct: 206 MDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDI 265

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG 342
            RR     L+ MSGHT++V+ + +S Q  GII S   DK V +WD+N  G
Sbjct: 266 TRRVC---LYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDMNADG 310

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 92/215 (42%), Gaps = 25/215 (11%)

Query: 146 ILATISGTGTVYIYDRSNERDTASITLQ------YHTDNGYGLAFNPLIKGHLLSGSDDS 199
           I   +   G + ++  S E +   I+L+       HT     L FNP  +  L S  ++ 
Sbjct: 79  IAGALDDNGKIELF--SKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNG 136

Query: 200 NVALWDV-----TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSL-QIHDTR 253
            + +WD+     ++D +           D +    W+     +F +  + ++   I D +
Sbjct: 137 EILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDLK 196

Query: 254 ESKPVATINGTKPFNTLS-------FSHHSENLLATG-GVNSE--VYLYDRRYVEEPLHL 303
             K V  +N T P   L        +       +AT  G +S+  + ++D R    P+  
Sbjct: 197 AKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPMTT 256

Query: 304 MSG-HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           + G HT  + SLD+ ++D+ ++LS+G D  V +WD
Sbjct: 257 LEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 76/344 (22%), Positives = 132/344 (38%), Gaps = 65/344 (18%)

Query: 110 LTESDEEQVRSNIRVTRKFK-HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTA 168
           L   +E   + +++   KFK H + V   R+ P+  N+LA+    G + I+D +    T 
Sbjct: 91  LFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINK---TL 147

Query: 169 SITLQYHTDNGYGLAFNPLIK--------GHLLSGSDDSN--VALWDVTSDRNEPVQKWE 218
           S T    +  G  ++    IK         H+ + + D+    ++WD+ + +       E
Sbjct: 148 SSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAKK-------E 200

Query: 219 NIHSDIVND----------CQWHNFQKSLFGTVS---EDSSLQIHDTRESK-PVATING- 263
            IH +  +            +WH    +   T S    D  + I D R S  P+ T+ G 
Sbjct: 201 VIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPMTTLEGP 260

Query: 264 -TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG 322
            TK   +L +    E+LL + G +  V L+D +   E        +       F+ ++  
Sbjct: 261 HTKGIMSLDWCTKDESLLLSSGRDGIVALWDTK-ANEVSTTYPTRSQWCFKTKFAPENPD 319

Query: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSE-------------------VMMIHA- 362
           I  SAG D ++ +  + D+   Q  +   D   E                   V  IHA 
Sbjct: 320 IFASAGFDGQINVNTLQDLTNSQDSQTQADTNKESESEFWNHVSTSTPLEKPTVSKIHAP 379

Query: 363 ---GHRSPINDFAINPSIPWLVASAEEENI----VQLWKCSHKL 399
              G+RSP   +A    +  +    +   I    VQ  +C+ KL
Sbjct: 380 NWYGNRSPAAQWAFGGKLVKISKDGKGVEIVKPKVQGMECNLKL 423

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 10/108 (9%)

Query: 242 SEDSSLQI-----HDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRY 296
           S DS+L++        ++  PVA+I     F  L +S  ++ +      N ++ L+ +  
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIELFSKEE 96

Query: 297 VEEPLHLMS-----GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
            +  + L S      HT AV +L F+ +   ++ SAG +  ++IWDIN
Sbjct: 97  NDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDIN 144

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 86/181 (47%), Gaps = 18/181 (9%)

Query: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-V 225
           T  IT  +HTD    +A N   +  L S S D  V LWD+ S      +   +IHS+  V
Sbjct: 278 TGHIT-THHTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNS--GNAARSLASIHSNKNV 334

Query: 226 NDCQWHNFQKSLFGTVSEDSSLQIHDTR------ESKPVATINGTKPFNTLSFSHHSENL 279
           +  +WH    S+  T   DS + + D R       SK  + + G +   T++F+  SEN+
Sbjct: 335 SSSEWHMLNGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAG-EEIETVTFA--SENI 391

Query: 280 LATGGVNSEVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILSAGA--DKRVII 335
           +  G  +  VY +D R  E  +P+  +  H   +++L  +    G ++S GA  +K V +
Sbjct: 392 ILCGTDSGNVYSFDIRNNENRKPVWTLKAHDAGISTLCSNKFIPG-MMSTGAMGEKTVKL 450

Query: 336 W 336
           W
Sbjct: 451 W 451

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 13/207 (6%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALW 204
           ++LA+ S   TV ++D ++     S+   +   N     ++ L    LL+G  DS VAL 
Sbjct: 300 SVLASTSADHTVKLWDLNSGNAARSLASIHSNKNVSSSEWHMLNGSILLTGGYDSRVALT 359

Query: 205 DV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSED-SSLQIHDTRESKPVATIN 262
           DV  SD ++  + W  +  + +    + +    L GT S +  S  I +    KPV T+ 
Sbjct: 360 DVRISDESQMSKYWSAMAGEEIETVTFASENIILCGTDSGNVYSFDIRNNENRKPVWTLK 419

Query: 263 G-TKPFNTLSFSHHSENLLATGGVNSEVY------LYDRRYVEEPLHLMSGHTDAVTSLD 315
                 +TL  +     +++TG +  +        L D    + P  ++S   D    L 
Sbjct: 420 AHDAGISTLCSNKFIPGMMSTGAMGEKTVKLWKFPLDDATNTKGPSMVLSRDFDVGNVLT 479

Query: 316 FSSQDD----GIILSAGADKRVIIWDI 338
            S   D    G ++  G +K + +WD+
Sbjct: 480 SSFAPDIEVAGTMVIGGVNKVLKLWDV 506

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           H+ + HTDAV S+  +     ++ S  AD  V +WD+N   A + L
Sbjct: 280 HITTHHTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSGNAARSL 325

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 72/151 (47%), Gaps = 10/151 (6%)

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           HL  G     V ++DV   +N+ ++     H D V    W+N    +  + S D  +   
Sbjct: 332 HLAVGLSSGIVEIYDVL--KNKCIRTLSG-HVDRVACLSWNNH---VLSSGSRDRKILHR 385

Query: 251 DTRESKPVATINGTKPFNTLSFSHH-SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTD 309
           D R  +P      T          + +EN LA+GG ++ VY+YD   + +P+  M  HT 
Sbjct: 386 DVRAPEPFFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYDGT-LRQPMLSMEEHTA 444

Query: 310 AVTSLDFSSQDDGIILSAG--ADKRVIIWDI 338
           AV ++ +S    G++ + G  ADK++ IW+I
Sbjct: 445 AVKAMAWSPHTRGVLATGGGTADKKLKIWNI 475

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 97/249 (38%), Gaps = 54/249 (21%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA    +G V IYD    ++    TL  H D    L++N  +   L SGS D  +   DV
Sbjct: 333 LAVGLSSGIVEIYDV--LKNKCIRTLSGHVDRVACLSWNNHV---LSSGSRDRKILHRDV 387

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATIN-GTK 265
            +   EP  +  + HS  V   +W N  ++   +   D+ + ++D    +P+ ++   T 
Sbjct: 388 RAP--EPFFEQIDTHSQEVCGLKW-NVNENKLASGGNDNMVYVYDGTLRQPMLSMEEHTA 444

Query: 266 PFNTLSFSHHSENLLATGG---------------------------------VNSEVYLY 292
               +++S H+  +LATGG                                  N++  + 
Sbjct: 445 AVKAMAWSPHTRGVLATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIIT 504

Query: 293 DRRYVE-----------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI 341
              Y +           EP+ ++ GH+  V  L  S+ D   ++S   D+ +  W + D 
Sbjct: 505 SHGYSKYNLTLWNYPTLEPMAVLKGHSFRVLHLTLSA-DGTTVVSGAGDETLRYWKLFDK 563

Query: 342 GAEQVLEDA 350
              +  +D+
Sbjct: 564 PKSRGYQDS 572

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 75/174 (43%), Gaps = 34/174 (19%)

Query: 166 DTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI 224
           +TA + T   H D    L+F+    GHL+SGS D  V  WD+TS +              
Sbjct: 487 ETACVYTFDSHVDEITALSFDS---GHLVSGSQDRTVRQWDLTSGK-------------- 529

Query: 225 VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGG 284
              C       S  G +S+ SS           + T   T P   +      +  LATG 
Sbjct: 530 ---C-LQTIDLSFAGRLSQTSS------NSGSGLLTSTDTSPI--IGALQCFDAALATGT 577

Query: 285 VNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
            +  V L+D R   + +  + GHT AVTSL F S++   +++   D+ V IWD+
Sbjct: 578 RDGAVRLWDLR-SGKIIRTLEGHTGAVTSLKFDSKN---LITGSLDRSVRIWDL 627

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 234 QKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATG----GVNSEV 289
           Q++LF   S  + +++ D RE+K VAT+      N LS       +LA G    GV++ +
Sbjct: 64  QENLFAA-SNGNKVKVFDLRENKEVATLEQENGANVLSLGS-GHGMLAYGSEQQGVDAHL 121

Query: 290 YLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           +L+D R   +P+   +  H D +TS+ F   D  ++LS   D    ++D+
Sbjct: 122 HLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDL 171

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 102/233 (43%), Gaps = 25/233 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           G+AF+P  +   L     S + LWD        + ++E+ H   V    +H  Q  LF +
Sbjct: 16  GIAFHP-SRPWALVALFSSTIQLWDYR--MGTLLHRFED-HEGPVRSVDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D ++++     +K + T+ G   +    F HH    + +   +  + +++ +  +E 
Sbjct: 71  AGDDCTIKVWSLETNKCLYTLTGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQNRKEI 130

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN-----------------DIGA 343
            +L+ GH   V    F   +D +++SA  D+ V +WDI+                  +  
Sbjct: 131 ANLI-GHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHSAPAQSASFEEQMST 188

Query: 344 EQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           +Q + D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QQNILDGGFGDCVVKFILEGHTRGVNWVSFHPTLP-LIVSGSDDRQVKLWRMS 240

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 81/182 (44%), Gaps = 36/182 (19%)

Query: 110 LTESDEEQVR-----SNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNE 164
           ++ SD++ +R     +   +     H+  V  A++ P + +++ + S   TV ++D S  
Sbjct: 111 ISASDDQTIRIWNWQNRKEIANLIGHNHFVMCAQFHPTE-DLVVSASLDETVRVWDISGL 169

Query: 165 RD-------TASITLQYHT-----DNGYG-LAFNPLIKGH---------------LLSGS 196
           R        +AS   Q  T     D G+G      +++GH               ++SGS
Sbjct: 170 RKKHSAPAQSASFEEQMSTQQNILDGGFGDCVVKFILEGHTRGVNWVSFHPTLPLIVSGS 229

Query: 197 DDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           DD  V LW +++ +   V      H++ V+   +H  Q +L  +V ED +L++ D  +  
Sbjct: 230 DDRQVKLWRMSATKAWEVDTCRG-HTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDLDKRT 287

Query: 257 PV 258
           PV
Sbjct: 288 PV 289

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 98/223 (43%), Gaps = 47/223 (21%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV------TS 208
           T+ ++D S+ +   S      T N   L     I   ++SG  DS V LWD+      ++
Sbjct: 377 TIKVWDLSSSKFIGSFNAHLSTINCMQLDTQQQI---IISGGRDSLVRLWDIKKFQDYST 433

Query: 209 DRNEPVQKWENI--------HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVAT 260
           + N+    +E          HSD ++   + NF      T S+D +++  D    K V T
Sbjct: 434 NYNDIENYYEETNCIFECDSHSDEISSISYDNFN---LLTGSQDKTIKHWDLITGKCVQT 490

Query: 261 ------INGTKPF-NTLS------FSHHS----------ENLLATGGVNSEVYLYDRRYV 297
                 +N + PF N  S      F+H            E+ LA+G  +  + L+D R  
Sbjct: 491 FDVSFYLNNSPPFENKFSPTKKNYFAHSEAPTIGSLQCFESALASGTKDGLIRLWDLR-S 549

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
            + + ++ GHTDA+TSL F   +   +++   DK + IWD+ +
Sbjct: 550 GKVIRILEGHTDAITSLKFDMTN---LITGSLDKNIRIWDMRN 589

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 20/175 (11%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           +NP+    L+S S D+   +WD+ S      Q     H   V D ++      LF +   
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIA--HDSEVFDVKFLAHSTQLFASCGG 287

Query: 244 DSSLQIHDTRESKPVATI-------NGTKPFN----------TLSFSHHSENLLATGGVN 286
           D S+++ D R       I       NG+               L  S    N++AT  ++
Sbjct: 288 DGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALD 347

Query: 287 SE-VYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
           S+ + + D R    P+  + GH+ AV  + +  +   ++LS G D +V+ WD+N+
Sbjct: 348 SKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 65/152 (42%), Gaps = 21/152 (13%)

Query: 120 SNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTD-- 177
           SN   T+   HDSEV   +++     + A+  G G+V ++D    R  A  T+ Y ++  
Sbjct: 255 SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDL---RSLAHSTIIYESNSD 311

Query: 178 -NGY-GLAFNPLIKGHLL----SGSDDSNVALWDVTSD-------RN--EPVQKWENIHS 222
            NG   L  N      LL    S SD + +A + + S        RN   PV   E  HS
Sbjct: 312 QNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLEG-HS 370

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE 254
             VN  +WH  + ++  +  +D  +   D  E
Sbjct: 371 AAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 82/199 (41%), Gaps = 38/199 (19%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA---FNPLIK-GHLLSGSDDSN 200
           N LA+ S  G V  ++ +   +  S    Y    G  +     +P  K   +LS  DD  
Sbjct: 81  NKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKT 140

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVAT 260
           + LW V SD                            F ++ +D+ + + DT +   + T
Sbjct: 141 IKLWSVNSDD---------------------------FNSIKDDTKI-VSDTGDGALLKT 172

Query: 261 INGTKPFNTLSFSHHSEN-LLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ 319
             G   F   S  HH  N    TGG   +++  +R+   +PL  +S   D V+ + F+  
Sbjct: 173 FYGEHAFQ--SIDHHRRNPNFVTGGAQIQLWDVNRK---KPLSNLSWGVDNVSFVRFNQN 227

Query: 320 DDGIILSAGADKRVIIWDI 338
           ++ I+ S G+D  ++++D+
Sbjct: 228 EEDILASTGSDNSIVLYDL 246

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 68/150 (45%), Gaps = 8/150 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWDV  +R +P+    W     D V+  +++  ++ +  +   D+S+ ++D R + 
Sbjct: 196 AQIQLWDV--NRKKPLSNLSWG---VDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNS 250

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   +      N L ++       A    +   Y YD R +   LH+   H  AV  +DF
Sbjct: 251 PTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDF 310

Query: 317 SSQDDGIILSAGADKRVIIWDINDIGAEQV 346
           S   + I+ +   DK + I+++    + +V
Sbjct: 311 SPTGEEIV-TGSYDKTIRIFNLKHGHSREV 339

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 13/137 (9%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENI--HSDIVNDCQWHNFQKSLFGTV 241
           F+ L     ++GS D+ +AL D+ + R     K  N   H+ +VN  +  N  +  F +V
Sbjct: 126 FDTLDDTRAVTGSSDTRLALVDLHTGR-----KLRNFAGHTRVVNQVRALNTDR--FASV 178

Query: 242 SEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHS--ENLLATGGVNSEVYLYDRRY--V 297
           S+D +L+I D     PV  I+   P  TL+ S  S  +N+L T G++  +  YD R    
Sbjct: 179 SDDGALKIWDAHTKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPVIRAYDLRQNNG 238

Query: 298 EEPLHLMSGHTDAVTSL 314
           +E  +  + HTD+VTS+
Sbjct: 239 QELFNWSTPHTDSVTSI 255

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/279 (21%), Positives = 112/279 (40%), Gaps = 43/279 (15%)

Query: 150 ISGTGTVYIYDRSNER---DTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           + G G ++I D  N+    +T S   Q   D  + +A+N L + H+L    D ++ L+D+
Sbjct: 34  LVGNGKLFIIDIDNQGRMLETKSFVTQ---DGLFDVAWNELHENHVLVAQGDGSLRLFDI 90

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI----------------- 249
             + + PV  ++  H   V  C W+   K LF + S D ++++                 
Sbjct: 91  QLN-DYPVAIFQE-HEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTPKPM 148

Query: 250 --HDTRESKPVATINGTKPFNTLS----------FSHHSENLLATGGVNSEVYLYDRRYV 297
             H++  S     ++  K   +LS          FS H  N++ +   NS V ++D R  
Sbjct: 149 TAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQP 208

Query: 298 EEP--LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATS 355
                   M+ +     + DF+     II + G D  V +WD+  +           + +
Sbjct: 209 ANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVN 268

Query: 356 EVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
           E+     GH   I   + +P    ++ S   +   ++W+
Sbjct: 269 EI----CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 16/139 (11%)

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYV-------EEPLHL--MSGHTDAVTSLDFSSQ 319
           T  F+ +  +++ATGGV++ V ++D R V        +P+ +  + GH  A+  + +S  
Sbjct: 226 TCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPH 285

Query: 320 DDGIILSAGADKRVIIW-DINDIGAEQVLE-DAEDATSEVMMIHAGHRSPINDFAINPSI 377
              ++LS   D    +W D++D G     + ++ D T     I + H   +  F  + S+
Sbjct: 286 HSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCRFIFSHHTEFV--FGADWSL 343

Query: 378 ---PWLVASAEEENIVQLW 393
              P  VAS   +  V +W
Sbjct: 344 WGQPGYVASTSWDGDVCIW 362

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 81/198 (40%), Gaps = 21/198 (10%)

Query: 101 PTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYD 160
           P  +T  ++   S +  + +  R T   K+ + + ++++ P DPNI+ + +G   V ++D
Sbjct: 145 PKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFD 204

Query: 161 RSNERDTASITLQYHTDNGY---GLAFNPLIKGHLLSGSDDSNVALWDV------TSDRN 211
                +    +   H  NG       FN      + +G  D+ V +WD+       ++  
Sbjct: 205 LRQPANANQYSFMAH--NGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSR 262

Query: 212 EPVQKWENIHSDI-VNDCQWHNFQKSLFGTVSEDSSLQI-----HDTRESKPVATINGTK 265
           +P+   E    D+ +    W     ++  + S D + ++      D R  +P    N   
Sbjct: 263 QPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGR--RPTGKTNSID 320

Query: 266 PFNTLS--FSHHSENLLA 281
           P +     FSHH+E +  
Sbjct: 321 PTHGCRFIFSHHTEFVFG 338

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/278 (20%), Positives = 113/278 (40%), Gaps = 48/278 (17%)

Query: 53  ETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSN--- 109
           +  +++P   +QW+P S+    T  + +      D+ +  + +++V     V D +N   
Sbjct: 103 QAHVIYPVSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNLSLVKYGKGVGDVANGHT 162

Query: 110 ------LTESDEEQVRSNIRV--------------------TRKFKHDSEVTRARYMPQD 143
                 +T  D   + +NI +                    T+   HDSEV  A+++ Q 
Sbjct: 163 LGKLPPVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQS 222

Query: 144 PNILATISGTGTVYIYDRSNERDTASI-----TLQYHTDNGYGLAFNPLIKGHLLSGSDD 198
            N+ A+  G G+V ++D      +  I      +Q HT +   L+      GH    + +
Sbjct: 223 SNLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQN 282

Query: 199 SNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ-IHDTR-ESK 256
           +      V+S  ++ + + E              F  ++  T+ +DS++  I D R    
Sbjct: 283 AAETSLAVSSLESQALLRLEP-----------SPFDPNILATIQQDSNVVIILDMRYPGS 331

Query: 257 PVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYD 293
           P+ T+NG     N L +     N+LAT G + ++  +D
Sbjct: 332 PILTLNGHYCALNQLRWHPSKPNVLATCGDDCQILYWD 369

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 101/266 (37%), Gaps = 62/266 (23%)

Query: 134 VTRARYMPQDPNILATISGTGTVY-IYDRSNERDTASITLQYHTD-----NGYGLA---- 183
           V+R ++MP     LAT S +  ++ + D+  E+   S+ ++Y        NG+ L     
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNLSL-VKYGKGVGDVANGHTLGKLPP 168

Query: 184 -----FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLF 238
                +N +    +LS S D+   +WD+ +      Q     H   V D ++     +LF
Sbjct: 169 VTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLIA--HDSEVFDAKFLTQSSNLF 226

Query: 239 GTVSEDSSLQIHDTRE-------SKPVATINGTKPFNT-LSFSHH------------SEN 278
            +   D S+++ D R         +P + I    P    LS   H            +E 
Sbjct: 227 ASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAET 286

Query: 279 LLATGGVNSE------------------------VYLYDRRYVEEPLHLMSGHTDAVTSL 314
            LA   + S+                        V + D RY   P+  ++GH  A+  L
Sbjct: 287 SLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQL 346

Query: 315 DFSSQDDGIILSAGADKRVIIWDIND 340
            +      ++ + G D +++ WD+ D
Sbjct: 347 RWHPSKPNVLATCGDDCQILYWDLLD 372

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 285 VNSEVYLYDRRYVEEPLHLMSGHTDA----VTSLDFSSQDDGIILSAGADKRVIIWDI-- 338
           +  +V L   +Y +    + +GHT      VTS D++S D  IILS+  D    +WD+  
Sbjct: 139 LKEQVNLSLVKYGKGVGDVANGHTLGKLPPVTSFDWNSIDTNIILSSSIDTTCTVWDLQA 198

Query: 339 -NDIGAEQVLEDAE 351
            N +  + +  D+E
Sbjct: 199 SNYVKTQLIAHDSE 212

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 33/84 (39%), Gaps = 7/84 (8%)

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           P DPNILATI     V I        +  +TL  H      L ++P     L +  DD  
Sbjct: 305 PFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLRWHPSKPNVLATCGDDCQ 364

Query: 201 VALWDVTSDRNE-------PVQKW 217
           +  WD+    N        P Q+W
Sbjct: 365 ILYWDLLDSLNGGTISSGIPQQRW 388

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 17/179 (9%)

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWEN--IHSDIVNDCQWHNFQKSL 237
           + L   PL +  LLS   + +V L D  +       K  N  I+   V D  + N   S+
Sbjct: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDN--GSV 74

Query: 238 FGTVSEDSSLQIHDTR--ESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSEV 289
           F +V+ + ++++ D R   +  VA +N  K  PF +L   H    +LA G    GV++E+
Sbjct: 75  F-SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSGVDAEI 130

Query: 290 YLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           ++YD R  ++P+  L+  H D VT + F   D  ++LS   D    ++D+  +  E  L
Sbjct: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE--- 212
           ++IYD  N      + +  H D+   + F+P     LLSGS D    ++D+T    E   
Sbjct: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189

Query: 213 -PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
             V  +E++HS     C W         T+S   +  IH+
Sbjct: 190 HQVINYESVHS-----CGW--LSPKRIYTLSHMETFAIHE 222

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 277 ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG--ADKRVI 334
           EN L +GG ++ V +YDR   + P   M+ H  AV +LD+SS   GI+ + G  AD+ + 
Sbjct: 398 ENKLVSGGNDNIVNVYDRTSTK-PFMTMTEHKAAVKALDWSSHKRGILATGGGTADRHLK 456

Query: 335 IWDINDI 341
           IW++N++
Sbjct: 457 IWNVNNM 463

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 97/251 (38%), Gaps = 58/251 (23%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA     G V I+D + ++     T+  H+D    L++N  I   L SGS D N+   DV
Sbjct: 318 LAVGQSNGIVEIFDVNKKK--CIRTMLGHSDRVACLSWNSYI---LTSGSRDHNILHRDV 372

Query: 207 TSDRNEPVQKWENI--HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT 264
            S    P   +E I  HS  V   +W N  ++   +   D+ + ++D   +KP  T+   
Sbjct: 373 RS----PDPFFEKIESHSQEVCGLKW-NVDENKLVSGGNDNIVNVYDRTSTKPFMTMTEH 427

Query: 265 KP-FNTLSFSHHSENLLATGG-----------VNSEVYLYD------------RRYVEE- 299
           K     L +S H   +LATGG           VN+   L D             +  +E 
Sbjct: 428 KAAVKALDWSSHKRGILATGGGTADRHLKIWNVNNMTKLNDVDTGSQVCNLVWSKNTDEI 487

Query: 300 --------------------PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
                               P+ ++ GH+  V  L  S+ D   I+S   D+ +  W + 
Sbjct: 488 VTSHGFSKYNLTLWNYPNLDPIAILKGHSFRVLHLTLSA-DGTTIVSGAGDETLRYWKLF 546

Query: 340 DIGAEQVLEDA 350
           +    + L D 
Sbjct: 547 EKQKHRSLSDT 557

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 131/328 (39%), Gaps = 58/328 (17%)

Query: 42  SNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLP 101
           SN  + ++ V+E  + +P   +QWLP S PNP   ++L     TS E    L+I  +D  
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLP-SVPNP---RKLA----TSSE---CLRIWSLD-D 237

Query: 102 TEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDR 161
             + ++S    +     R N    +       ++  +Y  Q       I    T  + ++
Sbjct: 238 NSMDNSSVFNNNISNNSRHNT-YKKSLTEQVNLSLCKYNEQH-----QIINNSTNSVSNK 291

Query: 162 SNERDTASI--TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWEN 219
           SN R    +     +H        +N +    L+S S D+   +WD+ S      Q    
Sbjct: 292 SNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIA- 342

Query: 220 IHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI-------NGTKPFNT--- 269
            H   V D ++      LF +   D S+++ D R  +    I        G   FN    
Sbjct: 343 -HDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNTFNNDVT 401

Query: 270 --------LSFSHH---------SENLLATGGVNSE-VYLYDRRYVEEPLHLMSGHTDAV 311
                    S SH            NL+AT G++ + + + D R    P+ ++SGH+ +V
Sbjct: 402 TKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVLSGHSPSV 461

Query: 312 TSLDFSSQDDGIILSAGADKRVIIWDIN 339
             + +      ++LS G D +V+ WD+N
Sbjct: 462 NQIKWHPSKPYVLLSCGDDCQVLYWDLN 489

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 8/166 (4%)

Query: 175 HTDNGYGLAFNPLIKGHL-LSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNF 233
           H +    L F P   GHL LSG +D+ + +WD+  DR   + +    H   + D  +   
Sbjct: 177 HENGTTALKFLPK-SGHLFLSGGNDNKLKIWDLYHDRR--LLRDFCGHQKPIRDFNFTTD 233

Query: 234 QKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYD 293
            K  F +VS D  L+I DT +   +     T   N ++F   +   L  G +NSE+  YD
Sbjct: 234 SKQ-FTSVSYDKFLKIWDTEKGAIIHRTKLTSVPNCVTFHPINNYELVVGLLNSEIKHYD 292

Query: 294 RR--YVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
            R  Y    +     HT ++ +L F       I S+  DK + IWD
Sbjct: 293 TRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFI-SSSEDKTIRIWD 337

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           +++  GH +  T+L F  +   + LS G D ++ IWD+      ++L D           
Sbjct: 171 INVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDL--YHDRRLLRD----------- 217

Query: 361 HAGHRSPINDF 371
             GH+ PI DF
Sbjct: 218 FCGHQKPIRDF 228

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 91/199 (45%), Gaps = 20/199 (10%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSD-RNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
           + F+P+    L+ G  +S +  +D   + +N  +Q +++  S I+    + N  K  F +
Sbjct: 269 VTFHPINNYELVVGLLNSEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSK--FIS 326

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSE-NLLATGGVNSEVYLYD--RRYV 297
            SED +++I D + + P+  I+ T   +      H E N  AT  +++ + +Y    +Y 
Sbjct: 327 SSEDKTIRIWDNQINIPIKQISDTAQHSMPWIEIHPEHNYFATQSMDNSIGVYSMKPKYK 386

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAG-ADKRVIIWDINDIGAEQVLEDAEDATSE 356
           +    +  GH  A   + F    DG  +++G +  R+ IWD       ++L+        
Sbjct: 387 KHTKKIFKGHHSAGYGIRFDISPDGRYIASGDSMGRLFIWDWKTC---RILK-------- 435

Query: 357 VMMIHAGHRSPINDFAINP 375
               +AG + P+ + A NP
Sbjct: 436 --QFNAGTKDPLTNVAWNP 452

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 17/197 (8%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA+ S  GT+ I+D S  R T   TL  HT++   + +    +G L +GS D  + +WD+
Sbjct: 251 LASASKDGTIKIWDAS--RRTCLYTLSGHTNSVSCVKWGG--QGLLYTGSHDKTIRVWDI 306

Query: 207 TSDRNEPVQKWENI---HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING 263
            +       K  NI   H+  VN            G    D        +E++ +A  N 
Sbjct: 307 KAG-----GKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKAS-PSPQEARDIAKKNY 360

Query: 264 TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI 323
            K    +  S   E L+ T   +  ++L++     +PL  M+GH   V  + F S D   
Sbjct: 361 EK---VVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAF-SPDGRY 416

Query: 324 ILSAGADKRVIIWDIND 340
           I+SA  D  + +WD  D
Sbjct: 417 IVSASFDNSIKLWDGRD 433

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 81/170 (47%), Gaps = 19/170 (11%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           AF P     +++G+ D+   +WD  +     V K    HS+ V    W +    L  T S
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLK---GHSNWVLCVAW-SPDGELIATGS 205

Query: 243 EDSSLQIHDTRESKPV--ATINGTKPFNTLSF------SHHSENLLATGGVNSEVYLYD- 293
            D+++++ +++  KP   A    +K   +L++      +   +  LA+   +  + ++D 
Sbjct: 206 MDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDA 265

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG 342
            RR     L+ +SGHT++V+ + +  Q  G++ +   DK + +WDI   G
Sbjct: 266 SRRTC---LYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWDIKAGG 310

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 72/146 (49%), Gaps = 7/146 (4%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           +++ SDD  + LW+      +P+ +    H  +VN   +    + +  + S D+S+++ D
Sbjct: 374 MVTASDDFTMFLWNPLKS-AKPLARMTG-HQKLVNHVAFSPDGRYIV-SASFDNSIKLWD 430

Query: 252 TRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
            R+ K +AT  G       +++S     LL +   ++ + ++D +  +  + L  GH D 
Sbjct: 431 GRDGKFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVKTRKLSVDL-PGHQDE 488

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIW 336
           V ++D+S  D   + S G DK V +W
Sbjct: 489 VYTVDWSV-DGQRVCSGGKDKMVRLW 513

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 104/241 (43%), Gaps = 28/241 (11%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWENIHSDIVND 227
           TL+ H      LA +P     LLS S D  +  W +T +  +   PV+ ++  HS I+ D
Sbjct: 12  TLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKG-HSHIIQD 70

Query: 228 CQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHSENLLATGGVN 286
           C   N  K    + S D +L++ D    + +    G K  + +S S       + +   +
Sbjct: 71  CTVTNDGKYAL-SASWDKTLRLWDLASGESLIRFVGHKS-DVMSVSIDAGATQIVSASRD 128

Query: 287 SEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG----IILSAGADKRVIIWDINDIG 342
             V +++   V E +  + GH D V+ +  + +D+      ++SAG DK V +WD+    
Sbjct: 129 KTVKVWNT--VGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQSF- 185

Query: 343 AEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRI 402
                      T E   I  GH + +N    +P    + ASA ++  + LW  + K+   
Sbjct: 186 -----------TIEADFI--GHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAKIALY 231

Query: 403 S 403
           S
Sbjct: 232 S 232

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 93/214 (43%), Gaps = 21/214 (9%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWEN--IHSDIVNDC 228
           T  + +DN + L   P    HLL+   +  V   D  + ++  V +  N  I+   + D 
Sbjct: 9   TQDFGSDN-WCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKLKIIDS 67

Query: 229 QWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG--- 283
              NF +     V+ + S+ I D R    +A++   K  PF +L   H    +LA G   
Sbjct: 68  ---NFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRH---GMLACGTEL 121

Query: 284 -GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI 341
            GV++E+++YD R    P+   +  H D VT + F   D  ++LS   D    ++D+   
Sbjct: 122 SGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLK-- 179

Query: 342 GAEQVLEDAEDATSEVMMIH-AGHRSPINDFAIN 374
             +Q  +DA         IH  G  SP   F ++
Sbjct: 180 --QQEEDDALHQVINYASIHSCGWLSPKRIFTLS 211

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 23/170 (13%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           ++S S D+   +WD+ S      Q     H   V D ++      LF +   D S+++ D
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA--HDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 252 TRE-------------SKPVATINGTKPFNT-------LSFSHHSENLLATGGVNS-EVY 290
            R              S P    + T P +        L  S +  N+LAT    S ++ 
Sbjct: 317 LRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKII 376

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
           + D R  E P+  + GH+ +V  + +      ++LS G D +V+ WD+N+
Sbjct: 377 ILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNN 426

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 129 KHDSEVTRARYMPQDPNILATISG-TGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPL 187
           K    + R    P DPN+LAT +  +  + I D  N  ++  + L+ H+ +   + ++P 
Sbjct: 347 KGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNP-ESPILNLEGHSSSVNEIKWHPT 405

Query: 188 IKGHLLSGSDDSNVALWDV 206
            +  LLS  DD  V  WD+
Sbjct: 406 KRNVLLSCGDDCQVLYWDL 424

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 62/160 (38%), Gaps = 26/160 (16%)

Query: 125 TRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAF 184
           T+   HDSEV   R++ +   + A+  G G+V ++D    R  A  T+ Y          
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL---RSLAHSTIIYEPPASSAPGL 337

Query: 185 NPLIKGHLLSGSD----------DSNV-ALWDVTSDR---------NEPVQKWENIHSDI 224
           N         GSD          D NV A +   S++           P+   E  HS  
Sbjct: 338 NADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEG-HSSS 396

Query: 225 VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT 264
           VN+ +WH  ++++  +  +D  +   D   S     ING 
Sbjct: 397 VNEIKWHPTKRNVLLSCGDDCQVLYWDLNNS--FMEINGA 434

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 245 SSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSEVYLYDRRYVE 298
            +++I D R +  +ATI+  K  PF +L   H   N+LA G    G ++E+++YD R  +
Sbjct: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWD 136

Query: 299 EPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
            PL  L+  H D +T + F   D  +++S   D    I+D+     E  L
Sbjct: 137 SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 71/152 (46%), Gaps = 10/152 (6%)

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           HL  G  +  V ++D+   +     +  + H D V    W+N    +  + S D  +   
Sbjct: 305 HLAVGQGNGLVEIYDIVKRK---CIRTLSGHMDRVACLSWNNH---ILTSGSRDRKILHR 358

Query: 251 DTRESKPVATINGTKPFNTLSFSHHS-ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTD 309
           D R  +P      T          ++ EN LA+GG ++ VY+YD     +P   ++ HT 
Sbjct: 359 DVRMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYD-GTSRKPTLKLAEHTA 417

Query: 310 AVTSLDFSSQDDGIILSAG--ADKRVIIWDIN 339
           AV ++ +S    GI+ + G  ADK++ IW++N
Sbjct: 418 AVKAIAWSPHKRGILATGGGTADKKMKIWNVN 449

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 88/239 (36%), Gaps = 54/239 (22%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA   G G V IYD    +     TL  H D    L++N  I   L SGS D  +   DV
Sbjct: 306 LAVGQGNGLVEIYDIVKRK--CIRTLSGHMDRVACLSWNNHI---LTSGSRDRKILHRDV 360

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI-NGTK 265
                EP  +    H+  V   +W N  ++   +   D+ + ++D    KP   +   T 
Sbjct: 361 RMP--EPYFEQVETHTQEVCGLKW-NTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTA 417

Query: 266 PFNTLSFSHHSENLLATGG-----------VNSEVYLYD--------------------- 293
               +++S H   +LATGG           VN+   L D                     
Sbjct: 418 AVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVT 477

Query: 294 ----RRY--------VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
                RY          EP+ ++ GH+  V  L  S+ D   ++S   D+ +  W + D
Sbjct: 478 SHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSA-DGTTVVSGAGDETLRYWKLFD 535

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 4/148 (2%)

Query: 199 SNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + + LWD +  R      W    +D V+  +++  +  +F +   D+S+ ++D R + P 
Sbjct: 193 AEINLWDSSRSRPTANLSWG---ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPT 249

Query: 259 ATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSS 318
                    N L ++            +   Y YD R +   LH+   H  AV  +DFS 
Sbjct: 250 QKFTQRMRTNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSP 309

Query: 319 QDDGIILSAGADKRVIIWDINDIGAEQV 346
             D I+ +   DK + I+ +    + +V
Sbjct: 310 TGDEIV-TGSYDKTIRIYQVKHGHSREV 336

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 28/185 (15%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC------ 228
           H D  Y +A N      L S S D  V  W++++   E +  ++  +  +   C      
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMST--REEICSFKAHYGLVHGLCVTPQHL 123

Query: 229 ---QWHNFQKS--------LFGTVSEDSSLQIHDTRESKP---VATINGTKPFNTLSFSH 274
              +  N+  S        L+   +ED S   +D  +S     + T +G   F  L   H
Sbjct: 124 SANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAF--LGIDH 181

Query: 275 H-SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
           H S+    T G  +E+ L+D      P   +S   D V+++ F+  +  I  SAG+D  V
Sbjct: 182 HRSKPYFVTAG--AEINLWDSS-RSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSV 238

Query: 334 IIWDI 338
           +++D+
Sbjct: 239 VLYDL 243

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 106/246 (43%), Gaps = 30/246 (12%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLSGS D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFG-TVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHS 276
             HS IV DC     Q   +  + S D +L++ D    +      G K  + +S +    
Sbjct: 63  G-HSHIVQDCTLT--QDGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVAIDRK 118

Query: 277 ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS---SQDDGI-ILSAGADKR 332
            +++ +G  +  + ++  +   + L  + GH D V+ +  +     DD + ++SAG DK 
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKM 176

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH   +N    +P    L+ASA ++  + L
Sbjct: 177 VKAWNLNQF---QIEAD-----------FVGHNGNVNAVTASPDGT-LIASAGKDGEIML 221

Query: 393 WKCSHK 398
           W  + K
Sbjct: 222 WNLAEK 227

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 98/247 (39%), Gaps = 43/247 (17%)

Query: 134 VTRARYMPQDPNILATISGTGTVY-IYDRSNERDTASITLQYHTDNG------------- 179
           VTR +++P+    LAT S +  ++ + D   E+   S+       NG             
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLPPV 170

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFG 239
               +N +    ++S S D+   +WD+ S      Q     H   V D ++      LF 
Sbjct: 171 TSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQL--IAHDSEVYDVKFLTNSTQLFA 228

Query: 240 TVSEDSSLQIHDTRE-------SKPVATI-----------------NGTKPFNTLSF--S 273
           +   D S+++ D R         +P+A +                 +GT     L    S
Sbjct: 229 SCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPS 288

Query: 274 HHSENLLATGGVNSE-VYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKR 332
               N++AT   +S  V + D RY   P+  + GH+ AV  + +      ++L+ G D +
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQ 348

Query: 333 VIIWDIN 339
           V+ WDIN
Sbjct: 349 VLYWDIN 355

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 89/258 (34%), Gaps = 53/258 (20%)

Query: 46  MMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVT 105
           + +D + E  + +P    QWLP       T  + +      D  Q  L +++     +  
Sbjct: 97  VTWDKLFECNVTYPVTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCKYSKQSN 156

Query: 106 DTSN---------LTESDEEQVRSNIRV--------------------TRKFKHDSEVTR 136
            ++          +T  D   V +N+ +                    T+   HDSEV  
Sbjct: 157 GSTASAALGSLPPVTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLIAHDSEVYD 216

Query: 137 ARYMPQDPNILATISGTGTVYIYD-RSNERDT------ASITLQYHTDNGYG-------- 181
            +++     + A+  G G+V ++D R     T      A +T      +G G        
Sbjct: 217 VKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDG 276

Query: 182 --------LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNF 233
                   L  +P     + + + DSN  L         P+   E  HS  VN  +WH  
Sbjct: 277 TNHTALLRLEPSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEG-HSSAVNQMRWHPT 335

Query: 234 QKSLFGTVSEDSSLQIHD 251
           Q+++  T  +D  +   D
Sbjct: 336 QRNVLLTCGDDCQVLYWD 353

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%)

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           P DPN++AT +      +        +  +TL+ H+     + ++P  +  LL+  DD  
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQ 348

Query: 201 VALWDVTS 208
           V  WD+ S
Sbjct: 349 VLYWDINS 356

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    L+ +   +  L S S D  V LWD+ +      + + +IHS+  V+  QWH+
Sbjct: 273 HHTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNA--GIAARSFASIHSNKNVSSSQWHS 330

Query: 233 FQKSLFGTVSEDSSLQIHDTR------ESKPVATINGTKPFNTLSFSHHSENLLATGGVN 286
              S+  T   DS + + D R       SK  + ++G +    + F+   EN +  G  +
Sbjct: 331 TSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSG-EEVECVQFA--DENTIMCGTDS 387

Query: 287 SEVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILS-AGADKRVIIWDINDIGA 343
             VY YD R  E  +PL  ++ H   +++L+ +     ++ + A  +K V +W  ++ G 
Sbjct: 388 GNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNPFIPNLLATGAMGEKTVKLWKCSESGP 447

Query: 344 EQVL 347
             VL
Sbjct: 448 SMVL 451

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 85/191 (44%), Gaps = 24/191 (12%)

Query: 221 HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE---SKPVATINGTKPFNTLSFSHHSE 277
           H+D V         +++  + S D ++++ D      ++  A+I+  K  ++  +   S 
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAGIAARSFASIHSNKNVSSSQWHSTSG 333

Query: 278 NLLATGGVNSEVYLYDRRYVEEPL-----HLMSGHTDAVTSLDFSSQDDGIILSAGADKR 332
           ++L TGG +S + L D R  ++        +MSG  + V  + F+  D+  I+       
Sbjct: 334 SVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSG--EEVECVQFA--DENTIMCGTDSGN 389

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVAS-AEEENIVQ 391
           V  +DI            +   S+ +     H + I+   +NP IP L+A+ A  E  V+
Sbjct: 390 VYSYDIR-----------QGEGSKPLWTLNAHDAGISTLNVNPFIPNLLATGAMGEKTVK 438

Query: 392 LWKCSHKLPRI 402
           LWKCS   P +
Sbjct: 439 LWKCSESGPSM 449

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           H+ + HTDAV SL  S Q   ++ S  AD  V +WD+N
Sbjct: 269 HVTTHHTDAVLSLSHSKQFRAVLASTSADHTVKLWDLN 306

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 105 TDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATIS-GTGTVYIYDRSN 163
           TD+ N+   D  Q   +  +     HD+ ++     P  PN+LAT + G  TV ++  S 
Sbjct: 385 TDSGNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNPFIPNLLATGAMGEKTVKLWKCSE 444

Query: 164 ERDTASITLQYHTDNGYGLAFNP--LIKGHLLSGSDDSNVALWDVTSDRN 211
              +  ++  +   N    +F P   + G+++ G  +  + LWDV ++R+
Sbjct: 445 SGPSMVLSRDFGVGNVLSTSFAPDLEVAGNIIIGGVNKGLKLWDVFTNRS 494

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 130/311 (41%), Gaps = 50/311 (16%)

Query: 109 NLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTA 168
           N   + +E ++S I V+   K   ++ + + + +  + L   +   +V +Y  +N     
Sbjct: 652 NTKTATKESIKSTISVS---KLQGKIKKFQELAKSLHYLGCQTSLPSVSMYTYTNTEKNM 708

Query: 169 SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR-NEPVQKWENI------- 220
           S +L + +D  Y LA          +G  DS + +W +     NE  Q +  I       
Sbjct: 709 S-SLDFSSD--YTLA---------ATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTL 756

Query: 221 --HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSE 277
             HSD V    +    + L  + S D + ++  T   K + +  G  KP   ++FS    
Sbjct: 757 VGHSDAVYSVNFSPCNRFLL-SGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGN 815

Query: 278 NLLATGGVN--SEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
           NL AT   +  + V+  DR Y   P+ +++GH   V  + F   +   + +  +DK   +
Sbjct: 816 NLFATASSDNTARVWSCDRVY---PVRILAGHLSDVDCVSFHP-NGQYVFTGSSDKTSRM 871

Query: 336 WDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW-- 393
           WD+              ++ + + +  GH S +   A++P   WL ++A E+  + +W  
Sbjct: 872 WDL--------------SSGDSVRLFIGHSSAVTATAVSPDGRWL-STANEDGTITVWDI 916

Query: 394 KCSHKLPRISG 404
               KL  + G
Sbjct: 917 GSGKKLKSMRG 927

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 89/224 (39%), Gaps = 49/224 (21%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW 230
           TL  H+D  Y + F+P  +  LLSGS D    LW  ++D  + +  ++  H   + D  +
Sbjct: 755 TLVGHSDAVYSVNFSPCNR-FLLSGSGDKTARLW--STDTYKGLVSYKG-HEKPIWDVNF 810

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEV 289
                +LF T S D++ ++       PV  + G     + +SF H +   + TG  +   
Sbjct: 811 SPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSF-HPNGQYVFTGSSDKTS 869

Query: 290 YLYDRRYVEEPLHLMSGHTDAVTSLDFS--------SQDDG------------------- 322
            ++D     + + L  GH+ AVT+   S        + +DG                   
Sbjct: 870 RMWDLS-SGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGH 928

Query: 323 ---------------IILSAGADKRVIIWDINDIGAEQVLEDAE 351
                          I++S+GAD  V +WDI     E  LE  E
Sbjct: 929 GKNSIYSLSYNKTGNILVSSGADNSVRVWDIKKNTHEPSLEPEE 972

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNG-YGLAFNPLI 188
           H S VT     P D   L+T +  GT+ ++D  + +   S  ++ H  N  Y L++N   
Sbjct: 886 HSSAVTATAVSP-DGRWLSTANEDGTITVWDIGSGKKLKS--MRGHGKNSIYSLSYNKT- 941

Query: 189 KGHLL--SGSDDSNVALWDVTSDRNEPVQKWENIHSDIVND 227
            G++L  SG+D+S V +WD+  + +EP  + E I+  + ND
Sbjct: 942 -GNILVSSGADNS-VRVWDIKKNTHEPSLEPEEIYPGLGND 980

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 118/283 (41%), Gaps = 44/283 (15%)

Query: 136 RARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSG 195
           R+     D   LAT +    + I+D S+++    +TLQ H  + Y L + P     L+SG
Sbjct: 373 RSVCFSPDGKYLATGAEDKLIRIWDLSSKK--ILMTLQGHEQDIYSLDYFP-AGDKLVSG 429

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES 255
           S D  V +WD+ + +       E    D V                S D ++++ D+   
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIE----DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 256 KPVATINGTKPFNT--------LSFSHHSENLLATGGVNSEVYLYDRRYVE-EPLHLM-- 304
             V  ++     +T        + F+    +++ +G ++  V L+D R +  +  H    
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVV-SGSLDRSVKLWDLRGLNGQKSHATCE 544

Query: 305 ---SGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIH 361
              +GH D V S+  ++QDD  ILS   D+ V+ WD               A+   +++ 
Sbjct: 545 VTYTGHKDFVLSV-ATTQDDEYILSGSKDRGVLFWDT--------------ASGNPLLML 589

Query: 362 AGHRSP------INDFAINPSIPWLVASAEEENIVQLWKCSHK 398
            GHR+       +N F + P I  + A+   +   ++WK + K
Sbjct: 590 QGHRNSVISVAVVNGFPLGPDI-GVFATGSGDCKARIWKYTKK 631

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 106/246 (43%), Gaps = 30/246 (12%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLSGS D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFG-TVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHS 276
             HS IV DC     Q   +  + S D +L++ D    +      G K  + +S +    
Sbjct: 63  G-HSHIVQDCTLT--QDGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVAIDRK 118

Query: 277 ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS---SQDDGI-ILSAGADKR 332
            +++ +G  +  + ++  +   + L  + GH D V+ +  +     DD + ++SAG DK 
Sbjct: 119 ASMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKM 176

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH   +N    +P    L+ASA ++  + L
Sbjct: 177 VKAWNLNQF---QIEAD-----------FVGHNGNVNTVTASPDGT-LIASAGKDGEIML 221

Query: 393 WKCSHK 398
           W  + K
Sbjct: 222 WNLAEK 227

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 19/188 (10%)

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV--QKWENIHSDI-VNDC 228
           L +HTD    LA +   +  L S S D  V LWD+    NE +  +   +IHS+  V+  
Sbjct: 289 LTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDL----NEGIAARSVASIHSNKNVSSS 344

Query: 229 QWHNFQKSLFGTVSEDSSLQIHDTR------ESKPVATINGTKPFNTLSFSHHSENLLAT 282
           QWH+   S+  T   DS + + D R       SK  + + G +    + F+   EN    
Sbjct: 345 QWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTG-EDVECVQFA--DENTFMC 401

Query: 283 GGVNSEVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILS-AGADKRVIIWDIN 339
           G  +  VY +D R  E  +PL  ++ H   +++L+ +     ++ + A  +K V  W I+
Sbjct: 402 GTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFWKIS 461

Query: 340 DIGAEQVL 347
           + G   VL
Sbjct: 462 ESGPSMVL 469

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND-IGAEQV 346
           H+++ HTDAV SL  S Q   ++ S  AD  V +WD+N+ I A  V
Sbjct: 287 HVLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEGIAARSV 332

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 105 TDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATIS-GTGTVYIYDRSN 163
           TD+ N+   D  Q   +  +     HD+ ++     P  PN+LAT + G  TV  +  S 
Sbjct: 403 TDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFWKISE 462

Query: 164 ERDTASITLQYHTDNGYGLAFNPLIK--GHLLSGSDDSNVALWDVTSDRN 211
              +  ++  +   N    +F P I+  G+++ G  D  + LWDV ++R+
Sbjct: 463 SGPSMVLSRDFGVGNVLTTSFAPDIEVAGNIVIGGVDKGLKLWDVFTNRS 512

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 30/167 (17%)

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWH 231
            + H D    L+F+      L+SGS D  +  WD+ + +   +Q+ + I +   ND    
Sbjct: 439 FEIHDDEITALSFDS---EALISGSKDKKILHWDMATGK--CIQQLDLIFAPTHND---- 489

Query: 232 NFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYL 291
               S     S + S ++ DT ++  +  +   K            + LATG  +  V L
Sbjct: 490 ----SRISAPSSNYSTRLLDT-DAPMIGALQCYK------------SALATGTKDGIVRL 532

Query: 292 YDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           +D R V +P+ L+ GHTD +TSL F S+    +++   D  V IWD+
Sbjct: 533 WDLR-VGKPVRLLRGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 575

>NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 90/210 (42%), Gaps = 22/210 (10%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLL-SGSDDSNVALWD 205
           LA   G G V IYD    +     TL  H D    L++N    GH+L SGS D N+   D
Sbjct: 346 LAVGQGNGLVEIYDVVKRK--CVRTLSGHVDRVACLSWN----GHILTSGSRDHNILHRD 399

Query: 206 VTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKP-VATINGT 264
           V     +P  +  N HS  V   QW N +++   +   D+ + ++D     P +  I   
Sbjct: 400 VRMP--DPFFERLNTHSQEVCGLQW-NTEENKLASGGNDNVVCVYDGTSRNPMIKFIEHK 456

Query: 265 KPFNTLSFSHHSENLLATGGVNSEVYLYDRRY----VEEPLHLMSGHTDA-VTSLDFSSQ 319
                L++S H   +LATGG        DRR     V   + L    T + V ++ +S  
Sbjct: 457 AAVKALAWSPHKRGILATGGGT-----VDRRLKTWNVNTSMKLSDVDTGSQVCNMIWSKN 511

Query: 320 DDGIILSAGADK-RVIIWDINDIGAEQVLE 348
            D I+ S G  K  + +WD   +    +L+
Sbjct: 512 TDEIVTSHGYSKYHLTLWDYPTMNPVAILK 541

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 94/215 (43%), Gaps = 17/215 (7%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           H+  V   R+ P    I A+ S   T  ++D   E +   +  + H    + LAF     
Sbjct: 264 HERRVAGCRFHPFGRYI-ASASFDNTWRLWD--AETNHELLLQEGHGKEVFCLAFQS--D 318

Query: 190 GHLL-SGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW--HNFQKSLFGTVSEDSS 246
           G LL S   D    +WD+ S     V    + H+  +    W    F+     T S D +
Sbjct: 319 GSLLCSAGLDCTGMIWDIRSGNCAMVL---SGHTKPIYSVDWSPRGFE---VATASGDGT 372

Query: 247 LQIHDTRES-KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMS 305
           + I D R++ +P   +      + + F  H+   L + G +  + +Y      + + ++ 
Sbjct: 373 VNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNK-ITILK 431

Query: 306 GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
           GHTD + +LD  +  DG ++SAG D+ V  W++++
Sbjct: 432 GHTDKILALDLGTH-DGSVVSAGWDRSVKSWNVDN 465

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 20/178 (11%)

Query: 218 ENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR--ESKPVATINGTKPFNTLSFSHH 275
           EN H+  V +  W N    L  T  ED  +++   +  E + VA + G +        H 
Sbjct: 217 ENAHTGKVGEVDW-NSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHP 275

Query: 276 SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
               +A+   ++   L+D     E L L  GH   V  L F S D  ++ SAG D   +I
Sbjct: 276 FGRYIASASFDNTWRLWDAETNHELL-LQEGHGKEVFCLAFQS-DGSLLCSAGLDCTGMI 333

Query: 336 WDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
           WDI               +    M+ +GH  PI     +P   + VA+A  +  V +W
Sbjct: 334 WDIR--------------SGNCAMVLSGHTKPIYSVDWSPR-GFEVATASGDGTVNIW 376

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 6/157 (3%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           L +G +D  V L+ V S     V   +  H   V  C++H F + +  + S D++ ++ D
Sbjct: 236 LATGGEDGLVKLFTVQSGELRQVADLQG-HERRVAGCRFHPFGRYI-ASASFDNTWRLWD 293

Query: 252 TRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
              +  +    G  K    L+F     +LL + G++    ++D R     + ++SGHT  
Sbjct: 294 AETNHELLLQEGHGKEVFCLAFQSDG-SLLCSAGLDCTGMIWDIRSGNCAM-VLSGHTKP 351

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           + S+D+S +   +  ++G D  V IWDI      QVL
Sbjct: 352 IYSVDWSPRGFEVATASG-DGTVNIWDIRKTNQPQVL 387

>Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364C
           (CDC40) - Member of the beta transducin family [contig
           130] FULL
          Length = 503

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 97/220 (44%), Gaps = 12/220 (5%)

Query: 124 VTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA 183
           + R ++  S+  R      + +   ++S    + I+D     +T  +  QY        A
Sbjct: 246 LLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDT----ETGKVRHQYSYSCIPNCA 301

Query: 184 -FNPLIKGHLLSGSDDSNVALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
            F P      + G  +S +  +D+ TS +N  VQ +++  S I+    + +  K  F + 
Sbjct: 302 EFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSK--FVSS 359

Query: 242 SEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSE-NLLATGGVNSEVYLYDR--RYVE 298
           SED S++I + + + P+  I+ T  ++      H E N  A   +++ +Y +    +Y  
Sbjct: 360 SEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHPEQNYFAAQSMDNAIYAFSMKPKYKR 419

Query: 299 EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADK-RVIIWD 337
            P    SGH  A   + F    DG  +++G  + RV IWD
Sbjct: 420 HPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWD 459

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 77/170 (45%), Gaps = 11/170 (6%)

Query: 175 HTDNGYGLAFNPLI----KGHL-LSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229
           HT  G+    N ++     GHL LS  +D+ V +WD+  DR E ++ +   HS  V    
Sbjct: 204 HTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDR-ELLRDYRG-HSKAVRGIS 261

Query: 230 WHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEV 289
           + N + S F +VS D  ++I DT   K     + +   N   F   + N    G  NSE+
Sbjct: 262 F-NSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEI 320

Query: 290 YLYDRRYVEEP--LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
             YD R   +   + +   H  ++ +L +   D    +S+  DK + IW+
Sbjct: 321 RHYDLRTSHKNGLVQVYDHHLSSIIALKYFP-DGSKFVSSSEDKSMRIWE 369

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 94/205 (45%), Gaps = 23/205 (11%)

Query: 154 GTVYIYDRSNERDT-ASIT-LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV----- 206
           G V ++ ++N +DT  SI  L  H  +   + FN   +  L SGS +  + +WD+     
Sbjct: 84  GMVELF-KTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCID 142

Query: 207 -TSDRNEPVQKWENIHS-DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT 264
            ++D   P+     +   + +    W+     +F +    S   I D +  K V  ++ T
Sbjct: 143 QSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIHLSYT 202

Query: 265 KPFNTLS-----FSHHSEN--LLATGGVNSE----VYLYDRRYVEEPLHLM-SGHTDAVT 312
            P ++L         H EN   +AT   NS+    + ++D R    PL ++ +G++  + 
Sbjct: 203 SPSSSLKPQLSVVEWHPENSTRVATAS-NSDNEPIILIWDLRNANTPLQILENGNSKGIL 261

Query: 313 SLDFSSQDDGIILSAGADKRVIIWD 337
           SLD+   D  ++LS+G D   ++W+
Sbjct: 262 SLDWCKHDSNLLLSSGRDNTAVLWN 286

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 82/173 (47%), Gaps = 22/173 (12%)

Query: 239 GTV----SEDSSLQI---HDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNS---E 288
           GTV    S DS+L++     T +  PV ++     FN + +S   +N    G +++   E
Sbjct: 30  GTVDADFSSDSTLELWSLLSTDKLNPVVSVEANAKFNDIDWSI--DNKYIAGALDNGMVE 87

Query: 289 VYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLE 348
           ++  + +   + +  +S H  +VT+++F+++ + ++ S   +  + IWD+N     + ++
Sbjct: 88  LFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLN-----KCID 142

Query: 349 DAEDATSEVMMIHAGHRSP---INDFAINPSIPWLVASAEEENIVQLWKCSHK 398
            + D+ S +    A   +P   I   A N S+  + ASA   +   +W    K
Sbjct: 143 QSNDSYSPLTPGMA--MTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAK 193

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 96/214 (44%), Gaps = 24/214 (11%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
           +A +P+      +GS+DS + +WD  S +   ++   + H   V D         +F + 
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGK---LKLTLSGHVMGVRDLVVSKRHPYMF-SA 169

Query: 242 SEDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           SED  ++  D  ++ P+    G     +T+   H + +L+A+ G +S V L+D R  +  
Sbjct: 170 SEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDI-HPTLSLIASAGRDSVVKLWDIRSKKAV 228

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           + L+ GH   + S+  +  D  II S   D  VI WD+                ++ M +
Sbjct: 229 ITLV-GHKSPINSVKCTPADPQII-SCSNDTTVITWDL--------------VAAKPMKV 272

Query: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              HR  + D A++P   + VAS    N ++ WK
Sbjct: 273 ITHHRKAVRDIAVHPG-EFSVASC-STNDIRSWK 304

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 19/120 (15%)

Query: 280 LATGGVNSEVYLYDRRYVEEPLHL-MSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
            ATG  +S + ++D  +    L L +SGH   V  L   S+    + SA  DK V  WD+
Sbjct: 124 FATGSNDSTIKVWD--FASGKLKLTLSGHVMGVRDL-VVSKRHPYMFSASEDKLVKCWDL 180

Query: 339 NDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
                           +  +  + GH S ++   I+P++  L+ASA  +++V+LW    K
Sbjct: 181 E--------------KNAPIRDYFGHLSGVHTVDIHPTLS-LIASAGRDSVVKLWDIRSK 225

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 86/214 (40%), Gaps = 46/214 (21%)

Query: 143 DPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLI---------KGHLL 193
           D N +A+ SG G +  +D S+    AS    Y T  G  L   P +         +  +L
Sbjct: 79  DLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITG--LCITPKVNIDSASSGNQNFVL 136

Query: 194 SGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR 253
           S SDD  V LW V              H D              F  V  D   Q+ +T 
Sbjct: 137 SSSDDKTVKLWSVN-------------HED--------------FAHVDND---QVINT- 165

Query: 254 ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
           ++  +    G   F  L  S  + N + TGG    ++  +R    +PL  +S   D + +
Sbjct: 166 DNGLIKHYYGEHAFQGLDHSRMTSNFV-TGGPRINLWDINR---SKPLSDLSWGADNINT 221

Query: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           + F+  D  ++ SAG+D  ++++D+    A Q +
Sbjct: 222 VKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKI 255

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWD  S+R+ P+    W    +D +   +++  +  +F +   D+S+ ++D R + 
Sbjct: 193 AQIQLWD--SNRSTPLSNLSW---GADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNS 247

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N + ++         G  +   Y YD R +   +++   H  AV  +DF
Sbjct: 248 PTQKIVQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDF 307

Query: 317 SSQDDGIILSAGADKRVIIWDIN 339
           S   D I+ +   DK + I+  N
Sbjct: 308 SPTGDEIV-TGSYDKTIRIFKTN 329

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 85/183 (46%), Gaps = 24/183 (13%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW---- 230
           H D  Y +A N      L +GS D  +  W++++ R+E V  ++  +  I   C      
Sbjct: 66  HRDGVYVIAKNYRNLNKLATGSADGVIKYWNMST-RDE-VCSFKAHYGLITGLCVTPEHL 123

Query: 231 -HNFQKSLFGTVSEDSSLQI--------HDTRESKPVATING-TKPFNT-LSFS----HH 275
             N   +   + S+D ++++         + ++ + + T +G  K F + ++F     H 
Sbjct: 124 SKNKNDNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDHHR 183

Query: 276 SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
           S +   TGG   +++  +R     PL  +S   D +T++ F+  +  I  SAG+D  +++
Sbjct: 184 SNSNFVTGGAQIQLWDSNR---STPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVL 240

Query: 336 WDI 338
           +D+
Sbjct: 241 YDL 243

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 81/173 (46%), Gaps = 15/173 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    L+ N   +  L S S D  V LWD+ S      +   +IH++  V+  QWH+
Sbjct: 287 HHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNS--GNAARSMASIHNNKNVSSSQWHH 344

Query: 233 FQKSLFGTVSEDSSLQIHDTR-----ESKPVATINGTKPFNTLSFSHHSENLLATGGVNS 287
              S+  T   DS + + D R     E     +++  +   T+ F+   EN++  G  + 
Sbjct: 345 GNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENIILAGTDSG 402

Query: 288 EVYLYDRR--YVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA--DKRVIIW 336
            +Y +D R     +P+  +  H   ++SL  ++   G ++S GA  +K V +W
Sbjct: 403 NIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPG-LMSTGAMGEKAVKLW 454

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           H+ S HTDAV SL  +     ++ S  AD  V +WD+N   A + +
Sbjct: 283 HITSHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSM 328

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 97/218 (44%), Gaps = 29/218 (13%)

Query: 192 LLSGSDDSNVALWDVTSDRNE---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           L+S S D  +  W +T D  +   PV+ ++  H+ IV DC       +   + S D +L+
Sbjct: 32  LVSASRDKTLISWKLTGDDQQYGVPVRSFKG-HNHIVQDCA-LTADGAYALSASWDKTLR 89

Query: 249 IHDTRESKPVATINGTKPFNTLSFS-HHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
           + +    +      G K  + +S +     +++ +G  +  + ++  +   + L  + GH
Sbjct: 90  LWNVATGETYQRFTGHKS-DVMSVAIDRKASMIISGSRDKTIKVWSIK--GDCLATLLGH 146

Query: 308 TDAVTSLDFS----SQDDGI-ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHA 362
            D V+ +  +     +DD + ++SAG+DK V  W+IN     Q+  D             
Sbjct: 147 NDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQF---QIEAD-----------FV 192

Query: 363 GHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLP 400
           GH + IN    +P    LVASA ++  + LW    K P
Sbjct: 193 GHNNYINSITASPDGS-LVASAGKDGDIMLWNLKQKTP 229

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 91/208 (43%), Gaps = 27/208 (12%)

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           P +   LAT S  GT+ I+D +  R   ++TL  HT +   + +    +  L SGS D  
Sbjct: 242 PGERPRLATSSKDGTIKIWDTT--RRVCTMTLSGHTSSVSCVKWGG--QNFLYSGSHDKT 297

Query: 201 VALWDV-TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI--HDTRESKP 257
           V +WD+  S R   + K         N   W N       ++S D +L++   D    +P
Sbjct: 298 VRVWDMKNSGRCINILK---------NHAHWVNHL-----SLSTDYALRVGPFDYTGEQP 343

Query: 258 ----VATINGTKPFNTLSFSHHSEN-LLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVT 312
               +A     K +  ++  +  E  L+ T   +  ++L+D     +P+  M+GH   V 
Sbjct: 344 ATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVN 403

Query: 313 SLDFSSQDDGIILSAGADKRVIIWDIND 340
            + F S D   I+SA  D  + +WD  D
Sbjct: 404 HVAF-SPDGRHIVSASFDNSIKLWDSRD 430

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 84/197 (42%), Gaps = 16/197 (8%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           H S +  + + P   + + T +G  T  I+D   +  T   TL  H +    ++++P   
Sbjct: 139 HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQ--TPMATLTGHHNWVLCVSWSP--D 194

Query: 190 GHLLS-GSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNF------QKSLFGTVS 242
           G L++ GS D+ V LW+  S   +P       H   +    W         ++    T S
Sbjct: 195 GELIATGSMDNTVRLWE--SKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSS 252

Query: 243 EDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPL 301
           +D +++I DT       T++G T   + + +    +N L +G  +  V ++D +     +
Sbjct: 253 KDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDKTVRVWDMKNSGRCI 310

Query: 302 HLMSGHTDAVTSLDFSS 318
           +++  H   V  L  S+
Sbjct: 311 NILKNHAHWVNHLSLST 327

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 72/146 (49%), Gaps = 7/146 (4%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           +++ SDD  + LWD      +P+ +    H  +VN   +    + +  + S D+S+++ D
Sbjct: 371 MVTASDDFTMFLWDPLRT-TKPIARMTG-HQKLVNHVAFSPDGRHIV-SASFDNSIKLWD 427

Query: 252 TRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
           +R+ K + T  G       +++S     LL +   ++ + ++D R  +  + L  GH D 
Sbjct: 428 SRDGKFITTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDIRTRKLSVDL-PGHKDE 485

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIW 336
           V ++D+S  D   + S G DK V IW
Sbjct: 486 VYTVDWSV-DGKRVCSGGKDKMVRIW 510

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 13/173 (7%)

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           HL  G  +  V ++D+   +     +  + HSD V+   W+N    +  + S D  +   
Sbjct: 381 HLAVGQSNGLVEIYDIIKRK---CIRTLSGHSDRVSCLSWNNH---ILSSGSRDRKILHR 434

Query: 251 DTRESKPVATINGTKPFNTLSFSHHSE-NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTD 309
           D R      T   T          + E N LA+GG ++ VY+YD     +P  + + HT 
Sbjct: 435 DVRSPDSYFTQIETHTQEVCGLKWNIEDNRLASGGNDNIVYVYD-GVNSKPTLMFTEHTA 493

Query: 310 AVTSLDFSSQDDGIILSAG--ADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           AV ++ +S    GI+ + G  AD+R+ IW++N       L D +  +    MI
Sbjct: 494 AVKAMTWSPHRRGILATGGGTADRRLKIWNVN---TSAKLNDVDSGSQICNMI 543

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 87/239 (36%), Gaps = 58/239 (24%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA     G V IYD    +     TL  H+D    L++N  I   L SGS D  +   DV
Sbjct: 382 LAVGQSNGLVEIYDIIKRK--CIRTLSGHSDRVSCLSWNNHI---LSSGSRDRKILHRDV 436

Query: 207 TSDRNEPVQKWENI--HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATIN-G 263
            S    P   +  I  H+  V   +W N + +   +   D+ + ++D   SKP       
Sbjct: 437 RS----PDSYFTQIETHTQEVCGLKW-NIEDNRLASGGNDNIVYVYDGVNSKPTLMFTEH 491

Query: 264 TKPFNTLSFSHHSENLLATGG-----------VNSEVYLYD------------------- 293
           T     +++S H   +LATGG           VN+   L D                   
Sbjct: 492 TAAVKAMTWSPHRRGILATGGGTADRRLKIWNVNTSAKLNDVDSGSQICNMIWSKNTDEI 551

Query: 294 ------RRY--------VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
                  RY          EP+ +  GH+  V  L   S+D   ++S   D+ +  W I
Sbjct: 552 VTSHGYSRYNLTLWNYPTLEPVAIFKGHSFRVLHLTL-SEDGTTVVSGAGDETLRYWKI 609

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 78/185 (42%), Gaps = 23/185 (12%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           ++S S D+   +WD+ S      Q     H   V D ++      LF +   D S+++ D
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA--HDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 252 TRE-----------SKPVA---------TINGTKPFNTLSFSHHSENLLATGGVNS-EVY 290
            R            S P +         ++ G+     L  S +  N+LAT   +S ++ 
Sbjct: 317 LRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKII 376

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDA 350
           + D R  E P+  + GHT +V  + +      ++LS   D + + WD+N+   E    D+
Sbjct: 377 ILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGSDS 436

Query: 351 EDATS 355
           +  T+
Sbjct: 437 KSPTA 441

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 124 VTRKFKHDSEVTRARYMPQDPNILATISG-TGTVYIYDRSNERDTASITLQYHTDNGYGL 182
            T   K    + R    P DPN+LAT +  +  + I D  N  ++  + L+ HT +   +
Sbjct: 342 TTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNP-ESPILNLEGHTCSVNEI 400

Query: 183 AFNPLIKGHLLSGSDDSNVALWDV 206
            ++P  +  LLS SDD     WD+
Sbjct: 401 KWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 65/161 (40%), Gaps = 28/161 (17%)

Query: 125 TRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAF 184
           T+   HDSEV   R++ +   + A+  G G+V ++D    R  A  T+ Y   +      
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDL---RSLAHSTIIYEPPSSPASGP 337

Query: 185 NPLIKGHLLSGSD----------DSNVALWDVTSDRNE-----------PVQKWENIHSD 223
           N       L GSD          D NV L    +D N+           P+   E  H+ 
Sbjct: 338 NAGATTPSLKGSDALLRLEPSPYDPNV-LATFAADSNKIIILDMRNPESPILNLEG-HTC 395

Query: 224 IVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGT 264
            VN+ +WH  ++++  + S+D      D   S     ING+
Sbjct: 396 SVNEIKWHPTKRNVLLSCSDDCQALYWDLNNS--FMEINGS 434

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 116/304 (38%), Gaps = 32/304 (10%)

Query: 46  MMYDFVSETRLVWPSLTVQWLP---HSAPNPVTRQELILGTHTSDE----EQNYLKIAVV 98
           + +D V+E  + +P  T+QW P   H          L + +   +E    EQ  L +   
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFCEEERNLQEQINLSLCKY 209

Query: 99  DLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHD-SEVTRARYMPQDPNILATISGTGTVY 157
           D   +     N        +R+N +  +    +   +T   + P DPN+L + S   T  
Sbjct: 210 DKQQQGASRVNAAAGGSGSIRTNPQQQQGLIGELPPITSFHWNPVDPNLLISSSIDTTCI 269

Query: 158 IYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKW 217
           ++D  +  +     L  H    Y + F         S   D +V ++D+           
Sbjct: 270 VWDLQSS-NYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCL-------- 320

Query: 218 ENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSE 277
              HS I+            +   S  ++LQ      S   A  +   P   L  S    
Sbjct: 321 --AHSTII------------YEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDP 366

Query: 278 NLLATGGVNS-EVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIW 336
           N++AT  ++S  V + D R    P+ ++ GH+ AV  + +      ++LS   D +V+ W
Sbjct: 367 NVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYW 426

Query: 337 DIND 340
           D+N+
Sbjct: 427 DLNN 430

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 76/173 (43%), Gaps = 13/173 (7%)

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
           HL  G  +  V ++DV   R     +    H D V    W+N    +  + S D  +   
Sbjct: 306 HLAVGQANGLVKIFDVEKKR---CIRTIPGHIDRVACLSWNNH---ILTSGSRDRRILHR 359

Query: 251 DTRESKPVATINGTKPFNTLSFSHH-SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTD 309
           D R  +P      T          +  EN LA+GG ++ V++YD     +P+  ++ HT 
Sbjct: 360 DVRTPEPCFEEIRTHKQEVCGLKWNVDENQLASGGNDNVVFVYD-GTSRKPILTLAEHTA 418

Query: 310 AVTSLDFSSQDDGIILSAG--ADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           AV ++ +S    G++ + G  ADKR+ IW++        L D + A+    MI
Sbjct: 419 AVKAMAWSPHRRGVLATGGGTADKRLKIWNVR---TSTKLHDVDTASQVCNMI 468

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 90/239 (37%), Gaps = 54/239 (22%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA     G V I+D   +R     T+  H D    L++N  I   L SGS D  +   DV
Sbjct: 307 LAVGQANGLVKIFDVEKKRCIR--TIPGHIDRVACLSWNNHI---LTSGSRDRRILHRDV 361

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATI-NGTK 265
            +   EP  +    H   V   +W N  ++   +   D+ + ++D    KP+ T+   T 
Sbjct: 362 RTP--EPCFEEIRTHKQEVCGLKW-NVDENQLASGGNDNVVFVYDGTSRKPILTLAEHTA 418

Query: 266 PFNTLSFSHHSENLLATGG-----------VNSEVYLYD-------------RRYVE--- 298
               +++S H   +LATGG           V +   L+D             R   E   
Sbjct: 419 AVKAMAWSPHRRGVLATGGGTADKRLKIWNVRTSTKLHDVDTASQVCNMIWSRNTNEIIT 478

Query: 299 -----------------EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340
                            EP+ ++ GH+  V  +  S+ D   I+S   D+ +  W + D
Sbjct: 479 SHGYSKYNLTLWDGVNAEPIAILKGHSFRVLHMTLSA-DGTTIVSGAGDETLRYWKLFD 536

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 117/283 (41%), Gaps = 44/283 (15%)

Query: 136 RARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSG 195
           R+     D   LAT +    + I+D + ++    +TLQ H  + Y L + P     L+SG
Sbjct: 356 RSVCFSPDGKYLATGAEDKLIRIWDLTTKK--ILMTLQGHEQDIYSLDYFP-AGDKLVSG 412

Query: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES 255
           S D  V +WD+ + +       E    D V                S D ++++ D+   
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSIE----DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 256 KPVATINGTKPFNT--------LSFSHHSENLLATGGVNSEVYLYDRRYVE-EPLHLM-- 304
             V  ++     +T        + F+   + ++ +G ++  V L+D R +  +  H    
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVI-SGSLDRSVKLWDLRGLNGQKSHATCE 527

Query: 305 ---SGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIH 361
              +GH D V S+  ++QDD  ILS   D+ V+ WD               A+   +++ 
Sbjct: 528 VTYTGHKDFVLSV-ATTQDDEYILSGSKDRGVLFWDT--------------ASGNPLLML 572

Query: 362 AGHRSP------INDFAINPSIPWLVASAEEENIVQLWKCSHK 398
            GHR+       +N F + P +  + A+   +   ++WK + K
Sbjct: 573 QGHRNSVISVAVVNGFPLGPDV-GVFATGSGDCKARIWKYTKK 614

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 73/153 (47%), Gaps = 10/153 (6%)

Query: 190 GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI 249
           G ++SGS D+ + LWD  + RN  V     +   ++   ++   Q +L   VS+D S++I
Sbjct: 218 GLIVSGSKDNLIKLWDPRTGRN--VSTILGLKHTVIK-TKFQPTQGNLLAVVSKDKSIKI 274

Query: 250 HDTRES-KPVATINGTKPFNTLSFSHHSENLLATGGVNSEV----YLYDRRYVEEPLHLM 304
           +D R+  + + TI     + +LS+   +E + + G  N  +     L+D        H +
Sbjct: 275 YDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTI 334

Query: 305 S-GHTDAVTSLDFSSQDDGIILSAGADKRVIIW 336
              H  +VTSL +S     I+ SA  D+ +  W
Sbjct: 335 PYAHEKSVTSLAYSPVGH-ILASAAKDRTIRFW 366

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 80/178 (44%), Gaps = 41/178 (23%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ--WHNFQKSL-------FGTV- 241
           L++GS D+ + LW++        Q +   ++DI N  Q   H F   L       + T+ 
Sbjct: 461 LITGSKDATIKLWNL----KLASQLYLEENADIGNSNQSCIHTFSSHLDELTAISYDTIN 516

Query: 242 ----SEDSSLQIHDTRESKPVATIN-----------------GTKPFNTLSFSHHSENLL 280
               S+D +++  D    K V TI+                 G KP   +      +  L
Sbjct: 517 LVSGSQDKTIRQWDLLSGKCVQTIDLSFIKSRNNDFYSNQLLGEKPL--VGAIQCFDAAL 574

Query: 281 ATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           ATG  +  V L+D R    P+  + GHTDAVT+L F   D   I++A +DK+V IWD+
Sbjct: 575 ATGTKDGIVRLWDLRS-GVPVRTLEGHTDAVTALKF---DSSSIVTASSDKQVRIWDL 628

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWD  S+R++P+    W    +D +   +++  +  +  +   D+++ ++D R + 
Sbjct: 192 AQIHLWD--SNRSKPISNLSWG---ADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNS 246

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N + ++            +   Y YD R +   LH+   H  AV  +DF
Sbjct: 247 PTQKIIQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDF 306

Query: 317 SSQDDGIILSAGADKRVIIWDINDIGAEQV 346
           S   D I+ +   DK + I+  N   A +V
Sbjct: 307 SPTGDEIV-TGSYDKTIRIFKTNHGHAREV 335

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 37/189 (19%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC------ 228
           H D  Y +A N      L SGS D  +  W++ S R E V  ++  +  +   C      
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNM-STREEFVS-FKAHYGLVTGLCVTPEHT 123

Query: 229 ---QWHNFQKSL---------------FGTVSEDSSLQIHDTRESKPVATINGTKPFNTL 270
              +  NF  S                F  V  D+ L          + T  G   F  +
Sbjct: 124 SKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGL-----LKTFYGEHAFQGI 178

Query: 271 SFSHHSE-NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329
              HH E +   TGG  ++++L+D     +P+  +S   D +TS+ F+  +  I+ S G+
Sbjct: 179 --DHHREASTFVTGG--AQIHLWDSNR-SKPISNLSWGADNITSVKFNQNEVDILASTGS 233

Query: 330 DKRVIIWDI 338
           D  ++++D+
Sbjct: 234 DNAIVLYDL 242

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 7/101 (6%)

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS------SQDDG 322
           T++ ++++ N LA+G  +  +  ++    EE +     H   VT L  +      ++++ 
Sbjct: 72  TIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSF-KAHYGLVTGLCVTPEHTSKNKNEN 130

Query: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAG 363
            +LS G DK V +W +N+     V  DAE  T  ++    G
Sbjct: 131 FMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYG 171

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 23/169 (13%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           ++S S D+   +WD+ S      Q     H   V D ++      LF +   D S+++ D
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIA--HDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 252 TRE--------SKPVATINGTKPFNTLSFSHHSE------------NLLATGGVNS-EVY 290
            R           P ++++G         S  S+            N+LAT   +S ++ 
Sbjct: 317 LRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKII 376

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           + D R  E P+  + GH  +V  + +      ++LS G D +V+ WD+N
Sbjct: 377 ILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLN 425

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 5/108 (4%)

Query: 124 VTRKFKHDSEVTRARYMPQDPNILATISG-TGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           +T   K    + R    P DPN+LAT +  +  + I D  N  ++  + LQ H  +  G+
Sbjct: 342 ITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNP-ESPILNLQGHGSSVNGI 400

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTS---DRNEPVQKWENIHSDIVND 227
            ++P  +  LLS  DD  V  WD+ S   + N    K  +IH   + D
Sbjct: 401 KWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSPSIHGTSLED 448

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 125 TRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYD 160
           T+   HDSEV   R++ +   + A+  G G+V ++D
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 99/226 (43%), Gaps = 15/226 (6%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEP 213
           G + IYD  +E    ++ + Y  D  +           + S S D    L D    +  P
Sbjct: 243 GRIVIYDSGDE---TTVKILYKNDARFAQVRCHPCNSFIGSTSFDKTWILIDTV--KQAP 297

Query: 214 VQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING-TKPFNTLSF 272
           +   E  HS  V    +HN   SL  T   D+   I D R  K + ++ G +KP  ++ +
Sbjct: 298 ILIQEG-HSAEVFSLSFHN-DGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDW 355

Query: 273 SHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKR 332
           S +   L A+G  +  + ++D R  +  +  +  H   V+ + F+ Q+ G ++S+G DK+
Sbjct: 356 SQNGYQL-ASGSGDGTIKVWDIRK-KGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKK 413

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMI-----HAGHRSPINDFAI 373
           V I++  +   E+ LE   D    + ++      AG    +N + +
Sbjct: 414 VNIFNDGNWIKERSLEGHLDKVMSIDIVGPDIYSAGWDRSVNKWGV 459

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 74/168 (44%), Gaps = 31/168 (18%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW 230
           T + HTD    L+ +P     L+SGS D  +  WD+ S +   +Q  +   ++++     
Sbjct: 497 TFEAHTDEVTALSLDP---SFLVSGSQDRTIRQWDLRSGK--CLQTIDLSFANVLTTSTN 551

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVY 290
            +  KS   T            R  +P  +I   + F+           LATG  +  V 
Sbjct: 552 VDLSKSTLLT-----------QRNERP--SIGALQSFDAA---------LATGTKDGVVR 589

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           L+D R   + +  + GHTDA+TSL F   D   +++   D+ V IWD+
Sbjct: 590 LWDLR-SGKVIRTLKGHTDAITSLKF---DSACLVTGSYDRTVRIWDL 633

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 37/94 (39%), Gaps = 21/94 (22%)

Query: 303 LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI---NDIGAEQVLEDAEDATSEVMM 359
           +MS H D +T LDF +    +  +   D  V IWD+   N IG                 
Sbjct: 393 IMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGE---------------- 436

Query: 360 IHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
             AGH + IN   IN     LV    +   ++LW
Sbjct: 437 -LAGHLATINCMQINRDYGTLVTGGRDA-ALKLW 468

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 49/95 (51%), Gaps = 12/95 (12%)

Query: 304 MSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHA- 362
           ++GH   +  +  + +D G +++ G D  + +W++N   A+Q+ ++ ++ TS    I + 
Sbjct: 437 LAGHLATINCMQIN-RDYGTLVTGGRDAALKLWNLN--LAQQLYQETQNLTSPTNHIDSP 493

Query: 363 ------GHRSPINDFAINPSIPWLVASAEEENIVQ 391
                  H   +   +++PS  +LV+ +++  I Q
Sbjct: 494 CVHTFEAHTDEVTALSLDPS--FLVSGSQDRTIRQ 526

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 274 HHSENLLATGGVNSEVYLYDRRY---VEEPL-HLMSGHTDAVTSLDFSSQDDGIILSAGA 329
           H+  N++A    ++++ LYD       E+P+  ++SGHT A+ S DF+     +I+S G 
Sbjct: 246 HNYSNVIAICNNSTDISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQ 305

Query: 330 DKRVIIWDI 338
           D  V +WDI
Sbjct: 306 DGCVKVWDI 314

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 31/185 (16%)

Query: 145 NILATISGTGTVYIYD--RSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNV 201
           N++A  + +  + +YD  R+   +   I  L  HT       FN      ++SG  D  V
Sbjct: 250 NVIAICNNSTDISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGCV 309

Query: 202 ALWDVTSDRNEPVQKWE-NIHS--DIVNDCQW---HNFQ--------KSL--------FG 239
            +WD+ SD  +   + + NI +  D + D +W   HNF         KSL        F 
Sbjct: 310 KVWDIRSDSMKRQGRSDLNIKTANDSIRDVKWMPSHNFASLPSSADGKSLNISSPGYTFA 369

Query: 240 TVSEDSSLQIHDTRESKPV-ATING-TKPFNTLSFSHHSENLLATGGVNSEV---YLYDR 294
           ++ +   L  +D R++  V   IN  + P   L++ H  ++ +ATGG + +    Y+ DR
Sbjct: 370 SIHDTGVLLKYDLRQTTQVDKKINAHSGPGLCLNW-HPHQDYIATGGRDGKCSLWYVGDR 428

Query: 295 RYVEE 299
           R  ++
Sbjct: 429 RSTDQ 433

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 4/138 (2%)

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVAT 260
           + LWD T  R      W    +D V+  +++  +  +F +   D+S+ ++D R + P   
Sbjct: 196 INLWDSTRSRPITNLSWG---ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQK 252

Query: 261 INGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQD 320
                  N L ++            +   Y YD R +   LH+   H  AV  +DFS   
Sbjct: 253 FVQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTG 312

Query: 321 DGIILSAGADKRVIIWDI 338
           D I+ +   DK + I+ +
Sbjct: 313 DEIV-TGSYDKTIRIYQV 329

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 29/186 (15%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDC------ 228
           H D  Y +A N  +   L + S D  V  W++++   E V  ++  +  I   C      
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNMST--REEVCSFKAHYGLIHGLCVTPQHL 123

Query: 229 ---QWHNFQKS--------LFGTVSEDSSLQIHDTRESKP----VATINGTKPFNTLSFS 273
              +  N+  S        L+   ++D S +  D    K     + T +G   F  L   
Sbjct: 124 SQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAF--LGID 181

Query: 274 HHSENL-LATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKR 332
           HH  N    TGG  +E+ L+D      P+  +S   D V+++ F+  +  I  SAG+D  
Sbjct: 182 HHRSNSNFVTGG--AEINLWDSTR-SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNS 238

Query: 333 VIIWDI 338
           V+++D+
Sbjct: 239 VVLYDL 244

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 87/183 (47%), Gaps = 19/183 (10%)

Query: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-- 224
            + I   +     +     PL K  +L+   +  V L D  S  N+ + K+++  + I  
Sbjct: 4   CSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKS--NKSINKFKSDETAINA 61

Query: 225 --VNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATING--TKPFNTLSFSHHSENLL 280
             + +  WHN  ++ F T S   ++++ D R +  + TI+     PF +L   +   + +
Sbjct: 62  LQIVNTDWHN--ETRFITASM-HAVKLFDVRSNACIGTIHNEVGAPFLSLDSRY---DKI 115

Query: 281 ATG----GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335
           A G    GV+++++++D R ++ P   L+  H D +TS+ F   D  ++LS   D    I
Sbjct: 116 ACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNI 175

Query: 336 WDI 338
           +D+
Sbjct: 176 YDL 178

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 95/222 (42%), Gaps = 15/222 (6%)

Query: 123 RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           +V + F    +V  +     D  +L     TG V ++D  N R T  +++   T   +  
Sbjct: 72  QVVKTFSRFKDVVYSASFRNDGKLLVAGDATGLVSVFDSYNPR-TLLLSINVSTHPVHVT 130

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
            F+      L++ SDD    LWD+ S   EP  +     SD V    +      L  T S
Sbjct: 131 KFHSQDSKTLVTASDDRVTRLWDI-SYAYEPSLELTGA-SDYVRTLTFIPSAPHLVATGS 188

Query: 243 EDSSLQIHDTRE--SKPVATINGTKPF-NTLSFSHHSENLLATGGVNSEVYLYDRRYVEE 299
            D  ++++DTR   S+PV ++N  +P  N L+ S     L++ GG N +V+        +
Sbjct: 189 YDGIVRLYDTRNSGSEPVFSLNHEQPLENILAIS--PTQLISAGGNNFKVWDLTS---NK 243

Query: 300 PLHLMSGHTDAVTSLDFSSQDDG----IILSAGADKRVIIWD 337
            LH        VT LD+    D      ++++  D  V ++D
Sbjct: 244 KLHERGNFNKTVTCLDYVENFDAPSQCALIASSLDGHVKVFD 285

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 11/170 (6%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
           +AFNP    H  + +  + V ++   S R   V K  +   D+V    + N  K L   V
Sbjct: 45  IAFNPQ-HTHDFAVTSSTRVQIF---SSRTRQVVKTFSRFKDVVYSASFRNDGKLL---V 97

Query: 242 SEDSS--LQIHDTRESKPVA-TIN-GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYV 297
           + D++  + + D+   + +  +IN  T P +   F       L T   +    L+D  Y 
Sbjct: 98  AGDATGLVSVFDSYNPRTLLLSINVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDISYA 157

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
            EP   ++G +D V +L F      ++ +   D  V ++D  + G+E V 
Sbjct: 158 YEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPVF 207

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 6/165 (3%)

Query: 175 HTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQ 234
           H +    L F P     LLSG +D+ + LWD   +R E ++ +E  HS  + D  + +  
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHER-ELLRTYEG-HSMTIKDLNFTDNG 191

Query: 235 KSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDR 294
            S F + S D  ++I +T +      +      N ++F    +N L  G  NSE+  YD 
Sbjct: 192 HS-FASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYDL 250

Query: 295 RYVEE--PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           R  E    +     H  ++ +L +   D   ++S+  DK V IW+
Sbjct: 251 RLSENHGEVQKYDHHQGSILALKYFP-DGKKLISSSEDKTVRIWE 294

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/312 (19%), Positives = 124/312 (39%), Gaps = 53/312 (16%)

Query: 74  VTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSE 133
           V  Q L         E++YL   ++  P ++                  ++   + H + 
Sbjct: 78  VASQSLERTKFVGSTEKDYLGRCILHPPVDIPLEFKKEPLSFRCFLPKTKIAEYYGHKNG 137

Query: 134 VTRARYMPQDPNILATISGTGTVYIYDRSNERDTA------SITLQ--YHTDNGYGLA-- 183
            T  R++P+  ++L +      + ++D  +ER+        S+T++    TDNG+  A  
Sbjct: 138 TTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASA 197

Query: 184 ------------------------------FNPLIKGHLLSGSDDSNVALWDVT-SDRNE 212
                                         F+P  K  L+ G  +S +  +D+  S+ + 
Sbjct: 198 SFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYDLRLSENHG 257

Query: 213 PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK----PFN 268
            VQK+++    I+    + + +K +  + SED +++I + R + P+  I+GT     P+ 
Sbjct: 258 EVQKYDHHQGSILALKYFPDGKKLI--SSSEDKTVRIWENRINIPIKQISGTAQHSMPWI 315

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDR--RYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326
            ++    S     T  +++ +Y Y    +Y   P     GH      + F+   DG  ++
Sbjct: 316 DINPQGQS---FCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPDGQYIA 372

Query: 327 AGADK-RVIIWD 337
           +G  K +  IWD
Sbjct: 373 SGDSKGQTFIWD 384

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 14/88 (15%)

Query: 306 GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHR 365
           GH +  TSL F  +   ++LS G D  + +WD                  E++  + GH 
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYH-------------ERELLRTYEGHS 179

Query: 366 SPINDFAINPSIPWLVASAEEENIVQLW 393
             I D     +     ASA  +  V++W
Sbjct: 180 MTIKDLNFTDN-GHSFASASFDKWVKIW 206

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 126/299 (42%), Gaps = 46/299 (15%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           H S +  + + P   + + T +G  T  I+D   +  T   TL  H +    ++++P   
Sbjct: 142 HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQ--TPMTTLTGHQNWVLCVSWSP--D 197

Query: 190 GHLLS-GSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNF------QKSLFGTVS 242
           G +++ GS D+ + LW+  SDR +P+ +    H   +    W         +K    + S
Sbjct: 198 GEIIATGSMDNTIRLWE--SDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASAS 255

Query: 243 EDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPL 301
           +D +++I DT     V T++G T   + + +    + +L +G  +  V ++D     + +
Sbjct: 256 KDGTIKIWDTVRRVCVYTLSGHTNSVSCVKWG--GQGVLYSGSHDKTVRVWDMNLGGKCI 313

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAE-----DATSE 356
           +++  H   V  L  S+  D  +     D         +   E+ L++ E     + T+E
Sbjct: 314 NILKNHAHWVNHLSLST--DYALRRGPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTE 371

Query: 357 VMMIHA----------------------GHRSPINDFAINPSIPWLVASAEEENIVQLW 393
            +M+ A                      GH+  +N  A +P   ++V SA  +N ++LW
Sbjct: 372 ELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSPDGRYIV-SASFDNSIKLW 429

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 85/199 (42%), Gaps = 21/199 (10%)

Query: 147 LATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206
           LA+ S  GT+ I+D    R     TL  HT++   + +    +G L SGS D  V +WD+
Sbjct: 251 LASASKDGTIKIWD--TVRRVCVYTLSGHTNSVSCVKWGG--QGVLYSGSHDKTVRVWDM 306

Query: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQK-----SLFGTVSEDSSLQIHDTRESKPVATI 261
                    K  NI   + N   W N        +L     + +  ++    E++  A  
Sbjct: 307 NLG-----GKCINI---LKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALK 358

Query: 262 NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDD 321
           N  K    +  +  +E L+ T   +  ++L++     +PL  M+GH   V  + F S D 
Sbjct: 359 NYEK---VVKKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAF-SPDG 414

Query: 322 GIILSAGADKRVIIWDIND 340
             I+SA  D  + +WD  D
Sbjct: 415 RYIVSASFDNSIKLWDGRD 433

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWDV  +R +PV    W    +D +   +++  +  +  +   D+S+ ++D R + 
Sbjct: 199 AKIHLWDV--NRLKPVSNLSWG---ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N + ++        T   +   Y YD R +   L++   H  AV  +DF
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 317 SSQDDGIILSAGADKRVIIWDIN 339
           S   D I+ +   DK + I+  N
Sbjct: 314 SPTGDEIV-TGSYDKSIRIYKTN 335

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 81/202 (40%), Gaps = 41/202 (20%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA------FNPLIKGH--LLSGS 196
           N LAT S  G +  ++ S   +  S    Y    G  +         P +K    +LS S
Sbjct: 81  NKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHDKKPDLKNQNFMLSCS 140

Query: 197 DDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           DD  V LW +  D                            F   S   +  +  T E  
Sbjct: 141 DDKTVKLWSINVDD---------------------------FSNKSSSDNDSV--TNEEG 171

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
            V T +G   F  +  SH   +  ATGG  ++++L+D   + +P+  +S   D +TS+ F
Sbjct: 172 LVRTFDGESAFQGID-SHRENSTFATGG--AKIHLWDVNRL-KPVSNLSWGADNITSVKF 227

Query: 317 SSQDDGIILSAGADKRVIIWDI 338
           +  +  I+ S G+D  ++++D+
Sbjct: 228 NQSETDILASTGSDNSIVLYDL 249

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 94/224 (41%), Gaps = 13/224 (5%)

Query: 120 SNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNG 179
           S  +V + F    +V  +     D  +L     TG V +YD  N R T  +++   +   
Sbjct: 69  STRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPR-TLLLSINASSHPT 127

Query: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFG 239
           +   F+      L++ SDD    +WD+ S   EP  K     SD V    +      L  
Sbjct: 128 HVTKFHTQDSKTLVTASDDRITRVWDI-SHAYEPQLKLSGA-SDYVRTACFVPSAPHLVM 185

Query: 240 TVSEDSSLQIHDTRES--KPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYV 297
           T S D  L+++DTR S   PV ++N  +P   ++ S     +++ GG N +V+       
Sbjct: 186 TGSYDGFLRLYDTRASGATPVYSLNHDQPVENVT-SISPTQVVSCGGSNFKVWDLTS--- 241

Query: 298 EEPLHLMSGHTDAVTSLD----FSSQDDGIILSAGADKRVIIWD 337
            + LH        VT LD    F    +  ++++  D  V ++D
Sbjct: 242 NKKLHERGNFNKTVTCLDYVENFDCPSESALIASSLDGHVKVFD 285

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 51/135 (37%), Gaps = 26/135 (19%)

Query: 278 NLLATGGVNSEVYLYDRRYVEEPLHL---MSGHTDAVTSLDFSSQDDGIILSAGADKRVI 334
            LL  G     V +YD  Y    L L    S H   VT   F +QD   +++A  D+   
Sbjct: 94  KLLCAGDATGLVSVYDS-YNPRTLLLSINASSHPTHVT--KFHTQDSKTLVTASDDRITR 150

Query: 335 IWDINDIGAEQV-LEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
           +WDI+     Q+ L  A D       +              PS P LV +   +  ++L+
Sbjct: 151 VWDISHAYEPQLKLSGASDYVRTACFV--------------PSAPHLVMTGSYDGFLRLY 196

Query: 394 KCSHKLPRISGTPPV 408
                  R SG  PV
Sbjct: 197 DT-----RASGATPV 206

>TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.663
           YKL021C
          Length = 393

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 19/121 (15%)

Query: 276 SENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI---ILSAGADKR 332
           ++  L +G  +  + +YD +  +E L  +  H  ++T L FS  +D     + S+  DK 
Sbjct: 51  NQRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITGLKFSKTEDNKSKWLFSSSDDKN 109

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           +IIW + D               E   I  GH + INDF I+PS   +  S  E++ ++L
Sbjct: 110 IIIWRVKDW--------------ENFGILKGHMNRINDFDIHPS-NRIAVSVSEDHTIRL 154

Query: 393 W 393
           W
Sbjct: 155 W 155

>TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8.288
           YDR128W
          Length = 1134

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 68/151 (45%), Gaps = 3/151 (1%)

Query: 189 KGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           K H +  + +    +W++    ++ ++   + H   + D  +++    +  T S D+ + 
Sbjct: 81  KPHWVVSTSNQKAIIWNLARSSSDAIEHVLHKHFRAITDINFNHQHPDILATCSIDTYVH 140

Query: 249 IHDTRE-SKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSG 306
             D R  S+P  T        + + +S   +N+LA+   N EV ++D R    PL  + G
Sbjct: 141 AWDMRSPSRPFYTTREWVAGASQVKWSFKDQNVLASAHGN-EVSIWDLRKGSTPLGKLLG 199

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           H   V S+DF+   +  I++   D  V  WD
Sbjct: 200 HESGVNSIDFNRFKNDEIMTGSNDGTVKFWD 230

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 86/202 (42%), Gaps = 41/202 (20%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA------FNPLIKGH--LLSGS 196
           N LAT S  G +  ++ S   +  S    Y    G  +         P +K    +LS S
Sbjct: 81  NKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCS 140

Query: 197 DDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           DD  V LW +       V  + N +S                   S++ S+    T E  
Sbjct: 141 DDKTVKLWSIN------VDDYSNKNS-------------------SDNDSV----TNEEG 171

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
            + T +G   F  +  SH   +  ATGG  ++++L+D   + +P+  +S   D +TSL F
Sbjct: 172 LIRTFDGESAFQGID-SHRENSTFATGG--AKIHLWDVNRL-KPVSDLSWGADNITSLKF 227

Query: 317 SSQDDGIILSAGADKRVIIWDI 338
           +  +  I+ S G+D  ++++D+
Sbjct: 228 NQNETDILASTGSDNSIVLYDL 249

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 199 SNVALWDVTSDRNEPVQ--KWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWDV  +R +PV    W    +D +   +++  +  +  +   D+S+ ++D R + 
Sbjct: 199 AKIHLWDV--NRLKPVSDLSWG---ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N + ++        T   +   Y YD R +   L++   H  AV  +DF
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 317 SSQDDGIILSAGADKRVIIWDIN 339
           S   D I+ +   DK + I+  N
Sbjct: 314 SPTGDEIV-TGSYDKSIRIYKTN 335

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 25/207 (12%)

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           P D   LA+ S  GT+ I+D +  R     TL  HT++   + +    +G L SGS D  
Sbjct: 244 PGDKPRLASASKDGTIKIWDTA--RRVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKT 299

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI--HDTRESKPV 258
           +  WD+ +       K  NI   + +   W N       ++S D +L++   D    KP 
Sbjct: 300 IRAWDMNAG-----GKCINI---LKSHAHWINHL-----SLSTDYALRVGAFDHTGKKPS 346

Query: 259 ----ATINGTKPFNTLSFSHHS-ENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313
               A     + +  ++  +   E L+ T   +  +YL+D     +P+  M+GH   V  
Sbjct: 347 SPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNH 406

Query: 314 LDFSSQDDGIILSAGADKRVIIWDIND 340
           + FS  D   I+SA  D  + +WD  D
Sbjct: 407 VAFSP-DGRYIVSASFDNSIKLWDGRD 432

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 72/146 (49%), Gaps = 7/146 (4%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           +++ SDD  + LWD      +P+ +    H  +VN   +    + +  + S D+S+++ D
Sbjct: 373 MVTASDDFTMYLWDPIKS-TKPITRMTG-HQKLVNHVAFSPDGRYIV-SASFDNSIKLWD 429

Query: 252 TRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
            R+   +AT  G       +++S     LL +   ++ + ++D R  +  + L  GH D 
Sbjct: 430 GRDGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL-PGHKDE 487

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIW 336
           V ++D+S  D   + SAG DK V IW
Sbjct: 488 VYTVDWSV-DGKRVCSAGKDKMVRIW 512

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           AF P     +++G+ D+   +WD  +  N P+Q  +  H + V    W +    L  T S
Sbjct: 149 AFAPHTSSRMVTGAGDNTARIWDCNT--NTPMQTLKG-HFNWVLCVAW-SPDGELIATGS 204

Query: 243 EDSSLQIHDTRESKPVA-TING-TKPFNTLSF------SHHSENLLATGGVNSEVYLYD- 293
            D+++++  + + +     + G +K   +LS+          +  LA+   +  + ++D 
Sbjct: 205 MDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDT 264

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG 342
            RR     L  +SGHT++V+ + +  +  G++ S   DK +  WD+N  G
Sbjct: 265 ARRVC---LFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDMNAGG 309

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    L  N   +  L S S D  V LWD+ S      +   +IHS   V+  +WH 
Sbjct: 270 HHTDAVLSLTHNKQFRSVLASTSADHTVKLWDLNS--ATAARSMASIHSGKNVSSSEWHT 327

Query: 233 FQKSLFGTVSEDSSLQIHD------TRESKPVATINGTKPFNTLSFSHHSENLLATGGVN 286
              S+  T   DS + + D      T+ SK  + + G +   T++F+   EN++  G  +
Sbjct: 328 TNGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPG-EDVETVTFA--DENIMLCGTDS 384

Query: 287 SEVYLYDRRYVE--EPLHLMSGHTDAVTSLDFSSQDDGIILSAGA--DKRVIIW 336
             +Y +D R  E  +P+  +  H   ++SL  +    G ++S GA  +K V +W
Sbjct: 385 GNIYSFDIRNNENSKPVWTLKAHDAGISSLCANRYIPG-LMSTGAMGEKTVKLW 437

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           H+ + HTDAV SL  + Q   ++ S  AD  V +WD+N   A + +
Sbjct: 266 HITTHHTDAVLSLTHNKQFRSVLASTSADHTVKLWDLNSATAARSM 311

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 12/150 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNF 233
           YH  N    A + L     ++GS D+ +AL D+ + +   + +    H  +VN  Q    
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQ---LLRGLAGHRRVVN--QVRAL 109

Query: 234 QKSLFGTVSEDSSLQIHDTRESK-PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLY 292
            +S F +V +D +L++ D   +K PV       P   ++    +E+L+   G+   +  Y
Sbjct: 110 GESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIRAY 169

Query: 293 DRRYVEEPLHLMS----GHTDAVTSLDFSS 318
           D R   +  H  S     H+DAVTSLD S+
Sbjct: 170 DLRRSAD--HAFSSWPAAHSDAVTSLDVSA 197

>TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON}
           Anc_5.631 YDR267C
          Length = 386

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 60/121 (49%), Gaps = 19/121 (15%)

Query: 292 YDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAE 351
           +D +YV E L ++ GH + V S+ +S  D  ++ +   DK V IW+ ++IG E       
Sbjct: 112 HDNKYVMELLAIIEGHENEVKSVAWS-YDGSLLATCARDKSVWIWETDEIGEEY------ 164

Query: 352 DATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL-------WKCSHKLPRISG 404
               E + +   H   + +   +PS+P ++AS+  ++ +++       W+CS  L    G
Sbjct: 165 ----ECISVLQEHSQDVKNVVWHPSLP-ILASSSYDDTIRIWTDYDDDWECSAVLNGHKG 219

Query: 405 T 405
           T
Sbjct: 220 T 220

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 68/151 (45%), Gaps = 7/151 (4%)

Query: 190 GHL-LSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           GHL LSG +D+ V LWDV   R E ++ +   HS  V D  +     S F +VS D  ++
Sbjct: 182 GHLFLSGGNDNKVKLWDVYHKR-ELLRDYCG-HSKAVRDVSFSGSGTS-FLSVSYDQHMK 238

Query: 249 IHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP--LHLMSG 306
           I +T               N   FS  + N L  G  NSEV  YD R   +   + +   
Sbjct: 239 IWNTETGDIEHRYKFPAVPNCAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDH 298

Query: 307 HTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           H  ++ +L +   D    +S+  DK + IWD
Sbjct: 299 HLSSIIALKYFP-DGSKFISSSEDKSMRIWD 328

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 262 NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDD 321
           NGT     L  S H   L  +GG +++V L+D  +  E L    GH+ AV  + FS    
Sbjct: 170 NGTTTIKMLPKSGH---LFLSGGNDNKVKLWDVYHKRELLRDYCGHSKAVRDVSFSGSGT 226

Query: 322 GIILSAGADKRVIIWD 337
              LS   D+ + IW+
Sbjct: 227 S-FLSVSYDQHMKIWN 241

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 100/256 (39%), Gaps = 22/256 (8%)

Query: 96  AVVDLPTEVTDTSNLTESDEEQVR----SNIRVTRKFKHDSEVTRARYMPQDPNILATIS 151
           AV D+    + TS L+ S ++ ++        +  ++K  +    A + P + N L    
Sbjct: 215 AVRDVSFSGSGTSFLSVSYDQHMKIWNTETGDIEHRYKFPAVPNCAEFSPANSNELIVGL 274

Query: 152 GTGTVYIYD-RSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210
               V  YD R   +D       +H  +   L + P      +S S+D ++ +WD  +  
Sbjct: 275 SNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFP-DGSKFISSSEDKSMRIWD--NQV 331

Query: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNT- 269
           N P+++  +     +     H  +   F T S D+++        KP    N  K F   
Sbjct: 332 NIPIKQISDTAQYSMPFIDIHP-EHHYFATQSMDNAIYAFSM---KPKYRRNPKKRFEGH 387

Query: 270 --------LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDD 321
                     FS   +  LA+G     VY++D +      H       AV ++ ++ Q+ 
Sbjct: 388 KCAGYGIGFGFSPDGQ-YLASGDTKGRVYIWDWKTTRLLKHFEVPGKKAVITVAWAPQET 446

Query: 322 GIILSAGADKRVIIWD 337
             +L AG   R+ ++D
Sbjct: 447 SKMLCAGNGGRIFLYD 462

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/93 (18%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           +H   GH +  T++    +   + LS G D +V +WD+                 E++  
Sbjct: 162 IHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYH-------------KRELLRD 208

Query: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
           + GH   + D + + S    ++ + ++++ ++W
Sbjct: 209 YCGHSKAVRDVSFSGSGTSFLSVSYDQHM-KIW 240

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 81/200 (40%), Gaps = 41/200 (20%)

Query: 177 DNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKS 236
           D  + LA+N   +   L    D ++ L+D+   ++ P+  ++  H   V  C W+  QK 
Sbjct: 61  DGLFDLAWNESHENQCLVAQGDGSLRLFDIKL-KDYPIAIYKE-HQREVFSCNWNMIQKQ 118

Query: 237 LFGTVSEDSSLQIHDTRESKPVATI--NGTKPFNTLS----------------------- 271
           +F + S D  +++      + + T+  N T   +TLS                       
Sbjct: 119 MFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADG 178

Query: 272 ---------FSHHSENLLATGGVNSEVYLYDRRYVEE--PLHLMSGHT--DAVTSLDFSS 318
                    FS H  NL+     NS + LYD R      P H   GH   +A+T  DF+ 
Sbjct: 179 NKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTC-DFNK 237

Query: 319 QDDGIILSAGADKRVIIWDI 338
               II + G DK + +WD+
Sbjct: 238 YRPHIIATGGVDKMIKVWDL 257

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 98/216 (45%), Gaps = 29/216 (13%)

Query: 192 LLSGSDDSNVALWDVTSDRNE---PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           LLS S D  +  W +T D  +   PV+ ++  HS IV DC       +   + S D +++
Sbjct: 31  LLSASRDKTLISWKLTGDDQQYGVPVRSFKG-HSHIVQDCA-LTADGAYALSASWDKTIR 88

Query: 249 IHDTRESKPVATINGTKPFNTLSFS-HHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
           + D    +      G K  + +S +     +++ +G  +  + ++  +   E L  M GH
Sbjct: 89  LWDVSTGETFQRFVGHKG-DVMSVAIDRKASMIISGSRDKTIKVWSIK--GECLATMLGH 145

Query: 308 TDAVTSLDFSS----QDDGI-ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHA 362
            D V+ +  +     +DD + ++SAG+DK V  W++N     Q   DA+           
Sbjct: 146 NDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVN-----QFQIDAD---------FI 191

Query: 363 GHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHK 398
           GH + IN    +P    L+ASA ++  + +W  + K
Sbjct: 192 GHNNYINAIVASPDGS-LIASAGKDGEIMMWDLAQK 226

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 75/168 (44%), Gaps = 31/168 (18%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQW 230
           T + HTD    L+ +P     L+SGS D  +  WD+ S +   +Q  +   ++++     
Sbjct: 495 TFEAHTDEVTALSLDP---SFLVSGSQDRTIRQWDLRSGK--CMQTIDLSFANVLTAATN 549

Query: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVY 290
            +  KS   T            R  +P  +I   + F+           LATG  +  V 
Sbjct: 550 VDLSKSTLLT-----------QRSERP--SIGALQSFDAA---------LATGTKDGIVR 587

Query: 291 LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
           L+D R   + +  + GHTDA+TSL F S+    +++   D+ V +WD+
Sbjct: 588 LWDLR-SGKVIRTLKGHTDAITSLKFGSE---CLVTGSYDRTVRVWDL 631

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 96/226 (42%), Gaps = 38/226 (16%)

Query: 185 NPLIKG---HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQK------ 235
           N +++G    L++ S+D  V  W V    NE +     I     ++  +H   K      
Sbjct: 437 NVMLRGWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQ---SEYTFHVHAKDINALS 493

Query: 236 -----SLFGTVSEDSSLQIHDTRESKPVATINGTK-PFNTLSFSHHSENLLATGGVNSEV 289
                SLF T S D + +I D    +  AT+ G K     +SF  + + LLAT   +  +
Sbjct: 494 LAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQY-DKLLATSSGDKTI 552

Query: 290 YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLED 349
            +++       +  + GHT+AV    F ++   ++ S+GAD  + IWD            
Sbjct: 553 KIWNLDTF-SCVKTLEGHTNAVQRCAFMNKQKQLV-SSGADGLIKIWDC----------- 599

Query: 350 AEDATSEVMMIHAGHRSPINDFAINPSIPW-LVASAEEENIVQLWK 394
               T + +    GH + I  +A+N      L+ SA+ + + Q W+
Sbjct: 600 ---ITGDCLKTLDGHGNRI--WAMNVCNDGDLIISADADGVFQFWR 640

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 279 LLATGGVNSEVYLYD---RRYVEEPLHLMSGHTDAVTSLDFS---SQDDGIILSAGADKR 332
           LLA+G  N    ++D   RR     LH M  HT A+  LDF     +D   +LS G D  
Sbjct: 161 LLASGDTNGVAKVWDLVKRR----CLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDI 216

Query: 333 VIIWDIN 339
           V +W+ N
Sbjct: 217 VNLWEFN 223

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 121 NIRVTRKFK-HDSEVTRARY---MPQDPNILATISGTGTVYIYDRSNERDTASITLQYHT 176
           N  +T  FK H   ++  ++   +  D  +LA+    G   ++D    R     T+Q HT
Sbjct: 132 NGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKRR--CLHTMQEHT 189

Query: 177 DNGYGLAFNPLIKGH----LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI 224
               GL F   ++G     LLSG  D  V LW+    ++  + K   +H  +
Sbjct: 190 SAIRGLDFKE-VEGEDCVKLLSGGRDDIVNLWEFNMKKHSKLLKTVPVHQQV 240

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 99/232 (42%), Gaps = 24/232 (10%)

Query: 181 GLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGT 240
            +AF+P  +  +L     S + LWD        + ++E  H   V    +H  Q  LF +
Sbjct: 16  AIAFHP-SRPWVLVALFSSTIQLWDYR--MGVLLHRFEE-HEGPVRGVDFHPTQ-PLFVS 70

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
             +D S+++      K + T+NG   +    F H     + +   +  + +++ +   E 
Sbjct: 71  AGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRRE- 129

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG----------------AE 344
           +  ++GH   V    F   +D +++SA  D+ V IWDI+ +                  +
Sbjct: 130 IACLTGHNHFVMCAQFHPTED-LVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQ 188

Query: 345 QVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
           Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 189 QNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 30/156 (19%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTAS-----------ITLQYHTDN 178
           H+  V  A++ P + +++ + S   TV I+D S  R   S           IT Q   D 
Sbjct: 136 HNHFVMCAQFHPTE-DLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SGSDD  V LW ++S +   V      H+
Sbjct: 195 GFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + V+   +H FQ +L  +V EDS++++ D  +  PV
Sbjct: 254 NNVDSVIFHPFQ-NLIISVGEDSTIRVWDLDKRTPV 288

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 88/183 (48%), Gaps = 15/183 (8%)

Query: 171 TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWENIHSDIVND 227
           TL+ H      L+ +P     LLSGS D  +  W +T +  +   PV+ ++  HS IV D
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG-HSHIVQD 86

Query: 228 CQ-WHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHH-SENLLATGGV 285
           C   H+ + +L  + S D +L++ D +  K +    G K  + +S S       + +   
Sbjct: 87  CTVTHDGKYAL--SASWDKTLRLWDLQSGKCIKRFVGHKS-DVMSVSIDPRATQIVSASR 143

Query: 286 NSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFS---SQDDGI-ILSAGADKRVIIWDINDI 341
           +  V +++   V + +  + GH D V+++  +     DD + ++SAG DK V +WD+   
Sbjct: 144 DKTVKVWNT--VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSF 201

Query: 342 GAE 344
             E
Sbjct: 202 TIE 204

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 13/172 (7%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    LA N L +  L S S D  V LWD+  +    V+ +++IHS   V+  +WH 
Sbjct: 277 HHTDAVLSLAHNKLFRSVLASTSADHTVKLWDL--NNASVVRSFDSIHSGKNVSASEWHQ 334

Query: 233 FQKSLFGTVSEDSSLQIHDTR--ESKPVA---TINGTKPFNTLSFSHHSENLLATGGVNS 287
              S+  T   DS + + D R  ++K ++   +++  +   + +F    EN++  G    
Sbjct: 335 SNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFV--DENIILCGTDTG 392

Query: 288 EVYLYDRRYVEEPLHL--MSGHTDAVTSLDFSSQDDGIILS-AGADKRVIIW 336
            VY +D R   E   +  +  H   +++L  +    G++ + A  DK    W
Sbjct: 393 NVYSFDIRNNAESKSVWTLKAHDSGISALAVNKFVPGLLTTGAMGDKVAKTW 444

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 133 EVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGH 191
           E+  A ++  D NI+   + TG VY +D  N  ++ S+ TL+ H      LA N  + G 
Sbjct: 373 EIESATFV--DENIILCGTDTGNVYSFDIRNNAESKSVWTLKAHDSGISALAVNKFVPGL 430

Query: 192 LLSGSDDSNVA-LWDVTSDRN 211
           L +G+    VA  W   +D N
Sbjct: 431 LTTGAMGDKVAKTWKFPTDTN 451

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 18/102 (17%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-------- 353
           H+ + HTDAV SL  +     ++ S  AD  V +WD+N+    +  +             
Sbjct: 273 HVTTHHTDAVLSLAHNKLFRSVLASTSADHTVKLWDLNNASVVRSFDSIHSGKNVSASEW 332

Query: 354 --TSEVMMIHAGHRSPI-------NDFAINPSIPWLVASAEE 386
             ++  +++ AG+ S I       ND A N S  W V+S EE
Sbjct: 333 HQSNGSILLTAGYDSRIALTDVRSND-AKNLSKYWSVSSGEE 373

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 127/295 (43%), Gaps = 32/295 (10%)

Query: 66  LPHSAPNPVTRQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNL------------TES 113
           +  + P  VT +  +L   T+ E++ + + +   L  E    +++            T S
Sbjct: 1   MSSARPRIVTSRAAVLPQQTTPEQRYWRQYSSAQLVKEHNSVTHIAFNPQHPHDFAVTSS 60

Query: 114 DEEQVRSNI--RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASIT 171
              Q+ S+   +V + F    +V  +     D  +L     TG V +YD  N R T  ++
Sbjct: 61  TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPR-TILLS 119

Query: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWH 231
           +   T   +   F+P     L++ SDD  + LWD+ S+  +P  +     +D V      
Sbjct: 120 INASTHPTHVTKFHPQDNKTLITASDDRVIRLWDI-SNAYQPQLELTG-STDYVRSVTCV 177

Query: 232 NFQKSLFGTVSEDSSLQIHDTRE--SKPVATINGTKPFNTLSFSHHSENLLATGGVNSEV 289
                +  + S D  ++++DTR   S P+ ++   +P   +  S  +  +++ GG N +V
Sbjct: 178 PSAPHMIVSGSYDGIIRLYDTRASGSSPIYSLLHDQPIEDI-ISISATQIVSCGGSNFKV 236

Query: 290 Y-------LYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           +       LY+R    + +  +    D V+SLD S  +  +I S+  D  V ++D
Sbjct: 237 WDLTSNKKLYERGNFNKTVTCL----DHVSSLDDSPMNSALIASS-LDGHVKVFD 286

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 67/169 (39%), Gaps = 20/169 (11%)

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           V+  + +QI  +R  + + T +  K     +       LL  G     V +YD       
Sbjct: 57  VTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPRTI 116

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV-LEDAEDATSEVMM 359
           L  ++  T       F  QD+  +++A  D+ + +WDI++    Q+ L  + D    V  
Sbjct: 117 LLSINASTHPTHVTKFHPQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTC 176

Query: 360 IHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPV 408
           +              PS P ++ S   + I++L+       R SG+ P+
Sbjct: 177 V--------------PSAPHMIVSGSYDGIIRLYDT-----RASGSSPI 206

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 80/169 (47%), Gaps = 17/169 (10%)

Query: 142 QDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA--FNPLIKGH--LLSGSD 197
            D N +A+ SG G +  ++ S+  +  S    Y    G  ++   +PL +    +LS  D
Sbjct: 78  HDLNKVASGSGDGVIKYWNMSSRDEICSFKAHYGLITGLCVSPQRSPLNRDQHFMLSCGD 137

Query: 198 DSNVALWDVTSDRNEPVQKWENIHSD---IVNDCQWHNFQ-------KSLFGTVSEDSSL 247
           D  V LW +  D    V+  +N++S    +      H FQ       K+ F  V+   ++
Sbjct: 138 DKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGIDHHKVKTTF--VTGGPTI 195

Query: 248 QIHDTRESKPVATIN-GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRR 295
           Q+ DT  SKP++ ++ G     ++ F+    ++LA+ G ++ + LYD R
Sbjct: 196 QLWDTARSKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVR 244

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 104/238 (43%), Gaps = 30/238 (12%)

Query: 108 SNLTESDEEQVRSNIR-VTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERD 166
           SN  ES  E +R + + +T        + +A   P+    LA+ S  GT+ I+D +  R 
Sbjct: 214 SNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPR----LASASKDGTIKIWDTT--RR 267

Query: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVN 226
              +TL  HT++   + +    +G L SGS D  +  WD+ +       K  NI   + +
Sbjct: 268 VCVLTLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAAG-----GKCINI---LKS 317

Query: 227 DCQWHNFQKSLFGTVSEDSSLQI--HDTRESKPV----ATINGTKPFNTLSFSHHS-ENL 279
              W N       +++ D +L++   D    KP     A     K +  ++  +   E L
Sbjct: 318 HAHWINHL-----SLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEEL 372

Query: 280 LATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWD 337
           + T   +  +YL+D     +P+  M+GH   V  + F S D   I+SA  D  + +WD
Sbjct: 373 MVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF-SPDGRYIVSASFDNSIKLWD 429

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 77/170 (45%), Gaps = 19/170 (11%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           AF P   G +++GS D+   +WD  +  N P+   +  H + V    W      L  T S
Sbjct: 149 AFAPHTSGRMVTGSGDNTARIWDCNT--NTPMYTLKG-HFNWVLCVAWCP-DGELIATGS 204

Query: 243 EDSSLQIHDTR--ESKPVATINGTKPFNTLSF------SHHSENLLATGGVNSEVYLYD- 293
            D+++++ D+   ES   A     K   +L++          +  LA+   +  + ++D 
Sbjct: 205 MDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDT 264

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIG 342
            RR     +  +SGHT++V+ + +  +  GI+ S   DK +  WD+   G
Sbjct: 265 TRRVC---VLTLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAAGG 309

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 72/146 (49%), Gaps = 7/146 (4%)

Query: 192 LLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251
           +++ SDD  + LWD     ++P+ +    H  +VN   +    + +  + S D+S+++ D
Sbjct: 373 MVTASDDFTMYLWDPLK-ASKPITRMTG-HQKLVNHVAFSPDGRYIV-SASFDNSIKLWD 429

Query: 252 TRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDA 310
            R    +AT  G       +++S     LL +   ++ + ++D R  +  + L  GH D 
Sbjct: 430 GRNGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL-PGHNDE 487

Query: 311 VTSLDFSSQDDGIILSAGADKRVIIW 336
           V ++D+S  D   + SAG DK V IW
Sbjct: 488 VYTVDWSV-DGKRVCSAGKDKMVRIW 512

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 97/208 (46%), Gaps = 23/208 (11%)

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           A +P+     ++GS+D+ + +WD+ S + +        H   V D    +    LF +VS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTL---TGHVMTVRDIAVSDRHPYLF-SVS 201

Query: 243 EDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPL 301
           ED +++  D  +++ +   +G      T+S  H + +L+AT G +S V L+D R    P+
Sbjct: 202 EDKTVKCWDLEKNQIIRDYHGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIR-TRVPV 259

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIH 361
             + GH   +  ++ +  D  I+ S+  D  V +WDI                 + M + 
Sbjct: 260 ITLVGHKGPINQVECAPVDPQIV-SSSTDATVRLWDI--------------VAGKAMKVL 304

Query: 362 AGHRSPINDFAINPSIPWLVASAEEENI 389
             H+  +   A++P+  + +ASA  ++I
Sbjct: 305 THHKRSVRAIALHPN-EFSMASACTDDI 331

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 16/100 (16%)

Query: 304 MSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAG 363
           ++GH   V  +  S +    + S   DK V  WD+      Q++ D           + G
Sbjct: 178 LTGHVMTVRDIAVSDRHP-YLFSVSEDKTVKCWDLE---KNQIIRD-----------YHG 222

Query: 364 HRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRIS 403
           H S +   +I+P++  L+A+A  +++V+LW    ++P I+
Sbjct: 223 HLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIRTRVPVIT 261

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 16/88 (18%)

Query: 306 GHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHR 365
           GH   V ++      D +I +AG D  V +WDI               T   ++   GH+
Sbjct: 222 GHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIR--------------TRVPVITLVGHK 266

Query: 366 SPINDFAINPSIPWLVASAEEENIVQLW 393
            PIN     P  P +V+S+ +   V+LW
Sbjct: 267 GPINQVECAPVDPQIVSSSTDAT-VRLW 293

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 106/235 (45%), Gaps = 30/235 (12%)

Query: 181 GLAFN---PLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSL 237
           G+AF+   P +   L S    S + LWD        + ++E+ H   V    +H  Q  L
Sbjct: 16  GIAFHSSRPWVLVALFS----STIQLWDYR--MGTLLHRYED-HEGPVRAVDFHPTQ-PL 67

Query: 238 FGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYV 297
           F +  +D ++++     +K + T+ G   +    F H+    + +   +  + +++ +  
Sbjct: 68  FVSAGDDYNIKVWSLDTNKCLYTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQNR 127

Query: 298 EEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDI-------GA------- 343
           +E +  ++GH   V S  F   +D +++SA  D+ + +WDI+ +       GA       
Sbjct: 128 KE-IACLTGHNHFVMSAQFHPTED-LVVSASLDETIRVWDISGLRKKHSAPGATSLEDQM 185

Query: 344 --EQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
             +Q L D       V  I  GH   +N  + +P++P L+ S  ++  V+LW+ S
Sbjct: 186 LMQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 30/156 (19%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTAS-----------ITLQYHTDN 178
           H+  V  A++ P + +++ + S   T+ ++D S  R   S           +  Q   D 
Sbjct: 136 HNHFVMSAQFHPTE-DLVVSASLDETIRVWDISGLRKKHSAPGATSLEDQMLMQQNLLDG 194

Query: 179 GYG-LAFNPLIKGH---------------LLSGSDDSNVALWDVTSDRNEPVQKWENIHS 222
           G+G      +++GH               ++SG DD  V LW ++S +   V      H+
Sbjct: 195 GFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRG-HT 253

Query: 223 DIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPV 258
           + V+   +H  Q +L  +V ED +L++ D  +  PV
Sbjct: 254 NNVDSVIFHPHQ-NLIISVGEDKTLRVWDLDKRTPV 288

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 155 TVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPV 214
           T+ I++  N ++ A +T   H        F+P  +  ++S S D  + +WD++  R +  
Sbjct: 118 TIRIWNWQNRKEIACLT--GHNHFVMSAQFHP-TEDLVVSASLDETIRVWDISGLRKKHS 174

Query: 215 QKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSH 274
                   D +      N     FG       L+ H             T+  N  SF H
Sbjct: 175 APGATSLEDQM--LMQQNLLDGGFGDCVVKFILEGH-------------TRGVNWASF-H 218

Query: 275 HSENLLATGGVNSEVYLYDRRYVEE-PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRV 333
            +  L+ +GG + +V L+     +   +    GHT+ V S+ F    + +I+S G DK +
Sbjct: 219 PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGEDKTL 277

Query: 334 IIWDINDIGAEQVLEDAED------ATSEVMMIHAGHRSPINDFAINPSIPWLV 381
            +WD++     +  +   D      A   + +  A H S I  F ++   P  V
Sbjct: 278 RVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSV 331

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 73/169 (43%), Gaps = 31/169 (18%)

Query: 170 ITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229
            T + H D    L+ +P     L+SGS D  +  WD+ S +   +Q  +   ++++    
Sbjct: 490 FTFEAHIDEVTALSLDP---NFLVSGSQDRTIRQWDLCSGK--CMQTIDLSFANVLTTAT 544

Query: 230 WHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEV 289
             +  KS   T            R  +P  TI   + F+           LATG  +  V
Sbjct: 545 NVDLSKSTLLT-----------QRSERP--TIGALQSFDAA---------LATGTKDGIV 582

Query: 290 YLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338
            L+D R   + +  + GHTDA+TSL F   D   +++   D+ V +WD+
Sbjct: 583 RLWDLR-SGKVIRTLEGHTDAITSLKF---DSACLVTGSYDRTVRVWDL 627

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 19/140 (13%)

Query: 270 LSFSHHSENLLATGGVNSEVYLYD---RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326
           L F      L   G ++  V ++D   R+ + E    ++GH   +  +    +D G +++
Sbjct: 398 LDFDGPFGTLCTAGYLDHTVKIWDLSKRKKIGE----LAGHLATINCMQID-RDYGTLVT 452

Query: 327 AGADKRVIIWDINDIGAEQVLEDAEDAT-------SEVMMIHAGHRSPINDFAINPSIPW 379
            G D  + +W++N   AEQ+ ++ ++ T       S  +     H   +   +++P+  +
Sbjct: 453 GGRDAALKLWNLN--LAEQLYQETQNLTCPASQIDSPCVFTFEAHIDEVTALSLDPN--F 508

Query: 380 LVASAEEENIVQLWKCSHKL 399
           LV+ +++  I Q   CS K 
Sbjct: 509 LVSGSQDRTIRQWDLCSGKC 528

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 96/229 (41%), Gaps = 29/229 (12%)

Query: 123 RVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
           +V + F    +V  +     D  +L     TG V +YD  N R T  +++   T   +  
Sbjct: 72  QVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPR-TILLSMNASTHPTHVT 130

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
            F+      L + SDD    LWD+ S+  EP  +     +D V    +      L  T S
Sbjct: 131 KFHTQDSKILATASDDRVTRLWDI-SNAYEPQLELTGA-TDYVRTLSFIPAAPHLIATGS 188

Query: 243 EDSSLQIHDTRE--SKPVATINGTKPF-NTLSFSHHSENLLATGGVNSEVY-------LY 292
            D  ++++DTR   S P+ ++N  +P  N ++ S     +++ GG N +V+       LY
Sbjct: 189 YDGLVRLYDTRSSGSTPIYSLNHDQPIENVIAVS--PTQIVSCGGSNFKVWDLTSNKKLY 246

Query: 293 DRRYVEEPLHLMSGHTDAVTSLD----FSSQDDGIILSAGADKRVIIWD 337
           +R               AVT LD    F S     ++++  D  V ++D
Sbjct: 247 ER----------GNFNKAVTCLDYIENFGSPMQSALIASSLDGHVKVFD 285

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 67/169 (39%), Gaps = 20/169 (11%)

Query: 241 VSEDSSLQIHDTRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           V+  + +QI  +R  + + T +  K     +       LL  G     V +YD       
Sbjct: 57  VTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTI 116

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV-LEDAEDATSEVMM 359
           L  M+  T       F +QD  I+ +A  D+   +WDI++    Q+ L  A D    +  
Sbjct: 117 LLSMNASTHPTHVTKFHTQDSKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSF 176

Query: 360 IHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPV 408
           I              P+ P L+A+   + +V+L+       R SG+ P+
Sbjct: 177 I--------------PAAPHLIATGSYDGLVRLYDT-----RSSGSTPI 206

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 100/209 (47%), Gaps = 14/209 (6%)

Query: 154 GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEP 213
           G + +Y+  +E  +  +  Q H D   GL ++P     +++ S+D  + +WDV S     
Sbjct: 321 GQLLVYEWQSE--SYILKQQGHFDTLNGLTYSP-DGSRVVTASEDGKIKIWDVVS--GFC 375

Query: 214 VQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLS 271
           +  +E  H+  V+  Q+    + LF + S D +++  D    +   T    +   FN+L+
Sbjct: 376 LATFEE-HTSAVSAVQFSKRGQVLF-SASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLA 433

Query: 272 FSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADK 331
                E + A    N E+ ++  +   + L  ++GH   V+ L FS Q++ ++ SA  DK
Sbjct: 434 VDPSGEVVCAGSIDNYEIQVWSVQ-TGQLLDCLAGHEGPVSCLAFS-QENNVLASASWDK 491

Query: 332 RVIIWDINDIGAEQVLEDAEDATSEVMMI 360
            + +W I   G  Q +E   D +++V+ +
Sbjct: 492 TIRVWSI--FGRSQQVEPI-DVSADVLAL 517

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 101/253 (39%), Gaps = 51/253 (20%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           HDS++    + P D   L T +  G + I++ +N+ ++ + TL  H +    + F+P  K
Sbjct: 224 HDSKIGGVDWNP-DGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGK 282

Query: 190 GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQI 249
            ++ S S D    LWDV  ++   +Q  E    ++   C       SL  +   DS   +
Sbjct: 283 -YVASASFDMTWRLWDV--EKQIELQLQEGHAKEVY--CVAFQKDGSLLCSTGLDSVGLV 337

Query: 250 HDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVE---------- 298
            D R  K +  + G  KP   L +S +  ++ ATG  +  + L+D R V           
Sbjct: 338 WDLRSGKSIMALEGHIKPIYGLDWSPNGYDI-ATGSADGTIRLWDVRKVGILGALPAHNS 396

Query: 299 --------------------------------EPLHLMSGHTDAVTSLDFSSQDDGIILS 326
                                             L ++ GHTD + S+D S+ D   + S
Sbjct: 397 IVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDIST-DGSHLFS 455

Query: 327 AGADKRVIIWDIN 339
           +G D+ +  W + 
Sbjct: 456 SGWDRSLKQWSLK 468

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 11/228 (4%)

Query: 140 MPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDS 199
           +  D +++AT S  G + I          +    + +  G G+ +NP     L++G+ + 
Sbjct: 190 ISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIG-GVDWNP-DGTALVTGAANG 247

Query: 200 NVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA 259
            + +W++ +D   P       H + V   ++H   K +  + S D + ++ D  +   + 
Sbjct: 248 EIRIWNLNNDSESPAGTLTG-HENRVARVRFHPSGKYV-ASASFDMTWRLWDVEKQIELQ 305

Query: 260 TING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSS 318
              G  K    ++F     +LL + G++S   ++D R  +  + L  GH   +  LD+S 
Sbjct: 306 LQEGHAKEVYCVAFQKDG-SLLCSTGLDSVGLVWDLRSGKSIMAL-EGHIKPIYGLDWSP 363

Query: 319 QDDGIILSAG-ADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHA-GH 364
             +G  ++ G AD  + +WD+  +G    L       SEV    A GH
Sbjct: 364 --NGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGH 409

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 19/160 (11%)

Query: 236 SLFGTVSEDSSLQIHDTRESKPVATI-NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDR 294
           S+F T S D + ++ +    +PVAT+ N  +    +SF   SE  +AT   +  V ++  
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFC-ESEKWIATCSGDKTVKIWSL 566

Query: 295 RYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDAT 354
                 L  + GHT+AV    F ++   ++ SAGAD  + +WDI              A+
Sbjct: 567 ESF-TVLKTLEGHTNAVQRCSFMNKQKQLV-SAGADGLIKVWDI--------------AS 610

Query: 355 SEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
            + +    GH + I   ++      L+ SA+ +++ Q WK
Sbjct: 611 GDCIKNLDGHSNRIWALSVLEDGD-LIISADADSVFQFWK 649

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWDV  +R +PV    W    +D +   +++  +  +  +   D+S+ ++D R + 
Sbjct: 199 AKIQLWDV--NRVKPVSNLSWG---ADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  T   N + ++            +   Y YD R +   L++   H  AV  +DF
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 317 SSQDDGIILSAGADKRVIIWDIN 339
           S   D I+ +   DK + I++ N
Sbjct: 314 SPTGDEIV-TGSYDKSIRIYNTN 335

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 82/202 (40%), Gaps = 41/202 (20%)

Query: 145 NILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLA------FNPLIKGH--LLSGS 196
           N LAT S  G +  ++ S   +  S    Y    G  +         P +K    +LS S
Sbjct: 81  NKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHDKKPDLKNQNFMLSCS 140

Query: 197 DDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           DD  V LW +  D                    + N + S   +V  +  L         
Sbjct: 141 DDKTVKLWSINVD-------------------DYSNKRSSDNDSVINEEGL--------- 172

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
            V T +G   F  +  SH   +  ATGG  +++ L+D   V +P+  +S   D +TS+ F
Sbjct: 173 -VRTFDGESAFQGID-SHRVNSTFATGG--AKIQLWDVNRV-KPVSNLSWGADNITSVKF 227

Query: 317 SSQDDGIILSAGADKRVIIWDI 338
           +  +  I+ S G+D  ++++D+
Sbjct: 228 NQNETDILASTGSDNSIVLYDL 249

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 87/206 (42%), Gaps = 29/206 (14%)

Query: 141 PQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200
           P D   LA+ S  GT+ I+D S  R     TL  HT++   + +    +G L SGS D  
Sbjct: 245 PGDKPRLASASKDGTIKIWDTS--RRVCIYTLSGHTNSVSCVKWGG--QGLLYSGSHDKT 300

Query: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWH---------NFQKSLFGTVSEDSSLQIHD 251
           V +WD+            N+    +N  + H         + + +L     + ++ +   
Sbjct: 301 VRVWDM------------NVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTS 348

Query: 252 TRESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAV 311
             E++  A  N  K       +  +E L+ T   +  ++L+D     +PL  ++GH   V
Sbjct: 349 AEEARKKALENYEK---IAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLV 405

Query: 312 TSLDFSSQDDGIILSAGADKRVIIWD 337
             + FS  D   I+SA  D  + +WD
Sbjct: 406 NHVAFSP-DGRFIVSASFDNSIKLWD 430

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 83/174 (47%), Gaps = 22/174 (12%)

Query: 184 FNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSE 243
           F P     +++G+ D+   +WD   D   P+      H + V    W    +++  T S 
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDC--DTQTPMATLSG-HQNWVLCVAWSPDGETI-ATGSM 206

Query: 244 DSSLQIHDTRESKPVA-TINGTKPFNTLSFSHHSENL--------LATGGVNSEVYLYD- 293
           D ++++ D++  +P+   + G + + T S      +L        LA+   +  + ++D 
Sbjct: 207 DCTVRLWDSKAGQPLGDALKGHQKWIT-SLVWEPLHLVKPGDKPRLASASKDGTIKIWDT 265

Query: 294 -RRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQV 346
            RR     ++ +SGHT++V+ + +  Q  G++ S   DK V +WD+N +G + +
Sbjct: 266 SRRVC---IYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDMN-VGGKCI 313

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 121/282 (42%), Gaps = 30/282 (10%)

Query: 124 VTRKFKH-DSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGL 182
            +R  +H DS+V R   +  D  +LA  +G   V +YD       A  T + H  N   +
Sbjct: 44  CSRTIQHSDSQVNRLE-ITNDKKLLAA-AGYQNVRLYDIRTTNPNAVATFEGHKGNVTSV 101

Query: 183 AFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVS 242
           +F    K  +++ S+D  + +WDV S    P       H+  VN+   H  Q  L  +  
Sbjct: 102 SFQQDNKW-MVTSSEDGTIKVWDVRS----PSVPRNYKHNAPVNEVVIHPNQGELI-SCD 155

Query: 243 EDSSLQIHDTRESKPVATI---NGTKPFNTLSFSHHSENLLATGGVNSEVYLYDR-RYVE 298
            D +++I D  E++    +   +      +LS +     L+A      + Y+++   + +
Sbjct: 156 RDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANN-KGDCYVWEMPNHTD 214

Query: 299 ----EPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDAT 354
               +P++  S H D +T +  SS D   + +  AD+   IW + +   +  LE   D  
Sbjct: 215 ASNLKPINKFSAHKDYITRVVLSS-DVKHMATCSADRTAKIWSVGETEDDFNLETTLD-- 271

Query: 355 SEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCS 396
                   GH+  + D A +    +LV +A  ++ V+LW  S
Sbjct: 272 --------GHQRWVWDCAFSADSAYLV-TASSDHYVRLWDLS 304

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 29/246 (11%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLS S D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHSE 277
             HS IV DC       +   + S D +L++ D    +      G K  + +S       
Sbjct: 63  G-HSHIVQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVDIDKKA 119

Query: 278 NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF----SSQDDGI-ILSAGADKR 332
           +++ +G  +  + ++  +   + L  + GH D V+ +       + DD + I+SAG DK 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH S IN    +P    L+ASA ++  + L
Sbjct: 178 VKAWNLNQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 393 WKCSHK 398
           W  + K
Sbjct: 223 WNLAAK 228

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 29/246 (11%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLS S D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHSE 277
             HS IV DC       +   + S D +L++ D    +      G K  + +S       
Sbjct: 63  G-HSHIVQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVDIDKKA 119

Query: 278 NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF----SSQDDGI-ILSAGADKR 332
           +++ +G  +  + ++  +   + L  + GH D V+ +       + DD + I+SAG DK 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH S IN    +P    L+ASA ++  + L
Sbjct: 178 VKAWNLNQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 393 WKCSHK 398
           W  + K
Sbjct: 223 WNLAAK 228

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 29/246 (11%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLS S D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHSE 277
             HS IV DC       +   + S D +L++ D    +      G K  + +S       
Sbjct: 63  G-HSHIVQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVDIDKKA 119

Query: 278 NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF----SSQDDGI-ILSAGADKR 332
           +++ +G  +  + ++  +   + L  + GH D V+ +       + DD + I+SAG DK 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH S IN    +P    L+ASA ++  + L
Sbjct: 178 VKAWNLNQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 393 WKCSHK 398
           W  + K
Sbjct: 223 WNLAAK 228

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 29/246 (11%)

Query: 162 SNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE---PVQKWE 218
           SNE      TL+ H      LA +      LLS S D  +  W +T D  +   PV+ ++
Sbjct: 3   SNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 219 NIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSFS-HHSE 277
             HS IV DC       +   + S D +L++ D    +      G K  + +S       
Sbjct: 63  G-HSHIVQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKS-DVMSVDIDKKA 119

Query: 278 NLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF----SSQDDGI-ILSAGADKR 332
           +++ +G  +  + ++  +   + L  + GH D V+ +       + DD + I+SAG DK 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 333 VIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQL 392
           V  W++N     Q+  D             GH S IN    +P    L+ASA ++  + L
Sbjct: 178 VKAWNLNQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 393 WKCSHK 398
           W  + K
Sbjct: 223 WNLAAK 228

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 34/189 (17%)

Query: 216 KWENIHSDIVNDCQW--HNFQKSLFGT-VSEDSSLQIHDTRESK-PVATINGTKPFNTLS 271
           + +NI + + + C +  HN  K +     S+D  L     ++S   + +++G+       
Sbjct: 459 RLDNIQTSLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKL 518

Query: 272 FSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADK 331
            S+  E +L TG              +E   L+ GH+ AV S  FS  D+  +LS   DK
Sbjct: 519 PSYKKEEILTTG--------------DETSSLLIGHSGAVYSTSFSP-DNKFLLSGSEDK 563

Query: 332 RVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQ 391
            V +W ++              T   ++ + GH  P+ D   +P   +  A+A  +   +
Sbjct: 564 TVRLWSMD--------------THTTLVSYKGHNHPVWDVKFSPMGHYF-ATASHDQTAR 608

Query: 392 LWKCSHKLP 400
           LW C H  P
Sbjct: 609 LWSCDHIYP 617

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 16/94 (17%)

Query: 300 PLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMM 359
           PL + +GH + V ++ F   +   + +  ADK   +WDI              +T + + 
Sbjct: 617 PLRIFAGHLNDVETVSFHP-NGCYVFTGSADKTCRMWDI--------------STGDSVR 661

Query: 360 IHAGHRSPINDFAINPSIPWLVASAEEENIVQLW 393
           +  GH +P+   A+ P   WL     E+ ++ +W
Sbjct: 662 LFLGHTAPVLTTAVTPDGRWLCTGG-EDGVINVW 694

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 15/246 (6%)

Query: 130 HDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIK 189
           H   V    + P D   L + S   TV ++  S +  T  ++ + H    + + F+P+  
Sbjct: 540 HSGAVYSTSFSP-DNKFLLSGSEDKTVRLW--SMDTHTTLVSYKGHNHPVWDVKFSPM-- 594

Query: 190 GHLLS-GSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQ 248
           GH  +  S D    LW  + D   P++ +   H + V    +H     +F T S D + +
Sbjct: 595 GHYFATASHDQTARLW--SCDHIYPLRIFAG-HLNDVETVSFHPNGCYVF-TGSADKTCR 650

Query: 249 IHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGH 307
           + D      V    G T P  T + +      L TGG +  + ++D     + L  M GH
Sbjct: 651 MWDISTGDSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIG-TGKRLKQMRGH 708

Query: 308 -TDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRS 366
             +A+ S  F+ + + I++S GAD  V +WD+     E   E  +     V  + A    
Sbjct: 709 GKNAIHSFSFNKEGN-ILISGGADHSVRVWDLKKATPEPSAEPEQPFAGYVGDVTASVNQ 767

Query: 367 PINDFA 372
            I +F 
Sbjct: 768 DIKEFG 773

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 98/214 (45%), Gaps = 24/214 (11%)

Query: 182 LAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTV 241
           +A +P+      +GS+D+ + +WD+ + +   ++   + H   V D         +F + 
Sbjct: 135 VAVDPIDNEWFATGSNDTTIKIWDLATGK---LKLTLSGHIMTVKDICISKRHPYMF-SA 190

Query: 242 SEDSSLQIHDTRESKPVATING-TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEP 300
           SED  ++  D  +++ +   +G     +T+   H + NL+AT G +S V L+D R  + P
Sbjct: 191 SEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDI-HPTLNLIATAGRDSVVRLWDIR-TKLP 248

Query: 301 LHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMI 360
           +  M+GH   +  +     D  ++ S  AD  V +WDI                 + + +
Sbjct: 249 VMTMAGHKSPINRVKCLPVDPQVV-SCSADATVRLWDI--------------TAGKTLKV 293

Query: 361 HAGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
              H+  + D  I+P   + ++SA  ++I + WK
Sbjct: 294 LTHHKRSVRDIGIHPG-EFSISSACTDDI-RSWK 325

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 65/138 (47%), Gaps = 21/138 (15%)

Query: 280 LATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
            ATG  ++ + ++D    +  L L SGH   V  +  S +    + SA  DK V  WD+ 
Sbjct: 145 FATGSNDTTIKIWDLATGKLKLTL-SGHIMTVKDICISKRHP-YMFSASEDKLVKCWDLE 202

Query: 340 DIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKL 399
                +V+ D           + GH S ++   I+P++  L+A+A  +++V+LW    KL
Sbjct: 203 ---KNRVIRD-----------YHGHLSGVHTVDIHPTLN-LIATAGRDSVVRLWDIRTKL 247

Query: 400 PRIS----GTPPVRVDML 413
           P ++     +P  RV  L
Sbjct: 248 PVMTMAGHKSPINRVKCL 265

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 199 SNVALWDVTSDRNEPVQK--WENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESK 256
           + + LWD  ++R++P+    W    +D V   +++  +  +  +   D+S+ ++D R + 
Sbjct: 193 AQIQLWD--ANRSKPISNLTWG---ADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNS 247

Query: 257 PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDF 316
           P   I  +   N + ++            +   Y YD R +   L++   H  AV  +DF
Sbjct: 248 PTQKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDF 307

Query: 317 SSQDDGIILSAGADKRVIIWDINDIGAEQV 346
           S   D I+ +   DK + I+  N   + +V
Sbjct: 308 SPTGDEIV-TGSYDKTIRIYKTNQGHSREV 336

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 89/190 (46%), Gaps = 11/190 (5%)

Query: 151 SGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR 210
           S  G + +Y+  +E  +  +  Q H D+  GL ++P     +++ ++D  + +WDV S  
Sbjct: 315 SALGQLLVYEWQSE--SYILKQQGHFDSLNGLTYSP-DGARVVTAANDGKIKVWDVVSGF 371

Query: 211 NEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFN 268
                   + H+  V   Q+    + LF + S D +++  D    +   T   T+  PFN
Sbjct: 372 CLAT---FSEHTSSVTAVQFAKRGQVLFSS-SLDGTVRAWDLIRFRNFRTFTSTQRIPFN 427

Query: 269 TLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAG 328
            L+     E + A    + E++++  +   + L  + GH   V+ L FS Q++ ++ SA 
Sbjct: 428 CLAVDPSGEVVCAGSSDSFEIHVWSVQ-TGQLLDSLDGHEGPVSCLAFS-QENSVLASAS 485

Query: 329 ADKRVIIWDI 338
            DK + IW I
Sbjct: 486 WDKTIRIWSI 495

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 115/297 (38%), Gaps = 48/297 (16%)

Query: 138 RYMPQDPNILATISGT-------GTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKG 190
           +Y P   N LA  +G+       G ++I D +N+            D  + +A+N L + 
Sbjct: 15  QYSPFFDNRLAVATGSNFGLVGNGKLFIVDINNQGIMTEAKSFLTQDGLFDVAWNELHEN 74

Query: 191 HLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIH 250
            +L    D ++ L+D T   + P+  +   H   V  C W+   K LF + S D ++++ 
Sbjct: 75  QVLVAQGDGSLRLFD-TQLTDYPIAIFHE-HEKEVFSCNWNLINKQLFVSSSWDGTVKVW 132

Query: 251 D--------TRESKPVATINGTKPFNTL---------------------SFSHHSENLLA 281
                    T   KP+A  N   P   +                      FS H  N++ 
Sbjct: 133 SPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIM 192

Query: 282 TGGVNSEVYLYDRRY--VEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339
           +   NS V ++D R          ++ +     + DF+     I+ + G D  + +WD+ 
Sbjct: 193 SCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDL- 251

Query: 340 DIGAEQVLEDAEDATSEVMMIH--AGHRSPINDFAINPSIPWLVASAEEENIVQLWK 394
                +++  A   + + M ++   GH   I   + +P    ++ S   +   ++W+
Sbjct: 252 -----RMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 67/170 (39%), Gaps = 21/170 (12%)

Query: 129 KHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGY---GLAFN 185
           K+ + + ++++ P DPN++ + +G   V ++D          +   H  NG       FN
Sbjct: 173 KNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAH--NGMETLTCDFN 230

Query: 186 PLIKGHLLSGSDDSNVALWDV------TSDRNEPVQKWENIHSDI-VNDCQWHNFQKSLF 238
                 + +G  D+ + +WD+       S+  +P+   E    D+ +    W     ++ 
Sbjct: 231 KYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNML 290

Query: 239 GTVSEDSSLQI-----HDTRESKPVATINGTKPFNT--LSFSHHSENLLA 281
            + S D + ++      D R  +P    N   P       F HH+E +  
Sbjct: 291 LSTSYDMTCRVWQDLSDDGR--RPTGKTNSVDPARGCRFVFPHHTEFVFG 338

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 15/173 (8%)

Query: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDI-VNDCQWHN 232
           +HTD    LA N   +  L S S D  V LWD+  +     +   +IHS   V+  +WH 
Sbjct: 286 HHTDAILSLALNKHFRAVLASTSADHTVKLWDL--NNGTAARSLASIHSGKNVSSSEWHK 343

Query: 233 FQKSLFGTVSEDSSLQIHDTR------ESKPVATINGTKPFNTLSFSHHSENLLATGGVN 286
              S+  T   DS + + D R       SK  + + G +     S +   EN++ +G  +
Sbjct: 344 TNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEE---VESSTFADENIILSGTDS 400

Query: 287 SEVYLYDRR--YVEEPLHLMSGHTDAVTSLDFSSQDDGII-LSAGADKRVIIW 336
             VY +D R     +P+  ++ H   ++ L  +    G++  SA  DK V +W
Sbjct: 401 GNVYAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 302 HLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347
           H+ + HTDA+ SL  +     ++ S  AD  V +WD+N+  A + L
Sbjct: 282 HITTHHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARSL 327

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,059,822
Number of extensions: 2213138
Number of successful extensions: 10611
Number of sequences better than 10.0: 1032
Number of HSP's gapped: 9246
Number of HSP's successfully gapped: 1825
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)