Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009306.12ON1091094992e-66
YEL059C-A (SOM1)6.12ON74641222e-09
Ecym_30156.12ON70521186e-09
Suva_5.96.12ON73641162e-08
Smik_5.286.12ON74551134e-08
TDEL0G045906.12ON74691117e-08
KLLA0D00880g6.12ON71571064e-07
SAKL0E00924g6.12ON97721074e-07
ACR014C6.12ON70521047e-07
KAFR0L003506.12ON7161971e-05
KLTH0C11484g6.12ON8955971e-05
Skud_5.306.12ON7464942e-05
Kwal_56.223596.12ON9153953e-05
NCAS0F002106.12ON7966848e-04
ZYRO0F00528g6.12ON7759820.002
Kpol_1032.36.12ON7833740.025
TPHA0M002206.12ON7860720.042
TBLA0G009906.12ON7826670.29
Suva_15.3915.47ON61047632.5
Skud_8.2545.47ON61039614.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00930
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...   196   2e-66
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    52   2e-09
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    50   6e-09
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    49   2e-08
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    48   4e-08
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    47   7e-08
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    45   4e-07
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    46   4e-07
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    45   7e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    42   1e-05
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    42   1e-05
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    41   2e-05
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    41   3e-05
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    37   8e-04
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    36   0.002
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    33   0.025
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    32   0.042
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    30   0.29 
Suva_15.391 Chr15 complement(686070..687902) [1833 bp, 610 aa] {...    29   2.5  
Skud_8.254 Chr8 complement(450923..452755) [1833 bp, 610 aa] {ON...    28   4.9  

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
           Anc_6.12 YEL059C-A
          Length = 109

 Score =  196 bits (499), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 97/109 (88%), Positives = 97/109 (88%)

Query: 1   MAPNVRVLTRNDVPLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEGTNKG 60
           MAPNVRVLTRNDVPLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEGTNKG
Sbjct: 1   MAPNVRVLTRNDVPLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEGTNKG 60

Query: 61  KCVATKRYEVXXXXXXXXXXXXNPKSPQTTTGNTARDRKSTSHTTKPST 109
           KCVATKRYEV            NPKSPQTTTGNTARDRKSTSHTTKPST
Sbjct: 61  KCVATKRYEVTGDTTTTTTSRTNPKSPQTTTGNTARDRKSTSHTTKPST 109

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 51.6 bits (122), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54
          MAP   + TR+    P      Q  C LKELVQ+ C+  G ++ C+PF+RLFE C  P +
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 55 EGTN 58
            TN
Sbjct: 61 SATN 64

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 50.1 bits (118), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 1  MAPNVRVLTRNDV-PLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51
          MAP   ++TR++V P+      C+L  L+Q  C  DG  + C PF+RLFE+C
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEEC 52

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 49.3 bits (116), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54
          MAP   +  R+    P      +  C LKELVQ+ C+  G  + C+PFRRLFE C  P +
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 55 EGTN 58
            TN
Sbjct: 61 AATN 64

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 48.1 bits (113), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51
          MAP   + +R+    P      Q  C LKELVQ+ C+  G  + C+PF+RLFE C
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHC 55

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 47.4 bits (111), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 1  MAPNVRVLTRNDVP-LPQPQDGCVLKELVQFRCE---NDGTQWQCAPFRRLFEQCPSQEG 56
          MAP   VL R ++P +PQ ++ CVLK L QF+C+        ++C PF+RLF++C    G
Sbjct: 1  MAPPTPVLAREELPEIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59

Query: 57 TNKGKCVAT 65
            K +   T
Sbjct: 60 RFKSRIEVT 68

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 45.4 bits (106), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1  MAPNVRVLTRNDVP-LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEG 56
          MAP  ++L  +    + Q  + C LK LVQ  C  +G  + C PF+RLFEQC  ++G
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 45.8 bits (107), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPSQEGTN 58
          MAP   V  ++++   L + +  C LK L+Q  C  +G ++ C PF+RLF++C     T 
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 59 KGKCVATKRYEV 70
           G+   T R E+
Sbjct: 61 DGRTSRTVRIEI 72

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 44.7 bits (104), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 1  MAPNVRVLTRNDV-PLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51
          MAP   VLTR +V P       CVL  L Q  C  DG  + C PF+RLF +C
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFREC 52

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 42.0 bits (97), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 1  MAPNVRVLTRNDVPLP-QPQDGCVLKELVQFRCEND-GTQWQCAPFRRLFEQCPSQEGTN 58
          MAP +RV+  +      +  +GC L  LVQ+ CE   G   +C PF+R+F +C  + G  
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60

Query: 59 K 59
          K
Sbjct: 61 K 61

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 42.0 bits (97), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPS 53
          MAP   V  + ++     +  + C LK LVQ  CE +G ++ C PF+RLF++C +
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA 55

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 40.8 bits (94), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54
          MAP   + +R+    P         C LKELVQ+ C+     + C PF+RLFE+C  P +
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 55 EGTN 58
            T+
Sbjct: 61 SATD 64

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 41.2 bits (95), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51
          MAP   V  + ++   L      C+ K L Q  C  DG Q+ C PF+R+F++C
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKEC 53

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 37.0 bits (84), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 16/66 (24%)

Query: 1  MAPNVRVLTRNDVPL-------------PQPQDGCVLKELVQFRCE--NDGTQWQCAPFR 45
          MAP V V  ++D+ +              +  DGC   +L QF+C+   DG Q+ C PF+
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDG-QYICFPFK 59

Query: 46 RLFEQC 51
          R+F++C
Sbjct: 60 RVFQEC 65

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 1  MAPNVRVLT-------RNDVPLPQPQDGCVLKELVQFRCENDG-TQWQCAPFRRLFEQC 51
          MAP   +LT       R  V + + ++ C LK L Q  C  +   ++ C PF+R+FE+C
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKC 59

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 33.1 bits (74), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 22 CVLKELVQFRCENDGT---QWQCAPFRRLFEQC 51
          C L  + QF+C  + +   ++ C PF+RLFE+C
Sbjct: 30 CTLTSITQFQCRFENSYEGEYICLPFKRLFEEC 62

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 32.3 bits (72), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 1  MAPNVRVLTRNDVPLP------QPQDGCVLKELVQFRCEN---DGTQWQCAPFRRLFEQC 51
          MAP   V+ R  V         + +  C LK L Q+ C+    +  ++ C PF+RLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 27 LVQFRC-ENDGTQWQCAPFRRLFEQC 51
          + Q+ C +ND  Q +C PF+R+F+Q 
Sbjct: 39 ITQYECFDNDKGQIECFPFKRIFQQV 64

>Suva_15.391 Chr15 complement(686070..687902) [1833 bp, 610 aa] {ON}
           YHR188C (REAL)
          Length = 610

 Score = 28.9 bits (63), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 9/47 (19%)

Query: 1   MAPNV-RVLTRNDVPLPQPQDGCVLKELVQFRCENDG--TQWQCAPF 44
           MA +V   L RN+ P+P+P DG  L      RC+ D     +QC P 
Sbjct: 264 MATHVPSALARNERPIPKPVDGSSL------RCDTDKPFDSYQCFPL 304

>Skud_8.254 Chr8 complement(450923..452755) [1833 bp, 610 aa] {ON}
           YHR188C (REAL)
          Length = 610

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 8/39 (20%)

Query: 8   LTRNDVPLPQPQDGCVLKELVQFRCEND--GTQWQCAPF 44
           L RN+ P+P+P DG  L      RC+ D     +QC P 
Sbjct: 272 LARNERPIPKPLDGSTL------RCDTDKPFDSYQCFPL 304

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,329,557
Number of extensions: 383039
Number of successful extensions: 625
Number of sequences better than 10.0: 21
Number of HSP's gapped: 622
Number of HSP's successfully gapped: 21
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)