Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009406.11ON53853828110.0
Kpol_1032.26.11ON53954213530.0
KAFR0L003406.11ON54052313480.0
NCAS0F002006.11ON54955313171e-177
TBLA0G009806.11ON55855113131e-176
TPHA0M002106.11ON54555613051e-175
Suva_5.106.11ON55355613051e-175
NDAI0K028906.11ON56155912941e-173
ZYRO0F00506g6.11ON55055712821e-172
Skud_5.316.11ON55756012791e-171
Smik_5.296.11ON55555412711e-170
TDEL0G046006.11ON52853512671e-170
SAKL0E00902g6.11ON54452512631e-169
KLTH0C11506g6.11ON54452212591e-168
YEL058W (PCM1)6.11ON55755812571e-168
Kwal_56.223556.11ON54155112531e-167
CAGL0B03597g6.11ON54053912441e-166
KLLA0D00858g6.11ON54152812041e-160
Ecym_30146.11ON55153512031e-160
ACR015W6.11ON55252711731e-155
ABL126W8.840ON6243161045e-04
Kwal_27.102588.840ON6201211028e-04
Ecym_46118.840ON630152960.005
TDEL0B005708.840ON630119940.008
Kpol_1068.88.840ON63227900.027
ZYRO0G14190g8.840ON610117890.030
NDAI0K004108.840ON626117890.032
KLLA0D01573g8.840ON60722890.034
TBLA0B032508.840ON64326850.097
TPHA0I002508.840ON62924850.097
Skud_13.4508.840ON622114850.10
Smik_13.4918.840ON62226840.13
NCAS0C004108.840ON62521840.13
CAGL0M02981g8.840ON61721840.14
KNAG0J002708.840ON62521830.17
YMR278W (PGM3)8.840ON62221830.18
Suva_13.4668.840ON62221830.18
Smik_13.4608.799ON156689820.27
KAFR0B039208.840ON62423790.46
SAKL0D01474g8.840ON62456790.58
KNAG0F039607.541ON1538161790.59
Suva_11.982.445ON57044780.67
KLTH0C03872g8.840ON62145770.91
Smik_11.1122.445ON57044751.5
YKL127W (PGM1)2.445ON57043741.8
KAFR0F034601.95ON48056705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00940
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...  1087   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   525   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   523   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   511   e-177
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   510   e-176
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   507   e-175
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   507   e-175
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   503   e-173
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   498   e-172
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   497   e-171
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   494   e-170
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   492   e-170
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   491   e-169
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   489   e-168
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   488   e-168
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   487   e-167
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   483   e-166
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   468   e-160
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   468   e-160
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   456   e-155
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    45   5e-04
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    44   8e-04
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    42   0.005
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    41   0.008
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.027
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    39   0.030
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    39   0.032
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.034
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.097
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    37   0.097
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    37   0.10 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.13 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.13 
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    37   0.14 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    37   0.17 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    37   0.18 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    37   0.18 
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    36   0.27 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    35   0.46 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    35   0.58 
KNAG0F03960 Chr6 (745722..750338) [4617 bp, 1538 aa] {ON} Anc_7....    35   0.59 
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    35   0.67 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    34   0.91 
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    33   1.5  
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    33   1.8  
KAFR0F03460 Chr6 complement(687700..689142) [1443 bp, 480 aa] {O...    32   5.9  

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/538 (97%), Positives = 525/538 (97%)

Query: 1   MSREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60
           MSREAVRAVFDAVC             FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY 120
           MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY 120

Query: 121 TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRDGVT 180
           TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRDGVT
Sbjct: 121 TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRDGVT 180

Query: 181 DAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240
           DAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN
Sbjct: 181 DAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240

Query: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFVKNK 300
           TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFVKNK
Sbjct: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFVKNK 300

Query: 301 QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACT 360
           QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACT
Sbjct: 301 QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACT 360

Query: 361 KTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTNDAASTLYHFSKLIN 420
           KTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTNDAASTLYHFSKLIN
Sbjct: 361 KTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTNDAASTLYHFSKLIN 420

Query: 421 QTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVS 480
           QTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVS
Sbjct: 421 QTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVS 480

Query: 481 PEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV 538
           PEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV
Sbjct: 481 PEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV 538

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/542 (50%), Positives = 356/542 (65%), Gaps = 19/542 (3%)

Query: 9   VFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNP 68
           +F+  C             FRD A++L+TVMF TG VA LRS  L G  VGVM+TASHNP
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 69  PEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGGARL-- 126
           PEDNGVK+V+P G ML + WEP+AT LAN+AAN TFD    Y    V++ +   G+++  
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124

Query: 127 --CVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS---LQRDGVTD 181
              VG D+RES   LL+ L+ +A       I I+   +T  PQLH+LT+   +++     
Sbjct: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKI-INYGLLTT-PQLHFLTNEINVKKSYAVQ 182

Query: 182 AAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240
            ++Y ++F   W K+     +       L IDTANG+G  ++Q+  K W    +K  L+N
Sbjct: 183 ESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPF-ASKVTLVN 241

Query: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KN 299
            ++  P+ LN  CGADFVKTN +LP+ V      +    DLYCS+DGDADRIVFYF  ++
Sbjct: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTEN----DLYCSYDGDADRIVFYFQDQD 297

Query: 300 KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSAC 359
           KQFHLLDGDKISTLFAK I +L   A  + K+++GVVQTAYANG+ST Y+   L +P +C
Sbjct: 298 KQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSC 357

Query: 360 TKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTND---AASTLYHFS 416
            KTGVKHLHH A T YDIG+YFEANGHGT++FSD F +V       N    A +TL   S
Sbjct: 358 AKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALS 417

Query: 417 KLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQER 476
            LINQTVGDAI+DMLGVL+VL  ++ + + W  EYTDLPNLLTKV+VPDRS+F TTDQER
Sbjct: 418 HLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQER 477

Query: 477 RLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLN 536
           +L+SPEGLQ KID  +  F   RSFVRASGTE+AVR+Y EA   +E +EL+  VT+ V  
Sbjct: 478 KLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537

Query: 537 SV 538
           SV
Sbjct: 538 SV 539

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/523 (52%), Positives = 352/523 (67%), Gaps = 24/523 (4%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR  A+ LDTVMF TG VA+LRS  L G  +GVM+TASHNPP+DNGVK+V+P G ML E 
Sbjct: 29  FRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAMLIES 88

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEGNY--TGGARLCVGHDTRESSPRLLKNLMD 145
           WE +AT LAN+A++G F  +  + + ++ + N   T   RL VGHD+RESSP L++ L  
Sbjct: 89  WEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVGHDSRESSPYLMECLQA 148

Query: 146 AALAVSGGSITISKPWITNHPQLHYLTSLQRDGVTDAAAYNDHFQGCWQKLF---PDGVV 202
           AA      +I I+   IT  PQLHYLT LQ D VT+   Y   F   W  LF   PD  +
Sbjct: 149 AAPVFD--TIVINHTLITT-PQLHYLTMLQNDVVTEVDYYK-FFSTSWNNLFSLYPD--L 202

Query: 203 AWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNH 262
              F+ L +D ANGVG+VQ  +F            ++N  +  P+ LNV CGADFVKTN 
Sbjct: 203 NLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQ 262

Query: 263 RLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KNKQFHLLDGDKISTLFAKFIGQL 321
           +LP+ + +   +     DLY SFDGDADRIVFY+V  NK+FHLLDGDKIST+  K +  +
Sbjct: 263 KLPNGIVNPNPS-----DLYASFDGDADRIVFYYVDNNKKFHLLDGDKISTILTKCLISM 317

Query: 322 TARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYF 381
              +   + + +GVVQTAYANG+ST+YI   L +P  CTKTGVKHLHH+A++++DIGIYF
Sbjct: 318 LRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKHLHHIAESKFDIGIYF 377

Query: 382 EANGHGTVVFSDKFNEVV-------AGVASTNDAASTLYHFSKLINQTVGDAIADMLGVL 434
           EANGHGTV+FS+KF EV+       +     + A  +L++FSKLINQTVGD++AD+L V+
Sbjct: 378 EANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVI 437

Query: 435 AVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGR 494
           A L  LQ +P  W  EY DLPNLLTK  V +R +F+TTD ER+L SP GLQEKIDA V +
Sbjct: 438 ATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSK 497

Query: 495 FKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNS 537
           +   RSFVRASGTE+AVRIY EA+   EV+ LSK+VT+ V NS
Sbjct: 498 YDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  511 bits (1317), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 266/553 (48%), Positives = 355/553 (64%), Gaps = 23/553 (4%)

Query: 1   MSREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60
           + +  ++ V+++ C             FRDKA+ LDTVMFATG +A  RS  L G  VGV
Sbjct: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62

Query: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY 120
           MVTASHNPP DNGVKVV+P G ML ++WEPL T+LAN+AAN +F++ +++   + ++  +
Sbjct: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122

Query: 121 ---TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL--- 174
                   L +GHD+RESSPRL K L++ A+ +    I      +   PQLH++TSL   
Sbjct: 123 PFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADI--HNYGLVTTPQLHFITSLWNA 180

Query: 175 ----QRDGVTDAAAYNDHFQGCWQKL--FPDGVVAWPFDRLFIDTANGVGAVQLQQFFKG 228
                 + V     Y ++F   W K     D      F+ L ID+ANG+G  ++      
Sbjct: 181 KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240

Query: 229 W-AVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDG 287
           W +  +    ++N  +  P  LN  CGAD+VKTN +LP  + +         +L+CSFDG
Sbjct: 241 WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNL-----NLHCSFDG 295

Query: 288 DADRIVFYFVK--NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNS 345
           DADRIVFY++   +++FHLLDGDKI+TLFAKF+  L       DKL +GVVQTAYANG+S
Sbjct: 296 DADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSS 355

Query: 346 TRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST 405
           T Y+ + L +P +CTKTGVKHLHH A T+YDIGIYFEANGHGTV+FS++F +V+     T
Sbjct: 356 TNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKT 415

Query: 406 NDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPD 465
             A  TL  F K+INQTVGDA+ADMLGV+ VL   + TP  W   Y DLPN L KV+VPD
Sbjct: 416 T-ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPD 474

Query: 466 RSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQE 525
           RS+F TT+QER+L SP GLQEKID  V +    RSFVRASGTE+AVR+Y EA   +E ++
Sbjct: 475 RSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEK 534

Query: 526 LSKQVTEAVLNSV 538
           LS++V + VL+SV
Sbjct: 535 LSQEVCKFVLSSV 547

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  510 bits (1313), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 269/551 (48%), Positives = 355/551 (64%), Gaps = 27/551 (4%)

Query: 9   VFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNP 68
           +F  +C             FRDKAA+LDTVMF TG VA LRS   +G  VGVMVTASHNP
Sbjct: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72

Query: 69  PEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGGARLCV 128
           P DNGVK+V+P G ML + WEP+AT LANLA+ G  D+  ++  + + E N      L V
Sbjct: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNSNKVPTLIV 132

Query: 129 GHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS---LQRDGVTDAAAY 185
           G D+RESS  LL+ L + +L +    I   +   T  PQLH+LT+   L++D +     Y
Sbjct: 133 GRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTT--PQLHFLTNAYNLEKD-LPKETDY 189

Query: 186 NDHFQGCWQKLFP-----DGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240
             HF   W +L           +   + L ID+ANG+G  +++   K W  +  K RL+N
Sbjct: 190 YHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNY-KVRLIN 248

Query: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV--K 298
            ++  PE+LN  CGAD+VKTN +LP+ +        +   ++CSFDGDADR+VFY+   +
Sbjct: 249 NNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQ 308

Query: 299 NKQFHLLDGDKISTLFAKFIGQLTARAGAD--DKLTVGVVQTAYANGNSTRYIASELGIP 356
           +  F+LLDGDKISTLFA FI      AG D  +++ +GVVQTAYANG+ST Y+   L IP
Sbjct: 309 SNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIP 368

Query: 357 SACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVV-------AGVASTND-- 407
            AC KTGVKHLHH A T+YDIG+YFEANGHGT++FS+ F +++       + + +T    
Sbjct: 369 VACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLR 428

Query: 408 AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRS 467
           A  TL   S LINQTVGDAI+DM+GV+AVL  L WTP++W  EYTDLPN L K+VVPDRS
Sbjct: 429 ALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDRS 488

Query: 468 IFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELS 527
           +FETTDQER+L SP GLQ KI+  V +++  RSFVRASGTE+AVR+Y EA D  +V +L 
Sbjct: 489 VFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD--DVNKLC 546

Query: 528 KQVTEAVLNSV 538
           ++V +A   SV
Sbjct: 547 QEVLDATAESV 557

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  507 bits (1305), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 354/556 (63%), Gaps = 29/556 (5%)

Query: 1   MSREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60
           M    + +VF++ C             FRD A VLDTVM  TG +A LRS  L+G  VGV
Sbjct: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60

Query: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWE-YWTSLVEEGN 119
           M+TASHN P DNGVK+V+P+G ML + WEP AT LAN A+     Q ++ Y      +  
Sbjct: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120

Query: 120 YTGGAR--LCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNH-----PQLHYLT 172
              G    L VG D+R+S PRLL+ L   A       + + KP I ++     PQLH+LT
Sbjct: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLA-------VPLMKPKIIDYGLLTTPQLHFLT 173

Query: 173 -----SLQRDGVTDAAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFF 226
                +  R  VT+   Y+  F   W  +    G+      RL+ID ANG+G  ++ + F
Sbjct: 174 NAINTTKSRAPVTEDDYYS-FFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLF 232

Query: 227 KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFD 286
           + W     +F L+N  + TP  LN  CGAD+VKTN RLP  +     +  A   LYCSFD
Sbjct: 233 EVWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPA--TLYCSFD 289

Query: 287 GDADRIVFYFVK-NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNS 345
           GDADRIVFY+      FHLLDGDKISTLFA FI +   +AG  +K+++GVVQTAYANGNS
Sbjct: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349

Query: 346 TRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST 405
           T Y+ + L IP +C KTGVKHLHH A T YD+GIYFEANGHGT++FS+KF E    +   
Sbjct: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKE 409

Query: 406 NDAA---STLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVV 462
           N+ +    TL  F+ LINQTVGDAI+DMLGVLAVL  ++ TP  W  EYTDLPNLLTKVV
Sbjct: 410 NNESLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVV 469

Query: 463 VPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQE 522
           VPDRS+F TTDQER+L++PEG Q KIDA V ++K  RSFVRASGTE+AVR+Y EA  PQ+
Sbjct: 470 VPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQD 529

Query: 523 VQELSKQVTEAVLNSV 538
              L+++V++AVL SV
Sbjct: 530 AAALNEEVSKAVLASV 545

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  507 bits (1305), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 274/556 (49%), Positives = 352/556 (63%), Gaps = 29/556 (5%)

Query: 4   EAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63
           + +R +++  C             FR  A  LDTVMF TG +AVLRS +L G  VGVM+T
Sbjct: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAA-NGTFDQWWEYWTSLVEEG--NY 120
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+   TFD+++     L+E    + 
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDL 125

Query: 121 TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL----QR 176
                + VG D+RESSP LL+ L     +V    + +    +T  PQLHY+T+L    QR
Sbjct: 126 DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHV-VDLGCVTT-PQLHYVTNLSNKRQR 183

Query: 177 DG----VTDAAAYNDHFQGCWQKLFPDGVVAWPFD--RLFIDTANGVGAVQLQQFF--KG 228
           +G    V     Y   F   + +LF    +       +LF+DTANG+G  QL++    K 
Sbjct: 184 EGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKD 243

Query: 229 WAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPD-LYCSFDG 287
           WAV  ++  ++N     P+ LN +CGAD+VKTN RLP      +G S + PD LYCSFDG
Sbjct: 244 WAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLP------KGLSPSSPDSLYCSFDG 297

Query: 288 DADRIVFYFVK-NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNST 346
           DADR+VFY+V    +FHLLDGDKISTLFAKF+ +    A   D L +GVVQTAYANG+ST
Sbjct: 298 DADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSST 357

Query: 347 RYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTN 406
            YI   L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS KF++ +    S  
Sbjct: 358 SYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRA 417

Query: 407 D----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVV 462
                A +TL  F+ LINQTVGDAI+DML VLA L  L   P  W  EYTDLPN L K +
Sbjct: 418 QGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCI 477

Query: 463 VPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQE 522
           VPDRSIF+TTDQER+L +P GLQ KID+ +G++   RSFVRASGTE+AVR+Y E +DP +
Sbjct: 478 VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTK 537

Query: 523 VQELSKQVTEAVLNSV 538
           + +   +V E V +SV
Sbjct: 538 LDQFCNEVVEYVKSSV 553

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  503 bits (1294), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 269/559 (48%), Positives = 361/559 (64%), Gaps = 30/559 (5%)

Query: 2   SREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQ---- 57
           +++ +++ F+ +C             FRD A  LDTVMF TG VA LRS  L  +     
Sbjct: 8   NKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSA 67

Query: 58  VGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW----TS 113
           +GVMVTASHNPPEDNGVK+++P G ML ++WEP AT+ AN+AAN +FD++++       +
Sbjct: 68  IGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVT 127

Query: 114 LVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS 173
           L  + N      L +GHD+R+SSP L+ +++ +A  +    I I+  ++T  PQLH+LT+
Sbjct: 128 LENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKI-INYNYVTT-PQLHFLTN 185

Query: 174 LQRDGVT-DAAAYNDHFQ---GCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQF---- 225
           L     T +   Y DHF       Q L+P      PFD L ID ANG+GA Q+++     
Sbjct: 186 LTNTTGTAEEINYYDHFNKYLSQLQSLYPP--FNLPFDNLIIDAANGIGAPQVEKLLFTK 243

Query: 226 --FKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYC 283
             F    + +N  +++N D   P  LN+ CGAD+VKTN +LP  +P     +  L   +C
Sbjct: 244 NKFPPLNI-KNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTL---FC 299

Query: 284 SFDGDADRIVFYFVK--NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYA 341
           S+DGDADRIVFY++      F+LLDGDKI+TLFAKF   L   A  +  L +GVVQTAYA
Sbjct: 300 SYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYA 359

Query: 342 NGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAG 401
           NG+ST YI+S+L +P +CTKTGVKHLHH A T+YDIGIYFEANGHGTV+FSDKF+  +  
Sbjct: 360 NGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTK 419

Query: 402 VASTNDA--ASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLT 459
           +  +  +    TL  FS+LINQTVGDA++DML V+AVL  LQ +P  W  EY DLPN L 
Sbjct: 420 LKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLA 479

Query: 460 KVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAED 519
           KV+VPDRS F TTDQER+LV P+GLQ  ++  V      RSFVRASGTE+AVR+Y EA+ 
Sbjct: 480 KVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKT 539

Query: 520 PQEVQELSKQVTEAVLNSV 538
            +E + LSK+V + V+ SV
Sbjct: 540 QEETEWLSKKVCQLVIESV 558

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  498 bits (1282), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 275/557 (49%), Positives = 348/557 (62%), Gaps = 29/557 (5%)

Query: 1   MSREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60
           ++ + +  + D  C             FR  AA LDTV+FATG +A LRS  L G  +GV
Sbjct: 2   LAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGV 61

Query: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLAN-LAANGTFDQWWEYWTSLVEE-- 117
           MVTASHNPP DNGVKVV+P+G M+PE WEPLAT LAN LA  G+  +  +   S ++   
Sbjct: 62  MVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQREL 121

Query: 118 --------GNYTGG--ARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQ 167
                    +Y  G    L VG D+RES P+LL  L+ +A  +    I      +   PQ
Sbjct: 122 KGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKI--HDQGLLTTPQ 179

Query: 168 LHYLTSLQRDGVTDA--AAYNDHFQGCWQ---KLFPDGVVAWPFDRLFIDTANGVGAVQL 222
           LH+LTS    GV +   + Y +HF   W    +L   G        L ID ANG+GA ++
Sbjct: 180 LHFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKV 239

Query: 223 QQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLY 282
           Q+    WA  + +   +N  +  PE LN +CGADFVK+N R P    D  G       L 
Sbjct: 240 QELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTG-------LG 291

Query: 283 CSFDGDADRIVFYFVKN-KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYA 341
           CS+DGDADR+VFY++    +F LLDGD+IS LFA F   +  +AG   +L++GVVQTAYA
Sbjct: 292 CSYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYA 351

Query: 342 NGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAG 401
           NGNST Y+   L +P +C KTGVKHLHH A T+YDIGIYFEANGHGT++FS KF +V+  
Sbjct: 352 NGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKE 411

Query: 402 VASTNDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKV 461
               + A  TL  FS+LINQTVGDAI+DMLGVLA L   +WTPE WG E+TDLPN L KV
Sbjct: 412 QKERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKV 471

Query: 462 VVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQ 521
           VVPDRS+F TTDQERRL  PEGLQ+KID  V  F++ RSFVRASGTE+AVR+Y EA   +
Sbjct: 472 VVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLE 531

Query: 522 EVQELSKQVTEAVLNSV 538
           +V++LS  V E V+ SV
Sbjct: 532 DVEKLSNTVKELVVKSV 548

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  497 bits (1279), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 271/560 (48%), Positives = 352/560 (62%), Gaps = 33/560 (5%)

Query: 4   EAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63
           E +R ++D  C             FR  A  LDTVMF TG +AVLRS +L G  VGVM+T
Sbjct: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVEEGNYTG 122
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  T F++++     L+E      
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125

Query: 123 GA-----RLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL--- 174
           GA      + VG D+RESSP LL+ L     +V    + +    +T  PQLHY+T L   
Sbjct: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARV-LDLGCVTT-PQLHYITDLSNR 183

Query: 175 -QRDGVTDAAA-----YNDHFQGCWQKLFP--DGVVAWPFDRLFIDTANGVGAVQLQQFF 226
            +R+G +  AA     Y   F G + +LF   D        +LFIDTANG+G  QL++  
Sbjct: 184 REREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLL 243

Query: 227 --KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTS-GALPDLYC 283
             K W V  ++  ++N     P+ LN +CGAD+VKTN RLP      +G S  +   LYC
Sbjct: 244 ASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLP------KGLSPSSFESLYC 297

Query: 284 SFDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYAN 342
           SFDGDADR+VFY+V ++ +FHLLDGDKISTLFAKF+ +    A  +  L +GVVQTAYAN
Sbjct: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357

Query: 343 GNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGV 402
           G+ST YI   L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF++ +   
Sbjct: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417

Query: 403 ASTND----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLL 458
            S  +    A  TL  F+KLINQTVGDA++DML VLA L  L+  P  W  EY DLPN L
Sbjct: 418 LSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKL 477

Query: 459 TKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAE 518
            K +VPDRSIF+TTDQER+L +P GLQ KID+ + ++   RSFVRASGTE+AVR+Y E +
Sbjct: 478 VKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQ 537

Query: 519 DPQEVQELSKQVTEAVLNSV 538
           D  ++ +   ++   V  SV
Sbjct: 538 DMSKLDQFCNEIVGYVKASV 557

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  494 bits (1271), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 269/554 (48%), Positives = 350/554 (63%), Gaps = 31/554 (5%)

Query: 4   EAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63
           E +  ++D  C             FR  A  LDTVMF TG +A+LRS +L G  VGVM+T
Sbjct: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVEEG---- 118
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  + F+++    T L+E      
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125

Query: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL---- 174
           + +    + VG D+RESSP LL+ L    ++V    + +    +T  PQLHY+T L    
Sbjct: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQV-LDLGCVTT-PQLHYITDLSNKR 183

Query: 175 QRDG----VTDAAAYNDHFQGCWQKLFPDGVVAWPFD--RLFIDTANGVGAVQLQQFF-- 226
           +R+G    V     Y   F G + +LF    +       RLFID ANG+G  QL++    
Sbjct: 184 EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 243

Query: 227 KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPD-LYCSF 285
           K W V  ++  ++N     PE LN +CGAD+VKTN RLP      +G S +  D LYCSF
Sbjct: 244 KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLP------KGLSPSSHDSLYCSF 297

Query: 286 DGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGN 344
           DGDADR+VFY+V ++ QFHLLDGDKISTLFAKF+ +    A  ++ L +GVVQTAYANG+
Sbjct: 298 DGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGS 357

Query: 345 STRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAS 404
           ST YI + L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF++V+    S
Sbjct: 358 STNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS 417

Query: 405 TND----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTK 460
                  A  TL  FSKLINQTVGDA++DML VLA L  ++  P  W  EYTDLPN L K
Sbjct: 418 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477

Query: 461 VVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDP 520
            +VPDRSIF+T DQER+L +P GLQ KID  + ++   RSFVRASGTE+AVRIY E +D 
Sbjct: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537

Query: 521 QEVQELSKQVTEAV 534
            ++ +   ++ E V
Sbjct: 538 SQLDQFCNEIVELV 551

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  492 bits (1267), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 272/535 (50%), Positives = 333/535 (62%), Gaps = 15/535 (2%)

Query: 3   REAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMV 62
           RE + ++ +  C             FRD +  LDTVMFATG VA LRS  LNG  VGVM+
Sbjct: 2   REPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMI 61

Query: 63  TASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTG 122
           TASHNP  DNGVKVV+P+G ML + WE  AT LANL AN   +        L   G  + 
Sbjct: 62  TASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTS-GESSV 120

Query: 123 GARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLT--SLQRDGVT 180
             +L VG D+R S P LL  L+ +A ++    IT      T  PQLH+LT  ++      
Sbjct: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTT--PQLHFLTNETMITGAHV 178

Query: 181 DAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240
           D  AY  HF G W ++     V  P   + +D ANG+G  ++      W   + +  ++N
Sbjct: 179 DEQAYFAHFLGAWDQIAALQPVKLP--NVVVDCANGIGGPKMSALLTQWGFAK-QCSVIN 235

Query: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KN 299
                PE LN  CGADFVKT+ RLP+      G      DLYCSFDGDADR+VFY++ +N
Sbjct: 236 DKCDEPELLNHGCGADFVKTSQRLPN------GVKPNANDLYCSFDGDADRVVFYYLDQN 289

Query: 300 KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSAC 359
             FHLLDGDKISTLFA F+ +L  +   D  L++GVVQTAYANG+ST+Y+   L +P +C
Sbjct: 290 LGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSC 349

Query: 360 TKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTNDAASTLYHFSKLI 419
           TKTGVKHLHH A   YDIGIYFEANGHGTV+FS+KF+E V   A        L + +KLI
Sbjct: 350 TKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYLAKLI 409

Query: 420 NQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLV 479
           NQTVGDAI+DM+ VLAVL  LQW+P  W  E+TDLPN LTKVVV DRS F TTDQERRLV
Sbjct: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469

Query: 480 SPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAV 534
           SP GLQ+KID  V R K  RSFVRASGTE+AVR+Y EA    E  +LS  V + V
Sbjct: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 260/525 (49%), Positives = 345/525 (65%), Gaps = 23/525 (4%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR KA VLDTVMF TG +A +RS  L G  VGVM+TASHNPP+DNGVK+VDP+G ML + 
Sbjct: 28  FRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKIVDPKGEMLDQA 87

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEG-NYTGGARLCVGHDTRESSPRLLKNLMDA 146
           WEP AT LAN A+ G  +        + + G + T  A++ +  D+RES PRLL+ ++D 
Sbjct: 88  WEPFATELANSASKGKQELIKALDKLITKLGIDDTESAKITISRDSRESGPRLLQAVIDG 147

Query: 147 ALAVSGGSITISKPWITNHPQLHYLTSLQRDGVT---DAAAYNDHFQGCWQKLFP-DGVV 202
              +   ++ +    +   PQLH+LT     G +   + + Y   F   W K+     + 
Sbjct: 148 TKVLK--NVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDIN 205

Query: 203 AWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNH 262
           + P+ R+ ID ANG+G  ++ +         +   ++N  + +PE LN  CGAD+VKTN 
Sbjct: 206 SLPY-RVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKTNQ 264

Query: 263 RLPSEVPDQRGTSGALPD--LYCSFDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIG 319
             P      +G SG   +  +YCSFDGDADRIVFY+   K +F+LLDGDKISTLFAKF  
Sbjct: 265 HFP------KGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFK 318

Query: 320 QLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGI 379
           +L   AGA+++L +GVVQTAYANG+ST Y++S L +P +CT TGVKHLHH A   YDIGI
Sbjct: 319 ELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGI 378

Query: 380 YFEANGHGTVVFSDKFNEVVAGV------ASTNDAASTLYHFSKLINQTVGDAIADMLGV 433
           YFEANGHGTV+FSD+F++ +           T  A  TLY F+ LINQTVGDAI+DML V
Sbjct: 379 YFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNLINQTVGDAISDMLAV 438

Query: 434 LAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVG 493
           LAVL  L+W+P+ W  EYTDLPN L KV+VPDRS+F+T++ ER+LVSP+GLQEKID+ V 
Sbjct: 439 LAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQ 498

Query: 494 RFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV 538
            F+  RSFVRASGTE+AVR+Y EA   ++   L+  V++ V  SV
Sbjct: 499 EFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSV 543

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  489 bits (1259), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 269/522 (51%), Positives = 347/522 (66%), Gaps = 24/522 (4%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR KA VLDTVMF TG +A LRS  L G  VGVM+TASHNPPEDNGVK+VDP+G ML + 
Sbjct: 28  FRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPPEDNGVKIVDPKGEMLEQS 87

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGGA--RLCVGHDTRESSPRLLKNLMD 145
           WE  AT LAN +A  +F  +  Y  +LV E      A   L V  D+RES PRLL  L++
Sbjct: 88  WESYATDLAN-SATQSFTAFLAYLQNLVSELGLDTDALGSLAVARDSRESGPRLLHALLN 146

Query: 146 AALAVSGGSITISKPWITNHPQLHYLTS----LQRDGVTDAAAYNDHFQGCWQKLFP-DG 200
            +  +   +I I+   +   PQLH+LTS    L  D   D   Y   F   W  +    G
Sbjct: 147 GSRVLP--NIRITDYGLLTTPQLHFLTSKRNELPNDTAIDRFFYYKEFLSAWDDITALCG 204

Query: 201 VVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKT 260
           + + P+ +L ID ANG+GA ++++           FR++N D+ TP +LN  CGAD+VKT
Sbjct: 205 IQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVNDDWETPASLNHLCGADYVKT 263

Query: 261 NHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIG 319
           N RLP  +      +     + CSFDGDADRIVFYF  ++ QF LLDGDK++TLFAKF  
Sbjct: 264 NQRLPYGIQ----ANNDCQRICCSFDGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQ 319

Query: 320 QLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGI 379
            + + A   ++L++GVVQTAYANG+ST YI   LGIP  CT TGVKHLHH A   YDIG+
Sbjct: 320 DILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGVKHLHHEA-INYDIGV 378

Query: 380 YFEANGHGTVVFSDKFNEVV-AGVASTNDAASTLY------HFSKLINQTVGDAIADMLG 432
           YFEANGHGTVVFS KF+EVV +G+++ + + S+L        F+ LINQTVGDAI+DM+G
Sbjct: 379 YFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMG 438

Query: 433 VLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACV 492
           VLAVL  L+WTP+ W  EYTDLPN L KV+VPDR++F+TT+ ER+L+SP GLQ KI+A V
Sbjct: 439 VLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALV 498

Query: 493 GRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAV 534
             + +ARSFVRASGTE+AVR+Y EA   +E   L+ +V++ V
Sbjct: 499 AEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  488 bits (1257), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 272/558 (48%), Positives = 354/558 (63%), Gaps = 37/558 (6%)

Query: 4   EAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63
           E +  ++D  C             FR  A  LDTVMF+TG +AVLRS +L G  VGVM+T
Sbjct: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVE----EG 118
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  T F+++      L+E    + 
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125

Query: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL---- 174
           N T    + VG D+RESSP LL+ L  +  +V    + +    +T  PQLHY+T L    
Sbjct: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQV-LDLGCVTT-PQLHYITDLSNRR 183

Query: 175 QRDGVTDAAA----YNDHFQGCWQKLFP----DGVVAWPFDRLFIDTANGVGAVQLQQFF 226
           + +G T   A    Y   F G + +LF     +  ++ P  +LFIDTANG+G  QL++  
Sbjct: 184 KLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP--KLFIDTANGIGGPQLKKLL 241

Query: 227 --KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTS-GALPDLYC 283
             + W V   +  ++N     PE LN +CGAD+VKTN RLP      +G S  +   LYC
Sbjct: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLP------KGLSPSSFDSLYC 295

Query: 284 SFDGDADRIVFYFVKN-KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYAN 342
           SFDGDADR+VFY+V +  +FHLLDGDKISTLFAKF+ +    A  +  L +GVVQTAYAN
Sbjct: 296 SFDGDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYAN 355

Query: 343 GNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGV 402
           G+ST YI + L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF+  +   
Sbjct: 356 GSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSE 415

Query: 403 ASTND------AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPN 456
            S +       A  TL  FS+LINQTVGDAI+DML VLA L  L+ +P  W  EYTDLPN
Sbjct: 416 LSKSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPN 475

Query: 457 LLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCE 516
            L K +VPDRSIF+TTDQER+L++P GLQ+KID  V ++   RSFVRASGTE+AVR+Y E
Sbjct: 476 KLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAE 535

Query: 517 AEDPQEVQELSKQVTEAV 534
            +D  ++ +   +V E V
Sbjct: 536 CKDSSKLGQFCDEVVEHV 553

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  487 bits (1253), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 278/551 (50%), Positives = 356/551 (64%), Gaps = 37/551 (6%)

Query: 1   MSREAVRAVFDAVCXXXXXXXXXXXXXFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60
           +  +A++++++A C             FR KA VLDTVMF TG VA LRS  L G  VGV
Sbjct: 2   LDTKALKSLYEAHCSTGFHYAYGTAG-FRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANG--TFDQWWEYWTSLVEEG 118
           M+TASHNPPEDNGVK+VDP+G ML + WE  AT LAN A+ G   F    E   + +E G
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120

Query: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS----L 174
           +   G+ + V  D+RES PRLL   +     ++  ++ ++   +   PQLH+LTS    L
Sbjct: 121 SNDHGS-IVVARDSRESGPRLLGAFLSGVKVLA--NVKVTDHGLLTTPQLHFLTSKSNEL 177

Query: 175 QRDGVTDAAAYNDHFQGCWQKLFPDGVV-AWPFDRLFIDTANGVGA------VQLQQFFK 227
            +      + Y D+F   W ++     + + P+ +L ID ANG+GA      +   +FFK
Sbjct: 178 PKGTEIGKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEMLSQHKFFK 236

Query: 228 GWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDG 287
           G       F ++N ++ TP++LN  CGADFVKTN +LP  +       G    + CSFDG
Sbjct: 237 G------AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGI----APGGERNRICCSFDG 286

Query: 288 DADRIVFYFV-KNKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNST 346
           DADRIVFY+  KN  FHLLDGDK++TLFAKF  +L   AG  D+L +GVVQTAYANG+ST
Sbjct: 287 DADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSST 346

Query: 347 RYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAST- 405
            YI   LGI   CT TGVKHLHH A  +YDIG+YFEANGHGTVVFS KF +V+    S  
Sbjct: 347 AYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEK 405

Query: 406 --NDAA----STLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLT 459
             +DAA      L+ F+KLINQTVGDAI+DML VLAVL  L+W+PE W  EYTDLPN L 
Sbjct: 406 LESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLI 465

Query: 460 KVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAED 519
           KV+VPDR++F+T + ER+LVSP G+QEKIDA V  F + RSFVRASGTE+AVR+Y EA  
Sbjct: 466 KVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAAT 525

Query: 520 PQEVQELSKQV 530
           PQE + LS+QV
Sbjct: 526 PQETEALSQQV 536

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  483 bits (1244), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/539 (51%), Positives = 347/539 (64%), Gaps = 52/539 (9%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR  A +LD+VMF TG +A LRS     A VGVM+TASHNPP DNGVK+V+ +G ML + 
Sbjct: 24  FRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQD 83

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGG--ARLCVGHDTRESSPRLLKNLMD 145
           WEPLATRLAN  A+  +  +     ++++E N + G   ++ VGHD+RESSPRLL NL+D
Sbjct: 84  WEPLATRLANSVAD--YHTFESTLNAIMQELNISPGHAPQIVVGHDSRESSPRLLANLLD 141

Query: 146 AALAVSGGSITISKPWITNH-----PQLHYLTSLQRDGVTDAAAYNDH----FQGCWQKL 196
              AVS  +       ITNH     PQLH+LT+       + A + D+    F   W +L
Sbjct: 142 GIKAVSPDA------RITNHGLLTTPQLHFLTA-------NPAHFEDYYYRYFLDAWNQL 188

Query: 197 FP-DGVVAW-PFDRLFIDTANGVGAVQLQQFFKGWAVDQ------NKFRL-----LNTDY 243
           F   G+  +  FD+L IDTANG+G     QF K  +  Q       K RL      N  +
Sbjct: 189 FELYGIEGFKSFDKLVIDTANGIGG---PQFLKMLSYSQTDLPHLQKIRLHQIDITNNSW 245

Query: 244 GTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFVKNK-QF 302
             P  LN  CGADFVKTN RLP       G +    +LYCSFDGDADR+VFY+V +   F
Sbjct: 246 LNPSMLNSGCGADFVKTNQRLP------EGINADPRNLYCSFDGDADRVVFYYVDDSLTF 299

Query: 303 HLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKT 362
           HLLDGDKISTL A FI  L   AG  ++L +GVVQTAYANG+ST Y+  +L +P +  KT
Sbjct: 300 HLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVSIAKT 359

Query: 363 GVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTN---DAASTLYHFSKLI 419
           GVKHLHH A T YDIG+YFEANGHGTV+FS  F EV+    + N    +  TL   S+LI
Sbjct: 360 GVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTLTLRLLSRLI 419

Query: 420 NQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLV 479
           NQT+GDAI+DML ++ VL  L W+P  W  EYTDLPN LTKVVVPDRSIF TTDQERRLV
Sbjct: 420 NQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLV 479

Query: 480 SPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNSV 538
           SP GLQ+KID  V      RSF+RASGTE+AVR+Y EA+  +  ++LS +VT+A++ +V
Sbjct: 480 SPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETV 538

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  468 bits (1204), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/528 (51%), Positives = 335/528 (63%), Gaps = 35/528 (6%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR   +VLDTVMF TG VAVLRS  L    VGVM+TASHNPPEDNGVKVV+P G ML + 
Sbjct: 24  FRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKVVEPYGEMLVQN 83

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEGNY--TGGARLCVGHDTRESSPRLLKNLMD 145
           WEP+AT+LAN AA+ +F Q      S++ E N   T  A + V  D+RES PRLL  L  
Sbjct: 84  WEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTTQLANITVARDSRESGPRLLAAL-K 141

Query: 146 AALAVSGGSITISKPWITNHPQLHYL-----TSLQRDGVTDAAAYNDHFQGCWQKLFP-D 199
           A ++V      I    +T  PQLH+L     TS Q   V D+  Y DHF   W +L    
Sbjct: 142 AGISVFPAVKIIDFELLTT-PQLHFLVYSLNTSSQPSQVRDSTYY-DHFVSIWNQLTQLY 199

Query: 200 GVVAWPFDRLFIDTANGVGAVQLQQFF-KGWAVDQNKFRLLNTDYGTPENLNVKCGADFV 258
            V   PF  L ID ANG+GA +++Q   +   + +N    +N +  T + LN  CGADFV
Sbjct: 200 EVTELPF-HLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKTFQLLNESCGADFV 258

Query: 259 KTNHRLPSEV---PDQRGTSGALPDLYCSFDGDADRIVFYFV--KNKQFHLLDGDKISTL 313
           KTN   P+     P Q         LYCSFDGDADR+VFY+V  K  +FHLLDGDKI+TL
Sbjct: 259 KTNQTFPANCNPKPSQ---------LYCSFDGDADRVVFYYVDGKENKFHLLDGDKIATL 309

Query: 314 FAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKT 373
            AK I  L    G  D L +GVVQTAYANG+ST+YI  +L IP +CTKTGVKHLHH A +
Sbjct: 310 LAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHLHHEAVS 369

Query: 374 QYDIGIYFEANGHGTVVFSDKFNEVV-------AGVASTNDAASTLYHFSKLINQTVGDA 426
           +YDIGIYFEANGHGTV+FS +F E V       +G      +  +L   S+LINQTVGDA
Sbjct: 370 RYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQLINQTVGDA 429

Query: 427 IADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQE 486
           I+DML V+A L      PE W   Y DLPN LTKV+VPDRS+F +T+ ER+L+SPEGLQ 
Sbjct: 430 ISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSPEGLQA 489

Query: 487 KIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAV 534
           KID  V +F  +RSFVRASGTE+AVR+Y EAE  +   EL+ +V E V
Sbjct: 490 KIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  468 bits (1203), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 259/535 (48%), Positives = 341/535 (63%), Gaps = 40/535 (7%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR KA +LDTV+F TG +A LRS  L G  VG M+TASHNPP+DNGVK+VDP+G ML ++
Sbjct: 28  FRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKLVDPKGEMLKQE 87

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTG-----GARLCVGHDTRESSPRLLKN 142
           WE  AT LAN A++G      ++   L E  N  G      AR+ V  D+RES  RLLK 
Sbjct: 88  WEVYATELANCASDGKH----QFLHRLQELMNQFGIKADSEARIVVARDSRESGSRLLKA 143

Query: 143 LMDAALAVSGGSITISKPWITNHPQLHYLT-----SLQRDGVTDA--AAYNDHFQGCWQK 195
           L+D     +   I       T  PQLH+LT      ++ + V +   A Y  HF    ++
Sbjct: 144 LVDGTSVFTNVDIVDYDMLTT--PQLHFLTYHLNRQMESERVIEVNEAFYYSHFLSALKE 201

Query: 196 L---FPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVK 252
           L   F    + +P   L ID ANGVG  + ++ F      ++   ++N ++   + LN  
Sbjct: 202 LTELFNIPGLPYP---LVIDAANGVGGAKAEELFMKNTFFKDSTTIINGNWSQHDLLNSF 258

Query: 253 CGADFVKTNHRLPSEVPDQRGTSGA--LPDLYCSFDGDADRIVFYFVK-NKQFHLLDGDK 309
           CGAD+VKTN  LP      +G S A  +  L+CSFDGDADR++FY+   +  FHLLDGDK
Sbjct: 259 CGADYVKTNQCLP------QGISAATDINSLHCSFDGDADRVIFYYRDVDGMFHLLDGDK 312

Query: 310 ISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHH 369
           ISTLFAKF   +   AG  D + +GVVQTAYANG+STRY++  L +P +CT TGVK+LH 
Sbjct: 313 ISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGVKYLHR 372

Query: 370 VAKTQYDIGIYFEANGHGTVVFSDKFNEVVAG-------VASTNDAASTLYHFSKLINQT 422
            A   YD+GIYFEANGHGTV+FS+ FN  V+         A +  A  TL  FSKLINQT
Sbjct: 373 KAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSKLINQT 432

Query: 423 VGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPE 482
           VGDA++DM+ VLAVL  L+WTP+ W  EYTDLPN L KVVVPDRS+F+TT+ ER+LVSP+
Sbjct: 433 VGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQLVSPK 492

Query: 483 GLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNS 537
           GLQ +ID  +  +  ARSFVRASGTE+AVRIY EA   ++  +LS ++++ V+++
Sbjct: 493 GLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLVISA 547

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  456 bits (1173), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 254/527 (48%), Positives = 334/527 (63%), Gaps = 27/527 (5%)

Query: 28  FRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQ 87
           FR +A VL  V+FATG +A LRS  L GA VGVM+TASHNPPEDNGVK+VDP G ML  +
Sbjct: 28  FRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPHGEMLAAE 87

Query: 88  WEPLATRLANLAANGTFDQWWEYWTSLVEEG--NYTGGARLCVGHDTRESSPRLLKNLMD 145
           WE  AT LAN A+ G   +  +    LV+    +    AR+ V  D+R S P+LL  L+D
Sbjct: 88  WEKHATALANCASQGQ-QELLDALHMLVDRLGLDLALRARVVVARDSRASGPQLLDALLD 146

Query: 146 AALAVSGGSITISKPWITNHPQLHYLTSLQRDGVTDAAAYND----HFQGCWQKLFP-DG 200
               +    + +    +   PQLH+LT    +  + A    D    HF    ++L    G
Sbjct: 147 GTRMLE--DVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALEELAALHG 204

Query: 201 VVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKT 260
           +   PF  L +DTANGVGA++ ++ F+   + +N+  ++N ++   E LN  CGAD+VKT
Sbjct: 205 LETLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCGADYVKT 263

Query: 261 NHRLPSEVPDQRGTSGAL--PDLYCSFDGDADRIVFYFVKNKQ-FHLLDGDKISTLFAKF 317
              LP      +G S  L    L+CS+DGDADR++FY++  ++ FHLLDGDKISTL AKF
Sbjct: 264 KQCLP------QGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAKF 317

Query: 318 IGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDI 377
           +      AG +D + +GVVQTAYANG+STRY++  L +P +CT TGVKHLH  A  +YD+
Sbjct: 318 LQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYDV 377

Query: 378 GIYFEANGHGTVVFSDKFNEVV-------AGVASTNDAASTLYHFSKLINQTVGDAIADM 430
           GIYFEANGHGTV+FS+ F   V       A  A    +  TL  F+ LINQT+GDAIADM
Sbjct: 378 GIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIADM 437

Query: 431 LGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDA 490
           L V+A+L  L W+PE W  +YTDLPN L KVVVPDRS+F+TT+ E++L SP GLQE ID 
Sbjct: 438 LAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDD 497

Query: 491 CVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNS 537
            V  +   RSFVRASGTE+AVRIY EA   Q+  EL+ +V+  V+ S
Sbjct: 498 IVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 108/316 (34%), Gaps = 61/316 (19%)

Query: 59  GVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTS--LVE 116
           GVM+TASHNP  DNG KV    G     Q  P    L     +   + W   W S  L+E
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGC----QIIPPHDELIGRHIDANLEPWTRAWDSKALIE 215

Query: 117 EGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQR 176
           E   +G       HD R+   +  K+ +   L           PW    P          
Sbjct: 216 EAIKSGKL-----HDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTP---------- 260

Query: 177 DGVTDAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKF 236
                         G   + F + V +                        G   D++  
Sbjct: 261 ------------MHGVGYEFFKEAVAS----------------------VLGIEEDKDYI 286

Query: 237 RLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYF 296
            +    Y  PE   V       +    +  +V D  G +  L +     D DADR     
Sbjct: 287 VVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLAN-----DPDADRFSVAV 341

Query: 297 VKNKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIP 356
             + +++ L G++I  LFA+   Q   +    D+  + ++ +A  +    R +A E G  
Sbjct: 342 KYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSA-VSSQLLRKMAEEEGFL 400

Query: 357 SACTKTGVKHLHHVAK 372
           +  T TG K L + A+
Sbjct: 401 AVETLTGFKWLGNRAR 416

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 47/121 (38%), Gaps = 21/121 (17%)

Query: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW--- 111
           GA  GVM+TASHNP  DNG KV    G     Q  P   RL   +     + W   W   
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGC----QIIPPHDRLIAQSILDNLNPWERAWDCK 207

Query: 112 ---TSLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQL 168
                  E+G +    +  V H  +E S +L          VS      SKPW    P L
Sbjct: 208 AVIAEATEKGYFVDMKKPMVDHYVKEISDKL----------VSSDIGDRSKPWFVYTP-L 256

Query: 169 H 169
           H
Sbjct: 257 H 257

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 19/152 (12%)

Query: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGML-PEQWEPLATRL-ANLAANGTFDQWWEYWT 112
           GA  G+M+TASHNP  DNG KV    G  + P   + +A+ + ANL     +DQ W+   
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVP---WDQAWDA-Q 215

Query: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNL---MDAALAVSGGSITISKPWITNHPQLH 169
            L+E+       RL   HD ++    L+KN    + ++L  +       K W    P   
Sbjct: 216 KLIEDAR--NNNRL---HDVKQ---ELIKNYVQRIQSSLVTTNSLADCGKNWFVYTPMHG 267

Query: 170 YLTSLQRDGVTDAAAY--NDHFQGCWQKLFPD 199
               +  + VT+      ++H+     + FPD
Sbjct: 268 VGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPD 299

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 52/119 (43%), Gaps = 19/119 (15%)

Query: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGML--PEQWEPLATRLANLAANGTFDQWWEYWT 112
           GA VGVM+TASHNP  DNG KV    G  +  P   E   +   NL     + + W+ W 
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLTL---WPKAWK-WD 211

Query: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITIS-----KPWITNHP 166
            L++EG  T     C+ +   E   R  K +  + +       TIS     KPW    P
Sbjct: 212 ELLKEGLDTK----CLVYAGEEMIERYTKKMGQSLV----DRTTISAEKEGKPWFVYTP 262

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 19/27 (70%)

Query: 55  GAQVGVMVTASHNPPEDNGVKVVDPEG 81
           GA VGVM+TASHNP  DNG KV    G
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 19/117 (16%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEG-GMLPEQWEPLATRL-ANL-AANGTFDQWWEYWT 112
           A VGVM+TASHNP  DNG KV    G  ++P     +A  + +NL   NG +D W +   
Sbjct: 145 ASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARSIESNLEPGNGVWD-WDQTMQ 203

Query: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDA---ALAVSGGSITISKPWITNHP 166
              +EG      +L  G D      ++L+  +     +      S+   KPW    P
Sbjct: 204 QAADEG------KLIYGRD------KMLEQYISCVKDSFVTELDSLPKGKPWFVYTP 248

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTS- 113
            A +GVM+TASHNP  DNG KV    G  +      +     N+AA  T D+  E W+S 
Sbjct: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQI------IPPHDKNIAA--TIDENLEPWSSD 202

Query: 114 ----LVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHP 166
                  E N      + V  +      + +K+++ ++ ++S  +    KPW    P
Sbjct: 203 WNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS-SISRPNNNGKKPWFVYTP 258

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%)

Query: 55  GAQVGVMVTASHNPPEDNGVKV 76
           GA VG+M+TASHNP  DNG KV
Sbjct: 151 GASVGIMITASHNPKMDNGYKV 172

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 18/26 (69%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEG 81
           A VGVMVTASHNP  DNG KV    G
Sbjct: 164 ASVGVMVTASHNPKMDNGYKVYYSNG 189

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 18/24 (75%)

Query: 53  LNGAQVGVMVTASHNPPEDNGVKV 76
           L  A +GVM+TASHNP  DNG KV
Sbjct: 152 LYSASIGVMITASHNPEMDNGYKV 175

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWT-SL 114
           A VGVM+TASHNP  DNG KV    G     Q  P   +  + A +   + W   W    
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGC----QIIPPHDQAISNAIDMNLEPWANAWNFDD 204

Query: 115 VEEGNYTGGARLCVGHDTRESSPRL-LKNLMDAALAVSGGSITI-SKPWITNHP 166
           +   N   G  +     +RE   +L L+ + D  +  +   + + SKPW    P
Sbjct: 205 ILSKNLKQGKLMY----SREEMLKLYLEKISDNLVETTPLKLEVRSKPWFVYTP 254

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 18/26 (69%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEG 81
           A VGVMVTASHNP  DNG KV    G
Sbjct: 149 ASVGVMVTASHNPKMDNGYKVYYSNG 174

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 56  AQVGVMVTASHNPPEDNGVKV 76
           A VGVM+TASHNP  DNG KV
Sbjct: 151 ASVGVMITASHNPKMDNGYKV 171

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 56  AQVGVMVTASHNPPEDNGVKV 76
           A VGVM+TASHNP  DNG KV
Sbjct: 146 ASVGVMITASHNPKMDNGYKV 166

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 56  AQVGVMVTASHNPPEDNGVKV 76
           A VGVM+TASHNP  DNG KV
Sbjct: 152 ASVGVMITASHNPKMDNGYKV 172

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 56  AQVGVMVTASHNPPEDNGVKV 76
           A VGVM+TASHNP  DNG KV
Sbjct: 149 ASVGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 56  AQVGVMVTASHNPPEDNGVKV 76
           A VGVM+TASHNP  DNG KV
Sbjct: 149 ASVGVMITASHNPKMDNGYKV 169

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa]
           {ON} YMR247C (REAL)
          Length = 1566

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 122 GGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRDGVTD 181
            G R+ + +      P LL +L    L +   S+ + +   T    L  L++L +D   +
Sbjct: 21  NGVRISLNYFDGSPDPSLLNSLYSNELKLIFKSL-LKRDETTKEKALTDLSNLMKDFDQN 79

Query: 182 AAAYNDHFQGCWQKLFPDGVVA-WPFDRL 209
              ++D F  CW +++P  +++ + F RL
Sbjct: 80  GCFFDDIFLLCWSQIYPKLIISDYKFIRL 108

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 59  GVMVTASHNPPEDNGVKVVDPEG 81
           GVM+TASHNP +DNG KV    G
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNG 180

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW 111
           A  G+M+TASHNP  DNG KV    G     Q  P   RL +   +     W + W
Sbjct: 153 ASAGIMITASHNPKMDNGYKVYYSNGC----QIIPPHDRLISETIDQNLVPWNKAW 204

>KNAG0F03960 Chr6 (745722..750338) [4617 bp, 1538 aa] {ON} Anc_7.541
           YPR184W
          Length = 1538

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 66/161 (40%), Gaps = 22/161 (13%)

Query: 220 VQLQQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTN--HRLPSEVPDQRGT--- 274
           V+L Q+    A D   FR+L   YG   +L+V  G   +KTN      ++V D+ G    
Sbjct: 348 VRLGQYTAEKATDPETFRVLGHRYGKTLDLSVLIG--ILKTNFGQEFTADVDDKVGKILD 405

Query: 275 SGALPDLYCSFDGDADRIVFYFVKNKQFHLLDGD--------KISTLFAKFIGQLTARAG 326
              LP LY  +D D + I+       ++  LDG+        K   L   +  + TA+ G
Sbjct: 406 EINLP-LYKEYDEDVNEILEQLFNRIKYLRLDGNGPRQGEVTKELPLTEPYFTRFTAKDG 464

Query: 327 ADDKLTV------GVVQTAYANGNSTRYIASELGIPSACTK 361
            +  L        G     +A+  S  YI  E+ +   C K
Sbjct: 465 EEYALANNGWIWDGNPLVDFASSQSKAYIRREVIVWGDCVK 505

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 47  VLRSWRLNGAQVGVMVTASHNP--PE-DNGVKVVDPEGGMLPEQ 87
           ++R++  N    G+++TASHNP  PE D G+K   P GG  PE 
Sbjct: 102 IIRTYEDNCNGGGIILTASHNPGGPENDLGIKYNLPNGGPAPES 145

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 56  AQVGVMVTASHNPPEDNGVKVVDPEGGML--PEQWEPLATRLANL 98
           A  G+M+TASHNP  DNG KV    G  +  P       + LANL
Sbjct: 154 ASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANL 198

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 47  VLRSWRLNGAQVGVMVTASHNP--PE-DNGVKVVDPEGGMLPEQ 87
           V+R++    +  G+++TASHNP  PE D G+K   P GG  PE 
Sbjct: 102 VIRTYEDKCSGGGIILTASHNPGGPENDLGIKYNLPNGGPAPES 145

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 47  VLRSWRLNGAQVGVMVTASHNP--PE-DNGVKVVDPEGGMLPE 86
           ++R++       G+++TASHNP  PE D G+K   P GG  PE
Sbjct: 102 IIRTYEEKCTGGGIILTASHNPGGPENDLGIKYNLPNGGPAPE 144

>KAFR0F03460 Chr6 complement(687700..689142) [1443 bp, 480 aa] {ON}
           Anc_1.95 YNL261W
          Length = 480

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%)

Query: 387 GTVVFSDKFNEVVAGVASTNDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQW 442
            + VF +K N    G  ST    + +Y+F  LI QT      + +  L+ LI L+W
Sbjct: 211 NSTVFHEKLNSFDNGTISTEICKNFVYNFINLIVQTFHSYTGNNIFALSDLIDLKW 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,348,485
Number of extensions: 2423229
Number of successful extensions: 5238
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5209
Number of HSP's successfully gapped: 46
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)