Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009706.7ON1004100445060.0
KAFR0L003306.7ON1028103320350.0
NCAS0F001806.7ON1018103920070.0
TDEL0G046406.7ON1017104219850.0
Skud_5.346.7ON1019103019610.0
YEL055C (POL5)6.7ON1022103419130.0
ZYRO0F00440g6.7ON1039106118870.0
Smik_5.326.7ON1020103018750.0
Suva_5.136.7ON1023103518420.0
CAGL0B03553g6.7ON1021103317890.0
SAKL0E00770g6.7ON1047106717350.0
Ecym_30096.7ON1027105117060.0
TPHA0J002506.7ON1024104816770.0
ACR020C6.7ON1002102816410.0
KLLA0D00792g6.7ON1020104816080.0
TBLA0A072106.7ON1041105315930.0
NDAI0K029106.7ON106374315380.0
Kwal_56.223346.7ON1008103215160.0
KLTH0C11594g6.7ON1006103814550.0
Kpol_1045.806.7ON10192764702e-47
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00970
         (1004 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....  1740   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   788   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   777   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   769   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   759   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   741   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   731   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   726   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   714   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   693   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   672   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   661   0.0  
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   650   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   636   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   624   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   618   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   597   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   588   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   565   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   185   2e-47

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score = 1740 bits (4506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 871/1004 (86%), Positives = 871/1004 (86%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXX 120
            GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQD           
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEER 120

Query: 121  XLMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQ 180
             LMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQ
Sbjct: 121  GLMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQ 180

Query: 181  TIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWKY 240
            TIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWKY
Sbjct: 181  TIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWKY 240

Query: 241  NNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPILYNDPREEPLX 300
            NNPLLKGN               DDNETKTNNANWHPKLHFVWDILLPILYNDPREEPL 
Sbjct: 241  NNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPILYNDPREEPLK 300

Query: 301  XXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKALPTVPS 360
                          EAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKALPTVPS
Sbjct: 301  KKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKALPTVPS 360

Query: 361  KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGALLFGT 420
            KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGALLFGT
Sbjct: 361  KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGALLFGT 420

Query: 421  NGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVLHFILDTLLHIL 480
            NGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVLHFILDTLLHIL
Sbjct: 421  NGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVLHFILDTLLHIL 480

Query: 481  RSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIARERIYSILSELSS 540
            RSHKLNLKGEHISTW            GFFHATETSPEDKINVSEIARERIYSILSELSS
Sbjct: 481  RSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINVSEIARERIYSILSELSS 540

Query: 541  VPTGDAHSWQFHIXXXXXXXXXXXXXXXALDEDLTTVKDTGLSVIHSLSVKNDKSSRGIE 600
            VPTGDAHSWQFHI               ALDEDLTTVKDTGLSVIHSLSVKNDKSSRGIE
Sbjct: 541  VPTGDAHSWQFHILNELTTVENELTLTNALDEDLTTVKDTGLSVIHSLSVKNDKSSRGIE 600

Query: 601  SLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKTVLTK 660
            SLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKTVLTK
Sbjct: 601  SLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKTVLTK 660

Query: 661  TSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEKVSGDENEVAPXXXX 720
            TSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEKVSGDENEVAP    
Sbjct: 661  TSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEKVSGDENEVAPEEES 720

Query: 721  XXXXXXXXXXXXXXXXXXXXNKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIXXX 780
                                NKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEI   
Sbjct: 721  ASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDL 780

Query: 781  XXXXXXXXXXXXXXXXXXXGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRM 840
                               GQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRM
Sbjct: 781  EDESSDDESMDDEAMMALDGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRM 840

Query: 841  IDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXX 900
            IDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRP             
Sbjct: 841  IDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKI 900

Query: 901  XXXXXPVSAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDN 960
                 PVSAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDN
Sbjct: 901  FKVKIPVSAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDN 960

Query: 961  KDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQQQ 1004
            KDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQQQ
Sbjct: 961  KDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQQQ 1004

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1033 (44%), Positives = 635/1033 (61%), Gaps = 43/1033 (4%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            M+GKVNRD FYKLAS+L EERLQAAVS+I+ELS+L LP   +EW+YV+ RLIKGLSSDR 
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAP-EELKSMDSFLHLLSKTFSIDP--QDXXXXXXXX 117
            GARLGFSLCLTEV++LAI +       + L ++D +L +LS+T SID   +         
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 118  XXXXLMFGKLFALQALLNEPLFSDIFIKDGKI-TKFTTKFIDELVNLASRKNWIKQPCLF 176
                L+FGK+F L+ALLNEPLFS  F+ + K+ + F  +F+ EL++LASRKNWI++PCLF
Sbjct: 124  DERGLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCLF 183

Query: 177  TLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKG------YSSALLS 230
            TL+QT+E+LLP++D  F+K V+ +LD +K+TLTNEGLAIYLL + KG      ++  +  
Sbjct: 184  TLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIKL 243

Query: 231  INVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL 290
            + + N  WK N+PL +GN               ++ + +  +ANW P+LHFVWDILLP +
Sbjct: 244  LVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDILLPTV 303

Query: 291  YNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLI 350
                 E                  E    I FPEFW+  VDE++F++KASSERK+LG  I
Sbjct: 304  --STIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLGFSI 361

Query: 351  FLKALPTVPSKWIA-CCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKL 409
            F +A+  V +   +  CFSQN MR LINQ SD+ R LHKI+ + + +IVK CE  P  KL
Sbjct: 362  FERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPSTKL 421

Query: 410  VPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAV- 468
            +PV+ ++LF TNGS NFD+LTKSKTV+KLI+  GL   ++ +LF + TS++    +E   
Sbjct: 422  IPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSEDFK 481

Query: 469  -LHFILDTLLHILRSHKLNL----KGEHISTWXXXXXXXXXXXXGFFHATETSP---EDK 520
               FILD+LLHI+RSHK ++     G   +               FF  T+ +    E  
Sbjct: 482  KTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKKEDESD 541

Query: 521  INVSEIARERIYSILSELSSVPTGDAHSWQFH--IXXXXXXXXXXXXXXXALDEDLTTVK 578
              V E+A+ER++S+LSEL++      HSWQ++  +                +D+DL TV+
Sbjct: 542  NQVDELAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKMDDDLKTVR 601

Query: 579  DTGLSVIHSLSVKNDKSS----RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSS 634
            D  + VI  ++ KN+K++    RG+ESLL+MCLLQLYSG+ADSVATI+E+  +    +  
Sbjct: 602  DNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELITFYNASRDV 661

Query: 635  KNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGF 694
            +   ++VGITEILL LLAQKK VL K SLLVWEQ + ++  D LNL+LDVL ARENK+GF
Sbjct: 662  EEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLPARENKQGF 721

Query: 695  SYLFEGAEEYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXX----NKDVTNIDRQ 750
            + LFE A+EYE+   +ENE                               N+ +  ID++
Sbjct: 722  AELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDEGAEGGNEAIAKIDKE 781

Query: 751  TACALAKALKLPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXXGQLADIFKRRK 810
               ALAKAL LP++++NE+GEV F+++                       QLA+IFKRRK
Sbjct: 782  ATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDDQLAEIFKRRK 841

Query: 811  DALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTVS 870
            +ALS V TGN RKIEV++SRESVI FK R+ D+L+IY+K+ E  +L  K  +        
Sbjct: 842  EALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAEDSELPAKYAI-------- 893

Query: 871  TFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAE-DGERFVESLQRIHGTYLLA 929
             F+EPM+KCVQ+TLD+                       E   E+  + +  +H T LL 
Sbjct: 894  LFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITAEQVFDHMTSVHET-LLT 952

Query: 930  EKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDK-KKFPTS 988
             K GQYQ  +YSLCSS SIF  KLL+   ++K+ A+ +++DIY+ETTKKW+ K  KF ++
Sbjct: 953  SKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSETTKKWVLKDSKFGSN 1012

Query: 989  VFFDFYNWLSSKR 1001
            +F DFYNWLSSK+
Sbjct: 1013 IFIDFYNWLSSKK 1025

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1039 (43%), Positives = 633/1039 (60%), Gaps = 59/1039 (5%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            M  KVNRD FYKLASDL EER QAA+SL+KEL++L LP   +EW+YVVNRLIKGL+SDR+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDP----QDXXXXXXX 116
             ARLGFSLCLTEV++LA+ M ++ APE L+++D FL LLSKT S+D     +        
Sbjct: 61   SARLGFSLCLTEVINLALSMKEN-APEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119

Query: 117  XXXXXLMFGKLFALQALLNEPLFSDIFI--KDGK--ITKFTTKFIDELVNLASRKNWIKQ 172
                 L+FGK+F LQA+ NEP+FS +F+  KDGK  IT F  KF++E+V+LA +KNWIK+
Sbjct: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179

Query: 173  PCLFTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALL--- 229
             CLFTL+QTI++LLPY++     +++++LD +  +LT+EGLA+YL  +    +   L   
Sbjct: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239

Query: 230  SINVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXD----DNETKTNNANWHPKLHFVWDI 285
            SI   N GWK N+PL +GN                    +N  K N +NW+P+LHFVWDI
Sbjct: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDI 299

Query: 286  LLPILYNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKF 345
            LLPIL +  +                   E    IEFPEFW+ +VDE++F++KASSERK+
Sbjct: 300  LLPILISG-KHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKY 358

Query: 346  LGLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADP 405
            LG LIF+K +  V    +  CFS N MR LINQ +DS+R LHK+++  L +I++ C+ D 
Sbjct: 359  LGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDS 418

Query: 406  GHKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSEL----- 460
             +KLV  V A++FG +GSINFD+LTKSKT++KLI+   L+  ++  LF LFTS +     
Sbjct: 419  SNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSE 478

Query: 461  NSQKNEAVLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDK 520
            N QKN     ++LDTLLHI+R+HK  L+ + I T               F A E  P   
Sbjct: 479  NKQKN----RYVLDTLLHIVRTHKTGLEYDAIVT-----PLLDPLIQWAFFAKENEP--- 526

Query: 521  INVSEIARERIYSILSELSSV-PTGDAHSWQFHI--XXXXXXXXXXXXXXXALDEDLTTV 577
              ++E+A+ER  SIL+EL+SV P    HSWQ++                   LDE+L  +
Sbjct: 527  --LNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKI 584

Query: 578  KDTGLSVIHSLSVKNDKSSR--GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSK 635
            K+    VI  + +K+ +S +  G+ESLL+MCLLQL+SGE +S++TI+E+ ++  E K   
Sbjct: 585  KNDACDVIVKI-IKSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDT 643

Query: 636  NSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFS 695
             S SLVGITEILL LLAQKK VL K SL+VWEQ I +VG +ELN++LDVL ARENK+GF+
Sbjct: 644  ESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFA 703

Query: 696  YLFEGAE----EYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXXNKDVTNIDRQT 751
            +LFEGA+      ++  G+ N+                             +V NID++ 
Sbjct: 704  HLFEGADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNIDKEA 763

Query: 752  ACALAKALKLPENVVNEDGEVKFNEIXX-------XXXXXXXXXXXXXXXXXXXXGQLAD 804
              ALAKAL LPEN+VN+ GEV   ++                              QL++
Sbjct: 764  TSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQLSE 823

Query: 805  IFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKE 864
            IFKRRK+ALS   TGN RKIE ++SRE+VI FK R++D+LT+YVKYVEKL   D     +
Sbjct: 824  IFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHS---Q 880

Query: 865  KLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPV--SAEDGERFVESLQRI 922
            K   + +FVEPM+ CVQ+TLD+                       ++ +    +E L+++
Sbjct: 881  KFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVEVLEYLKKL 940

Query: 923  HGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDK 982
            H   LL EK GQ+  +YY+L SSAS+FF K+ + S  ++  A+N++ID Y+ TTK WM K
Sbjct: 941  HEK-LLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSK 999

Query: 983  KKFPTSVFFDFYNWLSSKR 1001
             KF  + F DF+NWL+S++
Sbjct: 1000 SKFGPNFFADFFNWLASRK 1018

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1017

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1042 (43%), Positives = 617/1042 (59%), Gaps = 66/1042 (6%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTG+VNRD FYKLASDL EER+QAAV+LI+ELS+L LP    EWSYV+ RLI GLSS RN
Sbjct: 1    MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDP--QDXXXXXXXXX 118
             ARLGFSLCLTEV++LA+ ++ D+ PEEL S+D+FL LLS T S+ P  QD         
Sbjct: 61   SARLGFSLCLTEVINLALNLEGDR-PEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKD 119

Query: 119  XXXLMFGKLFALQALLNEPLFSDIFI-KDGKITKFTTKFIDELVNLASRKNWIKQPCLFT 177
               L+FGK+F LQALL+EPLF  +FI K+  I+ F  +F+DEL  LA  K+W+++PCLFT
Sbjct: 120  ERGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFT 179

Query: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKG---YSSALLSINVT 234
            L+Q  ER+LP +D    + V+ +LD  + TLTNEGLAIYLL + K    YSS++L ++  
Sbjct: 180  LFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDFE 239

Query: 235  NKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPILYND- 293
            +K WK N+PL +GN               +D E+    +NW P+LHFVWDILLPI+  D 
Sbjct: 240  SKSWKSNDPLARGNLPLLSQVLRDSSVATED-ESSPKASNWTPRLHFVWDILLPIITQDN 298

Query: 294  PREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLK 353
             R E                 E   AI+FPEFW+  VDE+ F++KAS+ERKFLGL+IF K
Sbjct: 299  SRRES----EDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQK 354

Query: 354  ALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVV 413
            AL   P K + CCFSQN+MR LIN  SDS+R L KI+ K L SIV  C+  P  KLVP +
Sbjct: 355  ALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCL 414

Query: 414  GALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTS-----ELNSQKNEAV 468
             A+LFG +GSINFD+LTKSKT   L+A  GL++ ++ +LF L +S      L  QKN+  
Sbjct: 415  SAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQ-- 472

Query: 469  LHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIAR 528
              FILDT+LH +RSHK  L  + I T              FF   +       + S +A+
Sbjct: 473  -QFILDTMLHAVRSHKSELNKDIIVT----SILRPIISLAFFTVKDE------HTSNLAK 521

Query: 529  ERIYSILSELSSVPTGDAHSWQFHIXXXXXXXXXXXXXXXALDEDLTTVKDTGLSVIHSL 588
            ER YSILSE++ +           +                LD+ L  VK   L  + ++
Sbjct: 522  ERFYSILSEITHLNNEGPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQAI 581

Query: 589  SVKNDKSS--RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEI 646
            S  N+K+   RG+E L++MCLLQLYSGE+++V+ I+E+C +   + + +NS SLVGITEI
Sbjct: 582  S-NNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFY--QDTDENSTSLVGITEI 638

Query: 647  LLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEK 706
            LL LLAQKK VL K SL  W+Q + ++G  EL  +LDVL ARENK+GFS LFEG +++E+
Sbjct: 639  LLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFEGEDDFEE 698

Query: 707  VSGDENEVAPXXXXXXXXXXXXXXXXXXXX---------XXXXNKDVTNIDRQTACALAK 757
               + +E A                                    DV  ID++   ALAK
Sbjct: 699  AEEEFDEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDSNENQDDVAKIDKEATSALAK 758

Query: 758  ALKLPENVVNEDGEVKFNE----------------IXXXXXXXXXXXXXXXXXXXXXXGQ 801
            AL LP+N+VN+ GEV  N                 +                       Q
Sbjct: 759  ALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDEDSMDDEKMMELDDQ 818

Query: 802  LADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDV 861
            L+ IFKRRKDALS++ TGN RK E ++SRE VI FKQR+IDML IYVK+VEK  L++++ 
Sbjct: 819  LSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVKFVEKQSLKEENY 878

Query: 862  MKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPV--SAEDGERFVESL 919
               K+ +    +EPM+KC+Q+T D+                        + D +  +E L
Sbjct: 879  --SKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTSAFCGSCDQDELMEML 936

Query: 920  QRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKW 979
            +  H   +   K GQ+QAIYYS+CS+AS+F  K++IE+ D+KDAA +++ID+YAET K+W
Sbjct: 937  RMTH-EKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKDAAVHDIIDLYAETMKQW 995

Query: 980  MDKKKFPTSVFFDFYNWLSSKR 1001
                KF  ++F DF NWLSS++
Sbjct: 996  ASNGKFGPNIFIDFSNWLSSRK 1017

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1030 (43%), Positives = 624/1030 (60%), Gaps = 45/1030 (4%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP+  +EWSYV+NRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXX-XXXXXX 119
             ARLGFSLCLTEVV+L I M   + P+ L+S + FL  LS    I   D           
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120

Query: 120  XXLMFGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFT 177
              ++FGKLF L++LLNEPLFS+IF+ D K   T+F  +F+++L++LA RKNWI++PCLF+
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLS-INVTNK 236
            L+QTI+ LLP+ ++S    ++ + D    TLTNEGL+ YL+   +   S + S +++ N 
Sbjct: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240

Query: 237  GWKYNNPLLKGNXXXXXXXXXXXXXXXDDN-----ETKTNNANWHPKLHFVWDILLPILY 291
            GWK N+PL +GN               D N       K  NANW+P+LHFVWD+LLP+  
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300

Query: 292  NDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351
            +   E                  +   +I+FPEFWK  VDE++F++KASSERK+LG LI 
Sbjct: 301  SGKLEN---TEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357

Query: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411
                 TVP   I  CFSQN+MR LINQ  DS+R L+KIA+  L SIVK CE DP  KLVP
Sbjct: 358  DATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVP 417

Query: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-AVLH 470
             + A+LFG +GSINFD+LTKS  ++KLIA K L    + +L + F  +L  ++ +    H
Sbjct: 418  CLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTH 477

Query: 471  FILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFF-HATETSPEDKINVSEIARE 529
            FILD+LLHI+R+HK+ +    I                FF HAT+    ++++  E+A+E
Sbjct: 478  FILDSLLHIIRAHKVEINDVGI----IKPVLTPIIHMAFFKHATDEQEFEQLH--ELAKE 531

Query: 530  RIYSILSELS---SVPTGDA--HSWQFHIXXXX--XXXXXXXXXXXALDEDLTTVKDTGL 582
            R+YSIL EL+    V + D   +SWQ+                    LDE L  +K+  +
Sbjct: 532  RLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAI 591

Query: 583  SVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVG 642
            S +  +S  N   S G+ +LL+MCL+QLY+GE DS++ I+E+C++   + +     S+VG
Sbjct: 592  SSLAEISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNN-----SMVG 646

Query: 643  ITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAE 702
            ITEILL  LAQKK +L K SL++W+Q IEDVG +EL ++LDVL ARENK+GF+ LFEG  
Sbjct: 647  ITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFEGEG 706

Query: 703  EYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXX--XXXXNKDVTNIDRQTACALAKALK 760
            E+E+++ +EN                              N+DV NID++   AL KAL 
Sbjct: 707  EFEEINEEENANEGDSKSESESESESDSDESNEKDEEDEANEDVVNIDKEATGALIKALH 766

Query: 761  LPENVVNEDGEVKFNEI--XXXXXXXXXXXXXXXXXXXXXXGQLADIFKRRKDALSHVPT 818
            LP+N+VN+ GEV  N++                         QL++IFKRRK+ALS++ T
Sbjct: 767  LPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSNIST 826

Query: 819  GNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKL----DLEDKDVMKEKLQTVSTFVE 874
            GN RK+EV++SRE+VI+FK R++DMLT+YVKY EKL     +E+   ++  L  +  F+ 
Sbjct: 827  GNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIV 886

Query: 875  PMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVESLQRIHGTY--LLAEKS 932
            PMLKC++ TLD+P                    + +  ++ +E +  +  T+  +L  K 
Sbjct: 887  PMLKCIRETLDKPLADKISKLLKGKIFKIKAN-TFKILDKNIELMNLLKSTHELMLTSKP 945

Query: 933  GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFD 992
            GQ+ ++++S CS++S+F  KL  E   N   A +E+ID+YA TTK+WM K KF T+VF D
Sbjct: 946  GQHASVFFSACSTSSLFLSKLYFEIGGNN--ALDELIDLYAATTKEWMLKGKFSTNVFID 1003

Query: 993  FYNWLSSKRQ 1002
            F NWLSSK+Q
Sbjct: 1004 FTNWLSSKKQ 1013

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1034 (42%), Positives = 616/1034 (59%), Gaps = 50/1034 (4%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP   +EWSYV+NRLIKGLSSDRN
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXX-X 119
             ARLGFSLCLTEV++LA+ M   + P+ L+S + FL  LS   +++  +           
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 120  XXLMFGKLFALQALLNEPLFSDIFIKD--GKITKFTTKFIDELVNLASRKNWIKQPCLFT 177
              ++FGKLF L++LLNEPLFS+IF+KD     T+F  +F ++L++LA +KNWIK+PC FT
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSI-NVTNK 236
            L+QT++ LLP+ D+S  + ++ + D    TLTNEGL+ YLL   +G  S + S+ ++ N 
Sbjct: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240

Query: 237  GWKYNNPLLKGNXXXXXXXXXXXXXXXDDN----ETKTN-NANWHPKLHFVWDILLPILY 291
            GWK N+PL +GN               D N    ETK   N NW+P+LHFVW +LLP+  
Sbjct: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300

Query: 292  NDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351
            N   E                  +   +I+FPEFWK  VDE++F++KASSERK+LG LI 
Sbjct: 301  NGKLEN---TSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357

Query: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411
              A   VP  +I  CFSQN+MR LINQ  DS+R L+KI++  L SIVK CE D  ++LVP
Sbjct: 358  DAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVP 417

Query: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVLH- 470
             + A+LFG +GSINFD+LTKS TV+KLIA K L    + +L  +F  +L  +K   + H 
Sbjct: 418  CLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKG-VLSHT 476

Query: 471  -FILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKI-NVSEIAR 528
             F LD++LHI+R+HK+ +    I                FF    TS + K+  + E+A+
Sbjct: 477  LFALDSILHIVRAHKVEINDMDI----MKPVLRPIVYMAFFK--HTSDDLKLEQLHELAK 530

Query: 529  ERIYSILSELS-----SVPTGDAHSWQFHIXXXXXXXXXXXX--XXXALDEDLTTVKDTG 581
            ER+YSIL EL+          + +SWQ+                    LDE+L  +K+  
Sbjct: 531  ERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEA 590

Query: 582  LSVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLV 641
            +S +  +       S G+ +LL+MCL+QLY+G+ DS++ I+E+C++   E +     S+V
Sbjct: 591  ISCLSKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENN-----SMV 645

Query: 642  GITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGA 701
            GITEILL LLAQKK +L K SL++W+Q IE+VG +EL ++LD+L ARENK+GF+ LFEG 
Sbjct: 646  GITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFEGE 705

Query: 702  EEYEKV----SGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXXNKDVTNIDRQTACALAK 757
            EE+E++       E+E                           N+D+ NID++   AL K
Sbjct: 706  EEFEEIKEENDASEDESKTGSESESESESDSDDADEKDEEDEANEDILNIDKEATSALVK 765

Query: 758  ALKLPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXX---GQLADIFKRRKDALS 814
            AL LP+N+VN+ GEV  +++                          QL++IFKRRK+ALS
Sbjct: 766  ALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLSEIFKRRKEALS 825

Query: 815  HVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDK----DVMKEKLQTVS 870
             + TGN RK EV+ SRE+VI+FK R++DML +YVKY EKL L +K    + +   L  + 
Sbjct: 826  SISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLV 885

Query: 871  TFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVESLQRIHGTY--LL 928
             F+ PMLKCV  TLDRP                    + +D  + +E +  +  T+  +L
Sbjct: 886  YFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKV-TAFKDMNKDIELMDLLKKTHKLML 944

Query: 929  AEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTS 988
              K GQ+ A++YS+CS++S+F  KL +E   N     +E+ID+Y  TTK+WM K K   +
Sbjct: 945  TSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKL--DELIDLYTATTKEWMQKGKCGPN 1002

Query: 989  VFFDFYNWLSSKRQ 1002
            +F DF NWLSSK+Q
Sbjct: 1003 IFIDFINWLSSKKQ 1016

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
            gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
            weakly similar to YEL055C uniprot|P39985 Saccharomyces
            cerevisiae
          Length = 1039

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1061 (40%), Positives = 617/1061 (58%), Gaps = 85/1061 (8%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            M GKVNRD FY+LASDL +ER++AAVSLI+ELS+L LPA  +EWSYV+ RLI GL+S RN
Sbjct: 1    MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDK---APEELKSMDSFLHLLSKTFSIDP-QDXXXXXXX 116
             ARLGFSLCL+EVV +A+    DK   AP++L S D +L LLS   S D           
Sbjct: 61   SARLGFSLCLSEVVKMAL----DKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKG 116

Query: 117  XXXXXLMFGKLFALQALLNEPLFSDIFI-KDGKITKFTTKFIDELVNLASRKNWIKQPCL 175
                 ++FGK+F LQA+LNEPLF+ IF  ++GK++ F  +F  EL  LA +KNW+++ CL
Sbjct: 117  KDERGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCL 176

Query: 176  FTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTN 235
            +TL+QT++RL+P  +   V +++ +LD  + T+TNEGLAIYLL           S  V +
Sbjct: 177  YTLFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPS 236

Query: 236  K------GWKYNNPLLKGNXXXXXXXXXXXXXXXDDNE----TKTNNANWHPKLHFVWDI 285
                    WK N+PL KGN               +D+E    +   +ANW+P+LHFVWDI
Sbjct: 237  SLALEFAAWKNNDPLSKGNLPQLSRVLRDAPA--NDSEVADGSHPKSANWNPRLHFVWDI 294

Query: 286  LLPILYNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKF 345
            L+PIL     +E +               + V  IEFPEF++A VDET+FS+KASSERK+
Sbjct: 295  LIPILAPGKSDEEIPSKKSHKKKKK----DTVEGIEFPEFFQAAVDETFFSEKASSERKY 350

Query: 346  LGLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADP 405
            LG L+F++A+  V S+WI  CF+QN MR LINQ SDS+R L+KI++K L +IVK CE D 
Sbjct: 351  LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410

Query: 406  GHKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQK- 464
              K+   + A+LFG +G+I+FD+LTKSKT +KL+A K +    + +LF + +++L+ ++ 
Sbjct: 411  SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470

Query: 465  -NEAVLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINV 523
             N+    F+LDT+LH +R+H+L +  E I+               FF       ED   +
Sbjct: 471  PNKQHYQFVLDTVLHAVRTHRLEISQELIA----HPLLDSIVTLAFFS---KKGED---I 520

Query: 524  SEIARERIYSILSELSSVPTGDAHSWQ-FHIXXXXXXXXXXXXXXXALDEDLTTVKDTGL 582
            S++ARER++SILSEL+     D  SWQ + +                LDEDL  ++   L
Sbjct: 521  SDLARERLFSILSELTI--QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEAL 578

Query: 583  SVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVG 642
             ++ ++S  +   SRG+E LL+ CLLQLYSG+++S++ ++E+C +  E  +  N  SLVG
Sbjct: 579  DILQNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESN--SLVG 635

Query: 643  ITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAE 702
            ITEILL LLAQKK +L K SL+VWEQ + +VG  EL ++L+VL ARENKEGF+ LFE  +
Sbjct: 636  ITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFENVD 695

Query: 703  EYEKVSGDENEVAPX------------------XXXXXXXXXXXXXXXXXXXXXXXNKDV 744
            +Y++ S  E E                                             + +V
Sbjct: 696  DYQEESAGEEEDLEDGEGKSKKSDDKSKSGNDPSDESEDASSASEEDSSDDSDAEDDSNV 755

Query: 745  TNIDRQTACALAKALKLPENVVNEDGEVKFNEIXXXXXX-----------------XXXX 787
              IDR+   ALAKAL LPEN+VN+ GEV    +                           
Sbjct: 756  AKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEEE 815

Query: 788  XXXXXXXXXXXXGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIY 847
                         QL+ IFKRRK+ALS V TGN RK+EV+++RE+VI FK R++DML  Y
Sbjct: 816  ESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEAY 875

Query: 848  VKYVEKLDLEDKD---VMKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXX 904
            +K+ +++ L+D +     K+  + +  FVEPM++C+Q TLD+P                 
Sbjct: 876  IKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIK 935

Query: 905  XPV--SAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKD 962
                  A D +R +E L+  H   LL  K GQ+ A+Y+S CS+ S+F  K+L+E+     
Sbjct: 936  ISAFKGAIDSKRLLEQLEVTHKA-LLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDP 994

Query: 963  A-AHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQ 1002
            A ++ ++ID+YA+TTK+W+   KF  +VF DF+NWL S+++
Sbjct: 995  AISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1030 (42%), Positives = 617/1030 (59%), Gaps = 44/1030 (4%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LI++LS+L LP+  +EW YV+NRL+KGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXX-X 119
             ARLGFSLCLTEV++LAI M   + P+ L+S + FL+ LS    ++  D           
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDE 120

Query: 120  XXLMFGKLFALQALLNEPLFSDIFIKD--GKITKFTTKFIDELVNLASRKNWIKQPCLFT 177
              ++FGKLF L++LLNEPLFS+IFIK+     T F  +F +EL++LA +KNWIK+PC FT
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLS-INVTNK 236
            L+QTI+ LLP+ D+S    ++ + D    TLTNEGL+ YLL    G  + + S +++ N 
Sbjct: 181  LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL 240

Query: 237  GWKYNNPLLKGNXXXXXXXXXXXXXXXDDN-----ETKTNNANWHPKLHFVWDILLPILY 291
            GWK ++PL +GN               D +       K  N NW+P+LHFVWDILLP+  
Sbjct: 241  GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLPLFG 300

Query: 292  NDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351
            +   E                  +   +I+FPEFWK  +DE++F++KASSERK+LG LI 
Sbjct: 301  SGKLEN---TEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLII 357

Query: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411
              A  TVP  +I  CFSQN+MR LINQ  DS+R L+KIA+  L SIVK CE D  +KLVP
Sbjct: 358  DAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVP 417

Query: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAV-LH 470
             + ++LFG +GS+NFD+LTKS TV+KLIA K L    + +L  +F  +L   K +    H
Sbjct: 418  CLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDLTHTH 477

Query: 471  FILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIARER 530
            FILD++LHI+R+HK+ +    +                FF    T  ++   + E+A+ER
Sbjct: 478  FILDSILHIIRAHKVEIDDMDV----MKPILTPIIYMAFFKDA-TDDQELEQLHELAKER 532

Query: 531  IYSILSELS---SVPTGDA--HSWQFHIXXXX--XXXXXXXXXXXALDEDLTTVKDTGLS 583
            ++SIL EL+    + + D   +SWQF                    LDE+L   K+  +S
Sbjct: 533  LFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAIS 592

Query: 584  VIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGI 643
             +  +S  +   + G+ +LL+MCL+QLY+GE DS++ I+E+C++     S   + S+VGI
Sbjct: 593  SLAEISRSSTAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEF-----SKDKNNSMVGI 647

Query: 644  TEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEE 703
            TEILL LLAQKK +L K SL++W+Q IEDVG +EL ++LDVL ARENK+GF+ LFEG  E
Sbjct: 648  TEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQLFEGEGE 707

Query: 704  YEKVSGDENEVAPXXXXX--XXXXXXXXXXXXXXXXXXXNKDVTNIDRQTACALAKALKL 761
            +E++  +E+                              N++V NID++   AL KAL L
Sbjct: 708  FEEIKEEESASEDESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEATSALVKALNL 767

Query: 762  PENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXX---GQLADIFKRRKDALSHVPT 818
            P+N+VN+ GEV  +++                         GQL++IFKRRK+ALS++ T
Sbjct: 768  PDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFKRRKEALSNIST 827

Query: 819  GNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDL----EDKDVMKEKLQTVSTFVE 874
            GN RK+EV++SRE+VI+FK R++DMLT+YVKY EKL L    ED   +   L  +  F+ 
Sbjct: 828  GNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIGSPLSKLVYFII 887

Query: 875  PMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVESLQRIHGTY--LLAEKS 932
            P+LKC+  TLDRP                      E  ++ +E +  +  T+  LL  K 
Sbjct: 888  PILKCINETLDRPLADKISKLLKGKIFKIKVNAFKE-MDKNIEVMDLLKSTHKVLLTSKP 946

Query: 933  GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFD 992
            GQ+ A++YS CS++S+F  KL +E   N     +E+ID+YA TTK+W ++ KF  +VF D
Sbjct: 947  GQHPAVFYSACSTSSLFLSKLYVEIHGNDKL--DELIDLYAATTKEWTNRGKFGANVFID 1004

Query: 993  FYNWLSSKRQ 1002
            F NWLSSK+Q
Sbjct: 1005 FINWLSSKKQ 1014

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1035 (42%), Positives = 615/1035 (59%), Gaps = 50/1035 (4%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP+  +EWSYV+NRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXX-XXXXXX 119
             ARLGFSLCLTEV++LA+ M   + P+ L+SM+ FL  LS    I+  +           
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120

Query: 120  XXLMFGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFT 177
              ++FGKLF L++LLNEPLFS IF++D K   T+F  +F+++L++LA RKNWIK+PCL++
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLS-INVTNK 236
            L+QTI+ LLP  ++S    ++   D    TLTNEGL+ YLL   +     + S + + N 
Sbjct: 181  LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 237  GWKYNNPLLKGNXXXXXXXXXXXXXXXD------DNETKTNNANWHPKLHFVWDILLPIL 290
            GWK N+PL +GN               D      DN  K  N NW+P+LHFVW+ILLP+ 
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300

Query: 291  YNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLI 350
             +   E                  +   +I+FPEFW+  VDE++F++KASSERK+LG LI
Sbjct: 301  GSGKLEN---AEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLI 357

Query: 351  FLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLV 410
                  TVP   I  CFS+N+MR LINQ  DS+R L+KIA+  L SI+K CE DP +KLV
Sbjct: 358  IDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLV 417

Query: 411  PVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAV-L 469
            P + A+LFG +GSINFD+LTK+   +KLIA K L    + +LF LF  +L  +K++    
Sbjct: 418  PCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDDLPHT 477

Query: 470  HFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFF-HATETSPEDKINVSEIAR 528
            HF+LD+LLHI+R+HK  +    I                FF HAT+    ++++  E+A+
Sbjct: 478  HFVLDSLLHIIRAHKAEINDVEI----IKPVLSPIVYMAFFKHATDDKESEQLH--ELAK 531

Query: 529  ERIYSILSELS---SVPTGDA--HSWQFHIXXXXXXXXXXXX--XXXALDEDLTTVKDTG 581
            ER+YSIL EL+    + + D   +SWQF                    LDE L   K+  
Sbjct: 532  ERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEA 591

Query: 582  LSVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLV 641
            +S +  +S  N   S G+ +LL+MCL+QLY+GE DS++ I+E+C++  +E SS     +V
Sbjct: 592  ISSLTEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSS-----MV 646

Query: 642  GITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGA 701
            GITEILL LLAQKK +L K SL++W+Q I DVG  EL ++LDVL  RENK+GF+ LFEG 
Sbjct: 647  GITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLFEGE 706

Query: 702  EEYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXXNKD--VTNIDRQTACALAKAL 759
             E+E+V  +E+ V                            +  V NID++   AL KAL
Sbjct: 707  GEFEEVDEEESAVEDESKSESESDSDSESNDDEERDEEDEANEDVVNIDKEATSALIKAL 766

Query: 760  KLPENVVNEDGEVKFNEI------XXXXXXXXXXXXXXXXXXXXXXGQLADIFKRRKDAL 813
             LP+N+VN+ GEV  +++                             QL++IFKRRK+AL
Sbjct: 767  NLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLSEIFKRRKEAL 826

Query: 814  SHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMK----EKLQTV 869
            S + TGN RK+EV++SRE+VI FK R++DMLTIYVK+ EKL + +K  +       L  +
Sbjct: 827  SSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNL 886

Query: 870  STFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVESLQRIHGTY--L 927
              F+ PM+KC++ TLDRP                    + +D ++ +E L  +   +  +
Sbjct: 887  VYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTS-AFKDLDKTIELLDLLKSAHKEM 945

Query: 928  LAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPT 987
            L  K GQ+  +++S CS++S+F  KL ++   N +   +++ID+YA TTK+W  K KF  
Sbjct: 946  LTSKPGQHANVFFSACSTSSLFLSKLYVDI--NGNDKFDDLIDLYASTTKQWTQKGKFGA 1003

Query: 988  SVFFDFYNWLSSKRQ 1002
            ++F DF NWLSSK++
Sbjct: 1004 NIFIDFINWLSSKKE 1018

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5 DNA
            polymerase V
          Length = 1021

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1033 (39%), Positives = 600/1033 (58%), Gaps = 51/1033 (4%)

Query: 3    GKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGA 62
             KVNRDHFYKLASDLPEERLQAAV +IK+LS+L +P   +EW+Y +NRL+KGL S RN A
Sbjct: 2    AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63   RLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXXXL 122
            RLGFS+CL+E ++LA+ + D KAPE L S++++L +L++T   D  D            +
Sbjct: 62   RLGFSMCLSEALNLALSLGD-KAPEGLNSIENYLKILNETLGADF-DEGKKRKGKDERGI 119

Query: 123  MFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQTI 182
            +FGKLF LQALLNEPLFS++F+    I+ F   F+ E++NL+  KNWI++P LF+LYQT+
Sbjct: 120  LFGKLFGLQALLNEPLFSNVFVTKDGISNFVPVFVQEMINLSKCKNWIREPALFSLYQTL 179

Query: 183  ERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFI---SKGYSSALLSINVTNKGWK 239
            E+L+     S +  +++ LD N  T+TNEGLAIYLL +   +K   + +  I + N+GWK
Sbjct: 180  EKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQGWK 239

Query: 240  YNNPLLKGN--XXXXXXXXXXXXXXXDDNETKTN--NANWHPKLHFVWDILLPILYNDPR 295
             N+PL KGN                 +DNE +     ANW+P+LHFVW+ LL  + N   
Sbjct: 240  SNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTIINGSH 299

Query: 296  EEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKAL 355
                                 + +I+F EFW+ +VDETYF+DKASSERK+LG LIF +A 
Sbjct: 300  S---LNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQRAF 356

Query: 356  PTVPS-KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVG 414
            P + S + +     QN +R LINQCS+ +RHL+KIA + +  IV++CE D   K++PV  
Sbjct: 357  PMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KILPVFE 415

Query: 415  ALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVL-HFIL 473
             L FG +GSI FDRL+K+K +++L+  K +  + + KLF + + +L+ +  E     FIL
Sbjct: 416  TLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQFIL 475

Query: 474  DTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIARERIYS 533
            D++LH++R    N K E  S               FF        D   + E+++ER++S
Sbjct: 476  DSMLHLVR----NQKAEVDSLLLTEKVLPQIVKLAFFTG------DNETLQEMSKERLFS 525

Query: 534  ILSELSSVPTGDAHSWQFH--IXXXXXXXXXXXXXXXALDEDLTTVKDTGLSVIHSLSVK 591
            ILSEL+S+   ++     +  I                LD++L   + + L ++  ++  
Sbjct: 526  ILSELNSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKA 585

Query: 592  NDKSS-RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGL 650
             DK   RG+ SL A CLLQLY+G+++SV T++E+ D + E+  S +   L  ITEILL L
Sbjct: 586  TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKD-IYEKLISDDERPLSSITEILLSL 644

Query: 651  LAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAE-------- 702
            LAQKK +L K S+ VWEQ++  V  DELNL+LD+L ARENK+GF+ LFEG +        
Sbjct: 645  LAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLFEGIDEYEEDEDD 704

Query: 703  -------EYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXXNKDVTNIDRQTACAL 755
                   + ++V+ D +  +                         N  V NID++T  AL
Sbjct: 705  EQLEDEEQIKEVTDDSSSNSESDSEEDEDNSDSHEDTSSDSVEDHNDAVNNIDKETTSAL 764

Query: 756  AKALKLPENVVNEDGEV---KFNEIXXXXXXXXXXXXXXXXXXXXXXGQLADIFKRRKDA 812
            AKAL LP +++N +GEV   K                           QL++IFKRRK+A
Sbjct: 765  AKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDDQLSEIFKRRKEA 824

Query: 813  LSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKL---DLEDKDVMKEKLQTV 869
            LS++PTGN RK EV++SRESVI FK R++D+L +Y+K+VEK+   +  D++   +KL  +
Sbjct: 825  LSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDENSKADKLNCL 884

Query: 870  STFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVESLQRIHGTYLLA 929
             TF  PM+KC+++TLD+                        D    VE  QRIH  +L A
Sbjct: 885  LTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTADVVEDFQRIHQDFLFA 944

Query: 930  EKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSV 989
             K GQ+  +YYS+CSS S++F K+L+++ D +   +  ++D Y+ T K+W+   KFP S+
Sbjct: 945  -KPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTTIKEWLKDTKFPHSI 1003

Query: 990  FFDFYNWLSSKRQ 1002
            F DF NWL+SK+Q
Sbjct: 1004 FLDFVNWLASKKQ 1016

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1067 (38%), Positives = 593/1067 (55%), Gaps = 89/1067 (8%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            M  K+NRD FYKLASDL EER+QAA+SLIKEL+SL    +  EW YV+NRLIKGLSS+RN
Sbjct: 1    MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXX 120
             ARLGFSLCLTEV+ +A++         L S++ ++ LL  T   +              
Sbjct: 59   SARLGFSLCLTEVLSVALEKG------YLNSIEEYIQLLQSTLLKE-----TVKNGKEER 107

Query: 121  XLMFGKLFALQALLNEPLFSDIFI-KDGKI-TKFTTKFIDELVNLASRKNWIKQPCLFTL 178
             L+FG++F LQALLNEPL S IF+ K G +   F   F+ ELV +A  K WI++PCLFTL
Sbjct: 108  GLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTL 167

Query: 179  YQTIERLLPYSDDSF-VKTVVTVLDVNKYTLTNEGLAIYLLFI--SKGYS-----SALLS 230
            +Q +E+L P+ +D+  ++++  +LD NK +LTNEGLAIYL  I    G S     S LL 
Sbjct: 168  FQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLK 227

Query: 231  INVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL 290
                N  WK N+PL KGN               D    +    +W P+LHFVW+I+LPIL
Sbjct: 228  NLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ--KGSWAPRLHFVWNIILPIL 285

Query: 291  YNDPREEPLXXXXXXXXXXXXXXXEA-VGAIEFPEFWKAIVDETYFSDKASSERKFLGLL 349
              D + E                 +  V  IEFPEFWKA+VDE++F++K+S ERK+LG L
Sbjct: 286  ARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFL 345

Query: 350  IFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKL 409
            I   A   VP   ++  FS+NLMR LINQ SDS+R LHKI++K L SI++ CE+ P  K 
Sbjct: 346  ILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHP-DKT 404

Query: 410  VPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE--A 467
            VP + A+LF  NG+INFD+LTK+KTV  L+A   +    +  L  LF S L    NE  A
Sbjct: 405  VPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAA 464

Query: 468  VLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHAT------ETSPEDKI 521
            +  F+LD++LH++R+HK         TW            GFF  +      E   +D  
Sbjct: 465  LTRFLLDSMLHVVRTHK----TVSDKTWVKPLITSVISM-GFFKTSPAKVDQENQDDDHT 519

Query: 522  NVSEI-ARERIYSILSELSSVPTGDAHS--WQFHIXXXXXXXXXXXXXXXALDEDLTTVK 578
            +  E  ARER+YSIL++L  +     HS  W +                  LD+ L  +K
Sbjct: 520  DGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIK 579

Query: 579  DTGLSVIHSL--SVKNDKSSR---GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKS 633
               L+ +  +   ++ND S+    G+E LL+M +LQ+Y G+ +S++ ++++  +    + 
Sbjct: 580  LDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRD 639

Query: 634  SKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEG 693
            S    SL+G+ EILL LLAQKK +L + SLLVWE  ++ VG+ EL ++ D+LSARENKEG
Sbjct: 640  SSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEG 699

Query: 694  FSYLFEGAEEY---------EKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXX----- 739
            F+ LFE  ++Y          +  G+E E A                             
Sbjct: 700  FTALFEAEDDYMDEEDDEEASQAQGEEGENASDTVNSGEEEEEEEEEEEEEEEEEEEGEE 759

Query: 740  ---------------XNKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEI-----XX 779
                            N+D+  ID++T  ALAKAL LP+ ++NE+GEV FNE+       
Sbjct: 760  EEEEEGDDQSEDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDED 819

Query: 780  XXXXXXXXXXXXXXXXXXXXGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQR 839
                                 QL+ IF+RRK+ALS + TGN RK+E ++SRE+VI FK +
Sbjct: 820  ESEEDEDEESMDDEKMMELDDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHK 879

Query: 840  MIDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXX 899
            ++DML ++VK+VE+   ++K+  + +L++V++  +P++KCVQ+T D+             
Sbjct: 880  VVDMLEVFVKFVERTS-KNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNR 938

Query: 900  XXXXXXPVSAEDG----ERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLI 955
                  P    D     E  + +L  +H   +LA+K GQ+  +Y+S CS  S+F  KLL+
Sbjct: 939  MCKLKLPKLINDSDDIEELTISNLGAVH-RLMLADKCGQFPNLYFSTCSVVSLFLSKLLV 997

Query: 956  ESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQ 1002
            ++  N D+ ++ +IDIY  T KKW  K KF TS FFDF NWL+SK+Q
Sbjct: 998  QASTN-DSIYDRLIDIYLSTMKKWFSKGKFGTSFFFDFINWLASKKQ 1043

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1051 (39%), Positives = 595/1051 (56%), Gaps = 78/1051 (7%)

Query: 4    KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGAR 63
            +VNRD FY+LASD+ EER++AAV ++ ELS +    ++ EW YV+ RLIKGL+S R GAR
Sbjct: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64   LGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXXXLM 123
            LGFS+CL+EVV L ++         L+S++ ++  L +  +                 L+
Sbjct: 63   LGFSMCLSEVVTLGLEKG------RLESVEVYIGQLFEKLA-----DGHVKNGKEERGLV 111

Query: 124  FGKLFALQALLNEPLFSDIFIKDGKIT--KFTTKFIDELVNLASRKNWIKQPCLFTLYQT 181
            FGKLF LQALLNEPLF  IF+ DGK+   +FT  F+D LV LA  K W+++PCLFTLYQ 
Sbjct: 112  FGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQL 170

Query: 182  IERLLP-YSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFI-------SKGYSSALLSINV 233
            IE+L   +++   ++ +  +LD +K TLTNEGLAIYLL I       S    S +LS   
Sbjct: 171  IEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKIT 230

Query: 234  TNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPILYND 293
                WK N+PL KGN               D+        +W P+LHFVWDIL+PIL   
Sbjct: 231  LRSCWKNNDPLSKGNVTILSSVLKDIIPVEDN--VMKQKGSWAPRLHFVWDILIPILCRQ 288

Query: 294  PREEP--LXXXXXXXXXXXXXXXEAVGA-IEFPEFWKAIVDETYFSDKASSERKFLGLLI 350
             +E P                  E V A + F EFW+ +VDE++F+ KASSERK+LGLLI
Sbjct: 289  -QEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLI 347

Query: 351  FLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLV 410
              KA+  VPS ++   FS+N+MR LINQ S+S R+LHKI+   L +IV  CE+DP  K++
Sbjct: 348  IEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT-KVL 406

Query: 411  PVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-AVL 469
            PVV +L FG NGSINFD LTKSKT+  +IA +GL+ + +  L AL  SE++ + +  + +
Sbjct: 407  PVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKV 466

Query: 470  HFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPE----------- 518
             ++LD LLHI+++HK  LK +   T              FF+   +  E           
Sbjct: 467  RYLLDILLHIVQAHK--LKADMFWT---KPLLSSIVKLSFFNDKLSDFEDVDLDAHADAD 521

Query: 519  -DKINVSEIARERIYSILSELSSVPTG----DAHSWQFHIXXXXXXXXXXXXXXXALDED 573
             +   +  ++RER++SIL +L  +PT     D  +W +                  LDE+
Sbjct: 522  AESKKIPVLSRERLFSILGQL--IPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEE 579

Query: 574  LTTVKDTGLSVIHSLSVKNDKSSRG-----IESLLAMCLLQLYSGEADSVATIKEICDYL 628
            L   K+  L  I+ +  K+ +S +      +E LL + +LQ+YSG+A+S + ++E+  + 
Sbjct: 580  LQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFY 639

Query: 629  TEEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSAR 688
                +  N   LVGITEILL ++AQKK VL + +L+VWE LI+ +  DELNL+ D+LS R
Sbjct: 640  KSIDTKPN--GLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVR 697

Query: 689  ENKEGFSYLFEGAEEYEKVSGDE-NE-----------VAPXXXXXXXXXXXXXXXXXXXX 736
            ENK+GF+ LFE A+EY +V  DE NE                                  
Sbjct: 698  ENKQGFAALFEAADEYVEVDDDEINEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSG 757

Query: 737  XXXXNKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXX 796
                N+ +  I+++T  ALA ALKLPEN+++E+G+V F +                    
Sbjct: 758  NNGYNEYIDKINKETTSALADALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMM 817

Query: 797  XXXGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDL 856
               GQL++IFKRRK+ALS VPTGN RK+EVR+SRESVI+FK R++DML IY KYV +L  
Sbjct: 818  ELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAG 877

Query: 857  EDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXX-XXXXXPVSA---EDG 912
            + +     KL  + + ++P+LKC+Q+T+DRP                   P      E  
Sbjct: 878  KSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVS 937

Query: 913  ERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIY 972
            E    SL+ IH + +LA+K GQ+Q +Y+  CS++S+F  K+L+ ++ + +  +N +IDIY
Sbjct: 938  EIVFLSLENIHNS-MLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD-EVTYNRIIDIY 995

Query: 973  AETTKKWMDKKKFPTSVFFDFYNWLSSKRQQ 1003
            +++ K W  K KF  + F DF NWL+SKR +
Sbjct: 996  SQSIKNWTVKGKFGPNFFIDFINWLASKRSK 1026

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
            YEL055C
          Length = 1024

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1048 (38%), Positives = 577/1048 (55%), Gaps = 73/1048 (6%)

Query: 4    KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLP-ASKDEWSYVVNRLIKGLSSDRNGA 62
            +V+RD FYKLASD+PEER+ + V ++  L  L +    + EW YVV+RL+KGL S+RN A
Sbjct: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63   RLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTF---SIDPQDXXXXXXXXXX 119
            RLGFS+CLTE + L +  D  + P  LK +  +L  +   F   ++              
Sbjct: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 120  XXLMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLY 179
               +FG+LFA + LLNEPLFS +F +     KF  +F + ++ L S KNW+ +PC F+LY
Sbjct: 122  RGTLFGRLFAYKVLLNEPLFSLLFDQ-----KFLIEFQERVIQLGSMKNWLLEPCFFSLY 176

Query: 180  QTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWK 239
            Q IE+LLP  D  + +  V  +D +K T+TNEGL++YLL   K     L    + N  WK
Sbjct: 177  QAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKF---TLSDFTLENSAWK 233

Query: 240  YNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPILYNDPREEPL 299
             N+PL KGN                D      N NW P+LH++WDI+L   +++  E+  
Sbjct: 234  ANDPLQKGNLSVMAKVMLDTNV---DGANSNTNKNWAPRLHYIWDIILREFFDN--EQHG 288

Query: 300  XXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKALPTVP 359
                           +    +EF  FW+A+VDE++F+DKAS ERK+ G LIF KA+ +VP
Sbjct: 289  SDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVP 348

Query: 360  SKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGALLFG 419
            +  +  CF+QN+MR +INQ SDS+R L+K+++K L ++V  CE++P  KL PV+ ALLF 
Sbjct: 349  ASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPVLTALLFS 407

Query: 420  TNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELN-SQKNEAV------LHFI 472
              GS+NFD LTKSKTV++L+ATK  +   +  L  LFTS LN S K   +      L FI
Sbjct: 408  EEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFI 467

Query: 473  LDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIARERIY 532
            LD+LL+++RS K  L+ +                  FF       +D   ++ IA+ER+ 
Sbjct: 468  LDSLLNLIRSQKALLETDK---EIVMEILESTIQLAFFQ------KDNEYINNIAKERLS 518

Query: 533  SILSELSSVPTGDAHSWQFHIXXXXXXXXXXXXXXXALDEDLTTVKDTGLSVIHSLSVKN 592
            S+L+EL  +P+ D  SW +                 +LD+ L  VK   L ++  +S   
Sbjct: 519  SMLAELIVLPSTDG-SWPYLALEIIVTKEKSETLIDSLDDSLVAVKAESLDILKKISELK 577

Query: 593  DKSSR--GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGL 650
             KSS+  GIESL++M L+QLYSG+A+S+  I+++  +   E S+  + +  G+TEILL L
Sbjct: 578  SKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFY-HETSNHETANFTGVTEILLSL 636

Query: 651  LAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAEEYEKVSGD 710
            LAQ+K++L K SLLVWEQ I+ +G +E+NL+L+ L ARENKEGFS LFE   +YE V  +
Sbjct: 637  LAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENEGDYEVVDSE 696

Query: 711  EN-----------EVAPXXXXXXXXXXXXXXXXXXXXXXXXNKD---VTNIDRQTACALA 756
             +           +                           N D   ++ ID++T  ALA
Sbjct: 697  NDAEGEEDDENNEKDNDDSDEDSDDDVSDDDDASLSSSDTDNADDEKISQIDKETTSALA 756

Query: 757  KALKLPENVVNEDGEVKFNEIXXX--------XXXXXXXXXXXXXXXXXXXGQLADIFKR 808
            KAL LP+N++NE+GEV  N +                               QL++IFKR
Sbjct: 757  KALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKMMELDDQLSEIFKR 816

Query: 809  RKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKD----VMKE 864
            RKDALS V TGN RK++V++SRE+VI FK R+IDML IY+K++E+L L   D    V  E
Sbjct: 817  RKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRADGGKVVTTE 876

Query: 865  K----LQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPV--SAEDGERFVES 918
            K    L  +   V+    CVQ+TLD+P                   +    E     + S
Sbjct: 877  KTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFEDIETSTEIMNS 936

Query: 919  LQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIES--RDNKDAAHNEVIDIYAETT 976
            L+RIH  +L   K GQ+ A YY  CSS S++ C+ LI++     K     +++D+YA TT
Sbjct: 937  LERIH-IHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKMFEKLVDVYAATT 995

Query: 977  KKWMDKKKFPTSVFFDFYNWLSSKRQQQ 1004
            K WM + K+   +F DFYNWL+SK+Q++
Sbjct: 996  KIWMQEGKYGAKIFVDFYNWLASKKQRK 1023

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1028 (38%), Positives = 564/1028 (54%), Gaps = 52/1028 (5%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            M  +VNRD FYKL SDL +ER+Q+A++LI EL+ L +  +  EW YV+ RL++GL+S   
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXX 120
             ARLGFSLCLTEV   A++     + EE      +L  L     +D              
Sbjct: 61   SARLGFSLCLTEVAAAALENGHIGSAEE------YLERLEAALPVD-----KVKNGKEER 109

Query: 121  XLMFGKLFALQALLNEPLFSDIFIK-DGKITK-FTTKFIDELVNLASRKNWIKQPCLFTL 178
              +FG++F LQA+LNEPLFS +F+  DG+I + F  +F+  LV LA  K W++QPCLFTL
Sbjct: 110  GQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTL 169

Query: 179  YQTIERLLPYSDDS-FVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYS-------SALLS 230
            YQ IERL P + D+ F++ V+T+LD +  T T+EGLAIYL   +K          + +  
Sbjct: 170  YQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFD 229

Query: 231  INVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL 290
                 K WK +NPL KGN                D   +     W P+LHFVWD+LLP+L
Sbjct: 230  ALPLVKRWKADNPLAKGNAKALASVLKDDALIEGDGPKQ--KGVWTPRLHFVWDLLLPLL 287

Query: 291  YNDPREEPLXXXXXXXXXXXXXXXEA-VGAIEFPEFWKAIVDETYFSDKASSERKFLGLL 349
              +                      A  G + F EFW+ +VDE++FS+KASSERK+LG+L
Sbjct: 288  AEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVL 347

Query: 350  IFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKL 409
            I  KA+ +VPS  +   FS+N +R LINQ S++ RHLHK++   L +IV  CE D   K+
Sbjct: 348  IMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETD-ASKV 406

Query: 410  VPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-AV 468
            VPV+ A+ FG NG+INFD+LTKSKT   L+  K L    + +L  L   +L  +  + + 
Sbjct: 407  VPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISK 466

Query: 469  LHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIAR 528
            + FILDTLLH++R+HK      H+S W             FF A     E    +  ++R
Sbjct: 467  IKFILDTLLHVIRAHKWK---AHLS-W-TNPLLLALVRYAFFSAPSHLSEQSEEIITLSR 521

Query: 529  ERIYSILSELSSVPTGD--AHSWQFHIXXXXXXXXXXXXXXXALDEDLTTVKDTGLSVIH 586
            ER++S+L EL  +   D  A SW +                  LD +L TV    L ++ 
Sbjct: 522  ERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILR 581

Query: 587  SLSVKNDKSSR------GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISL 640
             +  K+ KS        G+E LL++ +LQ+++G+ DS +T++E+  +  E  +      L
Sbjct: 582  KIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFY-ESATQGADNGL 640

Query: 641  VGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEG 700
            VGITEILL L+AQKK++L K +L+VWE  I+ VG +EL L+L+ LSARENK GF+ LFEG
Sbjct: 641  VGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEG 700

Query: 701  AEEYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXXXXXXNKDVTNIDRQTACALAKALK 760
            A+EYE++  D  E                           ++DV  ID++   ALA AL+
Sbjct: 701  ADEYEELGSD--EAGTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKIDKEATSALAHALR 758

Query: 761  LPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXXGQLADIFKRRKDALSHVPTGN 820
            LP+N+++EDG V F                         GQL++IFKRRKDAL+ +PTGN
Sbjct: 759  LPDNILDEDGNVGF---EEMDDEEEEEESMDDEAMMELDGQLSEIFKRRKDALNKIPTGN 815

Query: 821  MRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCV 880
             RKIE ++SR+SVI FK R++DML IY K VE+   ++K +       + +  EPM+K +
Sbjct: 816  QRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAI 875

Query: 881  QRTLDRPXXXXXXXXXXXXXXXXXXPVSAE-----DGERFVESLQRIHGTYLLAEKSGQY 935
            Q+TLDRP                      E     + E  + SL+ +H T +L+ K GQ+
Sbjct: 876  QQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHAT-ILSPKPGQF 934

Query: 936  QAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFYN 995
              +++S CSS S+F  K+LI  +D+   +  +VI IY+ T K W    KF  + F DF N
Sbjct: 935  PQLFFSACSSTSLFLSKVLIAMKDDPSTSE-QVIGIYSTTMKHWNVSGKFGPNFFIDFIN 993

Query: 996  WLSSKRQQ 1003
            WL+SK+ +
Sbjct: 994  WLASKKSK 1001

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1048 (37%), Positives = 586/1048 (55%), Gaps = 82/1048 (7%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKD---EWSYVVNRLIKGLSS 57
            +  +VNRD F+K+AS+L +ERL+AA+ LI E+S +    S+D   EW YV+ RL+KGL+S
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRNGARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXX 117
            +R GARLGFS+CLTEV+ LA++  D      L S+ +FL+ L +T               
Sbjct: 66   NRGGARLGFSMCLTEVIALALERRDI-----LPSIYAFLNQLEQTLPAG----TAFKNGK 116

Query: 118  XXXXLMFGKLFALQALLNEPLFSDIFIK--DGKIT-KFTTKFIDELVNLASRKNWIKQPC 174
                ++FG++FALQ+LLNEP+FS +F+   D  I  +F   ++++L+ LA  K W+++PC
Sbjct: 117  EERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPC 176

Query: 175  LFTLYQTIERLLP--YSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISK--GYSSALLS 230
            L+++YQTI++     ++D + +  ++ +LD  K TLTNEGL+IYL+F ++   YSS+L+ 
Sbjct: 177  LYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDTYSSSLV- 235

Query: 231  INVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL 290
              + N GWK N+PL KGN                 +  +     W P+LH+VWDILLP+L
Sbjct: 236  --IHNSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQ--KGTWAPRLHYVWDILLPLL 291

Query: 291  YNDP---REEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLG 347
             +D    +                   E  G I+FP+FW+A+VDE++F++K+S+ERK+LG
Sbjct: 292  EDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLG 351

Query: 348  LLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGH 407
             LI  +A+     K I    SQNL+RC+INQ  DS+R L+KI+ + L SIV  CE  P  
Sbjct: 352  FLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPA- 410

Query: 408  KLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSEL----NSQ 463
            K+VP+V    FG NGSINFD+L KSK V  LI+T  LE + +  L  L  S+L    +++
Sbjct: 411  KVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTK 470

Query: 464  KNEAVLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINV 523
             +  +  FI DT LHI R+HK  L+    S W             FF+ ++ S      +
Sbjct: 471  DSFNLTRFIFDTFLHITRAHKTRLE----SHWVKPLLSAIIKA-AFFNESDNS-----KL 520

Query: 524  SEIARERIYSILSELSSVPT---GDAHSWQF-HIXXXXXXXXXXXXXXXALDEDLTTVKD 579
            SE+A+ER+YSIL EL S P+   GD  +W +  +                LDEDL +V+ 
Sbjct: 521  SELAKERLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRK 580

Query: 580  TGLSVI---HSLSVKNDKSSR--GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSS 634
            + +  +   HS   KN+ + +  G+E LL++ +LQLY+G+ +SV+ ++++  +   E+  
Sbjct: 581  SAIKSLKQNHS-DNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFY--EECD 637

Query: 635  KNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGF 694
            K S  LVGITEILL L+AQ+K++L K SL+VWE  + D+G  ELN++L  L+ARENK+GF
Sbjct: 638  KESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGF 697

Query: 695  SYLFEGAEEYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXXX---XXXXNKDVT--NIDR 749
            + LFEG EE +     E                                +KD     I++
Sbjct: 698  ADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIEK 757

Query: 750  QTACALAKALKLPENVVNEDGEVKFNE---------IXXXXXXXXXXXXXXXXXXXXXXG 800
            +   ALAKAL LP+++V E G+V+                                    
Sbjct: 758  EATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLDD 817

Query: 801  QLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKD 860
            QL++IFKRRK+AL  VPTGN RK+EV++SRE+VI+FK R++DML IYVK  ++    +  
Sbjct: 818  QLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVARNNT 877

Query: 861  --VMKEKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDGERFVES 918
              +  E+   +S+ + P+LKC+Q TLD+                    ++ E  E+ V S
Sbjct: 878  SIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE--EKTVTS 935

Query: 919  -----LQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYA 973
                 L+++H   + A K GQ+Q +++S CS AS+F  KL + S      +H  +ID+YA
Sbjct: 936  EIFHLLEKVHKLIMTA-KPGQFQQLFFSTCSLASLFLSKLYLSS----GGSHENLIDLYA 990

Query: 974  ETTKKWMDKKKFPTSVFFDFYNWLSSKR 1001
            +T+K WM   K   + F DF NWL +KR
Sbjct: 991  DTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1053 (37%), Positives = 587/1053 (55%), Gaps = 78/1053 (7%)

Query: 5    VNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKD-------EWSYVVNRLIKGLSS 57
            VNRD FY+LASDL EERLQ+ V L+KEL  L    S +       EW+YVVNRLI GL+S
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   DRNGARLGFSLCLTEVVDLAIKMD-DDKAPEELKSMDSFLHLLSKTFSIDPQ---DXXXX 113
            +R GARLGFSLCLTEV++LA+     +  P  L  + SFLHL+S T SI      +    
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 114  XXXXXXXXLMFGKLFALQALLNEPLFSDIFIKDGKITKFTTKFIDELVNLASRKNWIKQP 173
                    L+FGKLFALQ+LLN+P+F  IF KD K   F  +FI EL+ L++ KNWIK+P
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKDNKAILF--EFIYELIALSNLKNWIKEP 181

Query: 174  CLFTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIY--LLFISKGYSSALLSI 231
             LFTL+  I++++ + D S +  ++ +L  N  TLTNEGL+IY  L++ +   S   + I
Sbjct: 182  TLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISPEDIQI 241

Query: 232  NVTNKGWKYN-NPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL 290
            +  N     N +P LK N                 +E  T+NANW P+LH+VWD++LPIL
Sbjct: 242  DNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQ-SEKHTSNANWTPRLHYVWDVILPIL 300

Query: 291  YNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLI 350
             N    + L                +   I+F EFW+ ++DE++F++KAS ERK+LG LI
Sbjct: 301  LNPKSSDKLLNKNGNKRRKV-----SRDRIKFNEFWRQVIDESFFNEKASHERKYLGFLI 355

Query: 351  FLKALPTV-PSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKL 409
              K  P +  +  I   F+ NL+R +INQ +DS+R+L+KI+ K +  IV  C+++   +L
Sbjct: 356  IQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNSELRL 415

Query: 410  VPVVGALLFG--TNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEA 467
            +PV+   LF    + SINFD+LTK+KT+++LI  + L  D++ KLF LFTS+L+S     
Sbjct: 416  IPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKLDSFTTTT 475

Query: 468  VLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATETSPEDKINVSEIA 527
             L F+LD++LHI+RSHK  +   H                 FF  T       +++S I 
Sbjct: 476  ELQFLLDSILHIIRSHKSQIIVSH---KFLDPVLEPIILLTFFKETA-----DVSISNIL 527

Query: 528  RERIYSILSELSSVPTGDAHSWQFHIXXXXXXXXX--XXXXXXALDEDLTTVKDTGLSVI 585
            ++R+ SIL++L++V   ++ S Q+                     D+ L  VKD+ ++ +
Sbjct: 528  KDRLISILNDLTTVGE-NSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAITTL 586

Query: 586  -----HSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSS------ 634
                 HS   K D   + + SLL++ ++QLY  + DS+ATI+++CD+    KS+      
Sbjct: 587  KRAIEHS---KRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTIMKND 643

Query: 635  KNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGF 694
            KN  SL GI EILL L AQKK++L K  L +WE  I+ +  +E + I DVL  RENKEGF
Sbjct: 644  KNRPSL-GIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGF 702

Query: 695  SYLFEGAEEYEKVSGDENEVAPXXX-----XXXXXXXXXXXXXXXXXXXXXNKDVTNIDR 749
            + LFEG +EYE++   ++E                                N D+  ID+
Sbjct: 703  ARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDINRIDK 762

Query: 750  QTACALAKALKLPENVVNEDGEVKF--------NEI---XXXXXXXXXXXXXXXXXXXXX 798
            +   ALAKALKLP+N++N+ GEV          NE+                        
Sbjct: 763  EATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQMMEL 822

Query: 799  XGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLED 858
             GQL+ IF RRK+ALS++ TGN RK++V++SRE+VI FK R++DM+ +Y+K++E +    
Sbjct: 823  DGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEIITKSS 882

Query: 859  KDVMK----EKLQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAEDG-- 912
            +++ +    + L ++   ++ +L C+Q+TLDR                       + G  
Sbjct: 883  ENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFKDCGDL 942

Query: 913  --ERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVID 970
              E  +E +  +H   +L +KSGQYQ +Y+ LCS +S+F+C++  E+  N D  ++ +ID
Sbjct: 943  TSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNAD-LYDSLID 1001

Query: 971  IYAETTKKWM--DKKKFPTSVFFDFYNWLSSKR 1001
            +Y +TTK W    + K PT++F DF+NWLSSKR
Sbjct: 1002 LYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/743 (46%), Positives = 464/743 (62%), Gaps = 57/743 (7%)

Query: 1   MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
           M GKVNRD FYKLASDL EERLQ+AVSLIKELS L +P   +EW+YV+NRLIKGL+SDRN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXX 120
            ARLGFSLCLTE ++LA+ M D+ AP+ ++S++ FL LLSKT  ID              
Sbjct: 61  SARLGFSLCLTEAINLALGMGDN-APQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119

Query: 121 X-------LMFGKLFALQALLNEPLFSDIFIKDGKI---TKFTTKFIDELVNLASRKNWI 170
                   ++FGKLFALQALLNEPLFS IF+ + K    +    +++DEL  L S+KNWI
Sbjct: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179

Query: 171 KQPCLFTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFI-----SKGYS 225
           ++ C FTLYQTIE+LLPY+D  F + V+T+LD  + TL+ EGLAIYLL I      K   
Sbjct: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239

Query: 226 SALLSINVTNKGWKYNNPLLKGNX-XXXXXXXXXXXXXXDDNE---TKTNN---ANWHPK 278
             L  I ++N  WK NNPL +GN                 D+E   TK N    ANW P+
Sbjct: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299

Query: 279 LHFVWDILLPILYNDPREEPLXX---XXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYF 335
           LHFVWDILLPIL     EE                    ++   I FPEFW+  +DE++F
Sbjct: 300 LHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFF 359

Query: 336 SDKASSERKFLGLLIFLKALPTVP---SKWIACCFSQNLMRCLINQCSDSERHLHKIAEK 392
           ++KASSERK+LG LIF K + ++    +K I+ CF++N MR LINQ SD++R LHK+++ 
Sbjct: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419

Query: 393 CLISIVKTCEADPGHKLVPVVGALLFGTN--GSINFDRLTKSKTVAKLIATKGLEDDSIG 450
            + +IVK CE DP +KL+P + ALLF TN  GSINFD+LTKSKTV+KLI+ K L   ++ 
Sbjct: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLR 479

Query: 451 KLFALFTSELNSQKNEA----VLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXX 506
           +L  LF S++N+   E     V  F LDT+LH++RSHK     + +              
Sbjct: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSV----VEPLLNPLVK 535

Query: 507 XGFFHATETSPEDKINVSEIARERIYSILSEL---SSVP--TGDAHSWQFHIXXXXXXXX 561
             FF       +D   ++E+A+ER+YSILSEL   +S P  +  AHSW ++         
Sbjct: 536 LAFF------SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELE 589

Query: 562 XXXXXXXA--LDEDLTTVKDTGLSVIHSLSVKN----DKSSRGIESLLAMCLLQLYSGEA 615
                     LD DL T+K+ GL V++ +S+ N     + S+G+E LL+MC+LQL+SG+ 
Sbjct: 590 KSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDT 649

Query: 616 DSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGS 675
           +S++TI+E+ ++ +  K  + S SLVGITEILL LLAQKK +L K SL VWE  I D+G 
Sbjct: 650 ESLSTIEELVEFYSNSKQEE-STSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGK 708

Query: 676 DELNLILDVLSARENKEGFSYLF 698
           +ELN++L VL  RENK+GF++LF
Sbjct: 709 NELNVLLAVLPVRENKQGFAHLF 731

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1032 (36%), Positives = 562/1032 (54%), Gaps = 59/1032 (5%)

Query: 4    KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGAR 63
            ++NRD FYKLASDL EERLQA + L+ +LS L   +S  EW YV++RLIKGLSS RNGAR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSS--EWQYVLDRLIKGLSSSRNGAR 62

Query: 64   LGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXXXLM 123
            LGFSLCLTEVV LA++         L  +D ++HLL    S +               L+
Sbjct: 63   LGFSLCLTEVVALALEKG------VLARVDQYMHLLISALSKE-----NVKNGKEERGLL 111

Query: 124  FGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFTLYQT 181
            FGKLF LQ LLNEPLFS +F  D      +  + ++  L+++A  K WI++  LFTL+Q 
Sbjct: 112  FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171

Query: 182  IERLLPY-SDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSA--------LLSIN 232
            +E+L P       +K V+ +LD    T T+EGLAIYL  + +   +         L  +N
Sbjct: 172  VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELN 231

Query: 233  VTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPILYN 292
            + N  WK N+PL +GN                D+ + T    W P+LHF WDI+L  L +
Sbjct: 232  LKNP-WKNNDPLKRGNLPAISNALKDSGAR--DDPSLTQKGVWAPRLHFAWDIVLQTLLH 288

Query: 293  DPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFL 352
                E                 E    I+FPEFWK++VDE++F++K+SSERK+LG+L+F 
Sbjct: 289  AENSE---ITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFE 345

Query: 353  KALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPV 412
            K     P +++   FS+NL+RCLINQC  +ER+LHKI++K L +IV+ C+A P  K  P 
Sbjct: 346  KTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP-EKTAPS 404

Query: 413  VGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLF-ALFTSELNSQKNEAVLHF 471
               L FG  G+INFD LTK+KTV  L++ K L  D +  L  +L ++   + K  +   F
Sbjct: 405  FVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARF 464

Query: 472  ILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATET-----SPEDKINVSEI 526
            ILD +LH++R+HK      H                GFF  +E      S E   ++S I
Sbjct: 465  ILDAILHLVRAHK-----AHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSI 519

Query: 527  ARERIYSILSELSSVPTGDAHS--WQFHIXXXXXXXXXXXXXXXALDEDLTTVKDTGLSV 584
            A ER++SIL++L +V   D +S  W F                 ++DE+L  + D+ ++V
Sbjct: 520  ASERLFSILADLLTVEQ-DTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTV 578

Query: 585  IHSLSVKNDKSS----RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISL 640
            + S+S K ++++    +G++ L ++ +LQ Y+GE +S++ ++++  +  E +    S  L
Sbjct: 579  LSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPL 638

Query: 641  VGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEG 700
             G  EILL L AQKK +  K+SLL WE  + DV   +L ++L+VL  RENKEGFS LFEG
Sbjct: 639  AGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEG 698

Query: 701  AEEYEKVSGDENEVAPXXXXXXXXX---XXXXXXXXXXXXXXXNKDVTNIDRQTACALAK 757
              E E  S ++ E+                             + D+  ID++   ALAK
Sbjct: 699  GSESEGDSEEDEEMNDEEEPEKDASDDEIEESDNNVSEDDSSSDDDMGKIDKEATSALAK 758

Query: 758  ALKLPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXX-GQLADIFKRRKDALSHV 816
            AL LP+++V++ GEV+F ++                       GQL++IFKRRK+ALS +
Sbjct: 759  ALNLPDSIVDDKGEVRFEDLGDTDEEEEESEEDLDDEKMMELDGQLSEIFKRRKEALSKI 818

Query: 817  PTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPM 876
            PTGN RK EV++SRE+VI FK R++DML I V+++E    +D  + K  L  V   + P+
Sbjct: 819  PTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPL 878

Query: 877  LKCVQRTLDRPXXXXXXXXXXXXXXXXXXPVSAE----DGERFVESLQRIHGTYLLAEKS 932
            L C++ TLD+P                    S+     D +  +  L+ +H   +L +K+
Sbjct: 879  LDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKKAVLSLLRSVHEA-MLVKKA 937

Query: 933  GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFD 992
            GQ+Q +Y+S CS+ S+F  +L++++    +  + E+  IY +T   W    KF  S+F +
Sbjct: 938  GQFQTLYFSGCSTTSMFLARLVVDTFPELE-TYEELTGIYHKTLDGWFVTGKFGVSMFVE 996

Query: 993  FYNWLSSKRQQQ 1004
            F NWLS K+ QQ
Sbjct: 997  FLNWLSVKKTQQ 1008

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/1038 (35%), Positives = 542/1038 (52%), Gaps = 71/1038 (6%)

Query: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60
            +  +V+RD FYKLASDL EERLQA + L+ +LS +   +   EW YV+NRLIKGLSS RN
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESR--EWEYVLNRLIKGLSSSRN 59

Query: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDXXXXXXXXXXX 120
            GARLG+ LCLTEVV  A++         L   D +L LL  T S +              
Sbjct: 60   GARLGYCLCLTEVVASALE------KSVLAHADEYLRLLLSTLSRE-----NIKNGKEER 108

Query: 121  XLMFGKLFALQALLNEPLFSDIFIKDGKIT-KFTTKFIDELVNLASRKNWIKQPCLFTLY 179
             ++FGKLF LQ LLNEPLFS +F  + +I  +F   ++  L+++A  K WI++  +FTLY
Sbjct: 109  GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168

Query: 180  QTIERLLP-YSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGY-------SSALLSI 231
            Q IE+L P       +K ++T+LD    T T+EGLA+YL    K +          LL  
Sbjct: 169  QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLED 228

Query: 232  NVTNKGWKYNNPLLKGNXXXXXXXXXXXXXXXDDNETKTNNANWHPKLHFVWDILLPIL- 290
               N  WK N+PL KGN               D   +      W P+LHFVWDI+L    
Sbjct: 229  LKLNSPWKNNDPLSKGNLPAIANALKEINSSED--LSVKQKGIWMPRLHFVWDIILTSFF 286

Query: 291  ----YNDPREEPLXXXXXXXXXXXXXXXEAVGAIEFPEFWKAIVDETYFSDKASSERKFL 346
                Y D   EP                     I+FPEFWK++VDE++F++K+SSERK+L
Sbjct: 287  EGGEYEDKASEPAKKKRKKSSEERHQQ------IKFPEFWKSVVDESFFNEKSSSERKYL 340

Query: 347  GLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPG 406
            G L+F KA    P  +     S+NL RCLINQC  SER+LHK++++ L +IV  C+  P 
Sbjct: 341  GFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQP- 399

Query: 407  HKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSEL-NSQKN 465
             K  P    L    +GSI+FD+LTKSKT+  L++ K L D  +  L  + T+ L  S ++
Sbjct: 400  EKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRD 459

Query: 466  EAVLHFILDTLLHILRSHKLNLKGEHISTWXXXXXXXXXXXXGFFHATET--SPE---DK 520
             + + F+LD +LH++R+H    K      W            GFF   E    PE   + 
Sbjct: 460  HSRVRFLLDAMLHLVRAH----KSAADKVW-LAPLLDSLVQQGFFELDENDRQPEVGDET 514

Query: 521  INVSEIARERIYSILSELSSVP-TGDAHSWQFHIXXXXXXXXXXXXXXXALDEDLTTVKD 579
              VS++A ER+YSIL++L S     +   W                    +DE+LT + +
Sbjct: 515  FTVSKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILN 574

Query: 580  TGLSVIHSLSVKNDKS-----SRGIESLLAMCLLQLYSGEADSVATIKEICDY---LTEE 631
            + +    ++  + +K      +RG + + ++ +LQ YSGE DS+  ++++  +   L E 
Sbjct: 575  SSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN 634

Query: 632  KSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENK 691
            KS     S  G  EILL L AQKK +L K SLLVWE  + +   D++ ++L++L ARENK
Sbjct: 635  KSG----SYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENK 690

Query: 692  EGFSYLFEGAEEYEKVSGDENEVAPXXXXXXXXXXXXXXXXXXX--XXXXXNKDVTNIDR 749
            EGFS LFEG +E      DE E++                            +D   ID+
Sbjct: 691  EGFSKLFEGDDEG---GSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGEDTEQIDK 747

Query: 750  QTACALAKALKLPENVVNEDGEVKFNEIXXXXXXXXXXXXXXXXXXXXXXGQLADIFKRR 809
            +   AL KAL LPE++VN++GEV F ++                      GQL++IFKRR
Sbjct: 748  EATSALVKALNLPESIVNDNGEVHFEDLEDTEDEEISDEDLDDEKMMELDGQLSEIFKRR 807

Query: 810  KDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTV 869
            K+ALS +PTGN RK EV++SRE+VI FK R++DML I+V++ E    +     K     +
Sbjct: 808  KEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKI 867

Query: 870  STFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPV-SAEDG---ERFVESLQRIHGT 925
             + + P++ CV+ TLD+P                     ++ DG     F  SL+ +H  
Sbjct: 868  ISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDGLEENLFENSLKSVHEA 927

Query: 926  YLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKF 985
             LL +K GQ+Q +Y+S CS+AS+F  KL +  R  +   +  + ++Y +T  +W    KF
Sbjct: 928  MLL-KKCGQFQNLYFSACSTASMFLAKLFVH-RSPRPETYFTLTEVYHKTLNEWFVGGKF 985

Query: 986  PTSVFFDFYNWLSSKRQQ 1003
              ++F +F NWLS K+QQ
Sbjct: 986  SANLFIEFLNWLSIKKQQ 1003

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa] {ON}
            complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  185 bits (470), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 158/276 (57%), Gaps = 22/276 (7%)

Query: 747  IDRQTACALAKALKLPENVVNEDGEVKFNEIXXX-----------XXXXXXXXXXXXXXX 795
            I+++T  ALAKAL LP+N++NE+GEV  + +                             
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 796  XXXXGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKL- 854
                 QL++IFKRRK+ALS V +GN RK++V++SRE+VI FK R+ID+L  Y+KYVEK+ 
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 855  --DLEDKDVMKEK-LQTVSTFVEPMLKCVQRTLDRPXXXXXXXXXXXXXXXXXXPV---- 907
               LED+ + KE+ L  V   +  M++C+Q TLDRP                        
Sbjct: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918

Query: 908  SAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESR--DNKDAAH 965
            +  + E  +  L+ IH   L+  K GQ+ ++Y+S+CS++S+F  KLLIE+   D +  A 
Sbjct: 919  NVSNQESVLTQLKAIH-ELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977

Query: 966  NEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKR 1001
            +++IDIY E +KKW+ K +F   VF DFYNWL+SK+
Sbjct: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,030,854
Number of extensions: 3569875
Number of successful extensions: 10723
Number of sequences better than 10.0: 25
Number of HSP's gapped: 10663
Number of HSP's successfully gapped: 36
Length of query: 1004
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 884
Effective length of database: 39,721,479
Effective search space: 35113787436
Effective search space used: 35113787436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)