Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009206.14ON53153127920.0
TDEL0G045506.14ON56450115340.0
Skud_5.296.14ON60848415300.0
YEL060C (PRB1)6.14ON63545615300.0
Smik_5.276.14ON60845615250.0
Suva_5.76.14ON66450715260.0
Kwal_56.223876.14ON54346115110.0
SAKL0E01012g6.14ON54449015030.0
TBLA0A073006.14ON57358914980.0
KLLA0D00979g6.14ON56157214960.0
KLTH0C11396g6.14ON55046914750.0
ZYRO0C07942g6.14ON54855614340.0
NCAS0F002206.14ON69541614480.0
ACR012C6.14ON54156414310.0
Kpol_1032.56.14ON68050614440.0
KAFR0L003606.14ON50245814090.0
NDAI0K028806.14ON70449114190.0
CAGL0B03619g6.14ON46846513850.0
Ecym_30186.14ON57557813820.0
TPHA0M002306.14ON58556213411e-180
Kpol_1045.756.14ON47745413011e-176
Skud_15.1646.14ON48241411771e-157
Suva_15.1786.14ON47641311611e-154
Smik_15.1726.14ON47841011601e-154
YOR003W (YSP3)6.14ON47850311441e-152
CAGL0E02651g6.14ON48541410791e-142
KAFR0B065506.14ON45647610571e-139
NCAS0D026306.14ON45140310311e-135
NDAI0I022806.14ON4824209891e-128
KNAG0F02970singletonON4203909171e-119
CAGL0L13266gsingletonON5795166863e-82
SAKL0A02002g6.313ON4794115213e-59
ZYRO0D08822g6.313ON4903845171e-58
NCAS0D043906.313ON4923855162e-58
Suva_3.846.313ON5273655122e-57
Smik_3.1496.313ON4913135031e-56
YCR045C (RRT12)6.313ON4913135032e-56
TDEL0A072806.313ON4363464931e-55
Kpol_1018.56.313ON4653754932e-55
KNAG0I024706.313ON4753674916e-55
KLTH0A06094g6.313ON4963154873e-54
CAGL0L10802g6.313ON5173424851e-53
Ecym_21056.313ON6103124882e-53
Kpol_1028.616.313ON5183284823e-53
AAR069W6.313ON7682984915e-53
Skud_3.1246.313ON5403134816e-53
NDAI0I005606.313ON4833904707e-52
TBLA0F039706.313ON7343194764e-51
Kwal_23.61836.313ON4933164638e-51
TPHA0D037606.313ON6073184565e-49
KAFR0J024506.313ON4783164417e-48
KLLA0F06028g6.313ON5083304341e-46
Kwal_33.133721.78ON3772593813e-40
KLTH0F02288g1.78ON3802913682e-38
TBLA0A067006.313ON4972583724e-38
ZYRO0F16764g1.78ON3863173102e-30
Kpol_2000.691.78ON3863023041e-29
TPHA0B045201.78ON3882722882e-27
TDEL0C062301.78ON3642922581e-23
TBLA0A054101.78ON3822852563e-23
NCAS0A008802.6ON833324980.003
Suva_14.1062.6ON809258970.004
YNL238W (KEX2)2.6ON814255950.007
Skud_14.1012.6ON819259950.007
Smik_14.972.6ON814259920.014
KLLA0D19811g2.6ON756247870.064
NDAI0F038902.6ON833253860.081
ZYRO0F15598g2.6ON790251840.14
SAKL0G00440g2.6ON836117800.42
Skud_4.6465.450ON49394751.3
Ecym_64862.6ON78190751.7
TPHA0P017902.6ON799246732.5
KLTH0H00418g2.6ON81192732.8
KAFR0A080402.6ON766249733.0
KNAG0F007702.6ON826251723.3
TDEL0B069402.601ON91299715.1
Kpol_1015.82.6ON84392698.1
CAGL0J07546g2.6ON789255698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00920
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...  1080   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   595   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   593   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   593   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   592   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   592   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   586   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   583   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   581   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   580   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   572   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   556   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   562   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   555   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   560   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   547   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   551   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   538   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   536   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   521   e-180
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   505   e-176
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   457   e-157
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   451   e-154
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   451   e-154
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   445   e-152
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   420   e-142
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   411   e-139
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     401   e-135
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   385   e-128
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              357   e-119
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   268   3e-82
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   205   3e-59
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   203   1e-58
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   203   2e-58
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   201   2e-57
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   198   1e-56
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   198   2e-56
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   194   1e-55
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   194   2e-55
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   193   6e-55
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   192   3e-54
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   191   1e-53
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   192   2e-53
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   190   3e-53
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   193   5e-53
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   189   6e-53
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    185   7e-52
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   187   4e-51
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   182   8e-51
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   180   5e-49
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   174   7e-48
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   171   1e-46
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   151   3e-40
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   146   2e-38
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   147   4e-38
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   124   2e-30
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   121   1e-29
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   115   2e-27
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   103   1e-23
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   103   3e-23
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    42   0.003
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    42   0.004
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    41   0.007
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    41   0.007
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    40   0.014
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    38   0.064
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    38   0.081
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    37   0.14 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.42 
Skud_4.646 Chr4 (1149707..1151188) [1482 bp, 493 aa] {ON} YDR376...    33   1.3  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    33   1.7  
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    33   2.5  
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    33   2.8  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    33   3.0  
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    32   3.3  
TDEL0B06940 Chr2 complement(1225910..1228648) [2739 bp, 912 aa] ...    32   5.1  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    31   8.1  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    31   8.8  

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/531 (98%), Positives = 521/531 (98%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK 60
           MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK 60

Query: 61  DEHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQLLQQ 120
           DEHRPCKHGKEAHDEEELAPLYTPG          NKYIILFKEGVTAEQISAHKQLLQQ
Sbjct: 61  DEHRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQLLQQ 120

Query: 121 VLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTN 180
           VLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTN
Sbjct: 121 VLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTN 180

Query: 181 EFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQ 240
           EFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQ
Sbjct: 181 EFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQ 240

Query: 241 WGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVE 300
           WGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVE
Sbjct: 241 WGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVE 300

Query: 301 FAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDAC 360
           FAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDAC
Sbjct: 301 FAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDAC 360

Query: 361 NTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSM 420
           NTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSM
Sbjct: 361 NTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSM 420

Query: 421 ASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIY 480
           ASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIY
Sbjct: 421 ASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIY 480

Query: 481 NGGGADLSDFWGDKGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
           NGGGADLSDFWGDKGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF
Sbjct: 481 NGGGADLSDFWGDKGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/501 (62%), Positives = 365/501 (72%), Gaps = 33/501 (6%)

Query: 53  HHGPKHEKD-----EHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVT 107
           H GP HE       EHR   H       E +APL  P           ++YI++ K   +
Sbjct: 75  HDGPSHEGHHDALPEHRGIVHKMG----EGVAPLSIP------PNAFPHRYIVVLKHS-S 123

Query: 108 AEQISAHKQLLQQVLLETSD--------VSAQGI--VADVLDSFDLEGVLSGYVAELSPM 157
            E+I+ H + + Q  L++           SAQG+     + DSFD+ G+L+GYV   +  
Sbjct: 124 PEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYFTDA 183

Query: 158 VLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGE 217
           V+EL+R+SP V  VE DS VH +EFDTQN APWGL+RISHR+ L+LGSFNKYL+DD AG+
Sbjct: 184 VVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGK 243

Query: 218 GVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRAN 277
           GV SY+IDTGINVKH++FEGRA WGKTIP ND D DGNGHGTHCAGTIASKHYGVAK A+
Sbjct: 244 GVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGAD 303

Query: 278 VIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRV 337
           V+AVKVLRSNGSGSMSDVI GVEFAA+ H    K   K FKGSTANMSLGGGKSP+LD  
Sbjct: 304 VVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLA 363

Query: 338 VDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAP 397
           V+AAVK G+HF+VAAGNENQDACNTSPAA+E+A+TVGASTLSDDRAYFSN+G CVDIFAP
Sbjct: 364 VNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAP 423

Query: 398 GLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQF--GTSAQITPEQLK 455
           GLNILSTY GSDDATATLSGTSMASPHVAGLLTYFLSLQP+  S F    S  +TPEQLK
Sbjct: 424 GLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLK 483

Query: 456 KKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHE-----YDNV 510
           KKL+ YSTK +L+DLPEDTPNALIYNGGG  L  FW    K+     F         DN+
Sbjct: 484 KKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNL 543

Query: 511 WASSDAMFEQVRAMFGKLNIF 531
            A +DA+F+QVR +  +LNI 
Sbjct: 544 GAKTDALFDQVRDVLDRLNII 564

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/484 (61%), Positives = 362/484 (74%), Gaps = 23/484 (4%)

Query: 70  KEAHDEEELAPLYTPGXX--XXXXXXXXNKYIILFKEGVTAEQISAHKQLLQQVLLET-S 126
           ++A   E+LAPL +              N+YII+FK+GV  E    HK+ + Q  L++  
Sbjct: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185

Query: 127 DVSAQGI--------------VADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVE 172
           ++SA+                   + DSF+++ + SGY+   +  +++L+R++P V  VE
Sbjct: 186 NLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVE 245

Query: 173 QDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKH 232
           +DS V   +FDTQN+APWGLARISHR+ L+LGSFNKYLYDD AG GV SY+IDTG+NV H
Sbjct: 246 RDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNH 305

Query: 233 KEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSM 292
           K+FE RA WGKTIP ND D DGNGHGTHCAGTIASKHYGVAK ANV+AVKVLRSNGSG+M
Sbjct: 306 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM 365

Query: 293 SDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAA 352
           SDV+ GVE+AA+ H  +A+   K FKGSTANMSLGGGKSP+LD  V+AAV+ G+HF+VAA
Sbjct: 366 SDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAA 425

Query: 353 GNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDAT 412
           GNENQDACNTSPA++++AITVGASTLSDDRAYFSNWG CVDIFAPGLNILSTY GSDDAT
Sbjct: 426 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDAT 485

Query: 413 ATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDL 470
           ATLSGTSMASPHVAGLLTYFLSLQP   S+F    Q  +TP+QLK KL+ YSTK +LFD+
Sbjct: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDV 545

Query: 471 PEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYDN---VWASSDAMFEQVRAMFGK 527
           PEDTPNALIYNGGG DLS FW D  KKSH   F  E +    + + +D +FEQVR +  K
Sbjct: 546 PEDTPNALIYNGGGQDLSAFWNDT-KKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDK 604

Query: 528 LNIF 531
           LNI 
Sbjct: 605 LNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/456 (64%), Positives = 352/456 (77%), Gaps = 21/456 (4%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLE--------------TSDVS-AQGIVADVLDS 140
           N+YII+FK G   E+I  HK+ +QQ  L+              T D S +      + DS
Sbjct: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240

Query: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200
           F+++ + SGY+   +  +++L+R++P V  VE+DS V   EFDTQN+APWGLARISHR+ 
Sbjct: 241 FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER 300

Query: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260
           L+LGSFNKYLYDD AG GV SY+IDTG+N+ HK+FE RA WGKTIP ND D DGNGHGTH
Sbjct: 301 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 360

Query: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320
           CAGTIASKHYGVAK ANV+AVKVLRSNGSG+MSDV+ GVE+AAK H  +A+   K FKGS
Sbjct: 361 CAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFKGS 420

Query: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380
           TANMSLGGGKSP+LD  V+AAV++G+HF+VAAGNENQDACNTSPA++++AITVGASTLSD
Sbjct: 421 TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 480

Query: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440
           DRAYFSNWG CVD+FAPGLNILSTY GSDDATATLSGTSMASPHVAGLLTYFLSLQP   
Sbjct: 481 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD 540

Query: 441 SQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498
           S+F    Q  +TP+QLKKKL+ YSTK +LFD+PEDTPN LIYNGGG DLS FW D  KKS
Sbjct: 541 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDT-KKS 599

Query: 499 HKPLFAHEYDN---VWASSDAMFEQVRAMFGKLNIF 531
           H   F  E +    + + +D +F+QVR +  KLNI 
Sbjct: 600 HSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/456 (63%), Positives = 355/456 (77%), Gaps = 21/456 (4%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLET-SDVSAQGI--------------VADVLDS 140
           N+YI++FK+GV  E+++ HK+ + Q  L++  ++SA+                   + DS
Sbjct: 154 NRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDS 213

Query: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200
           F+++ + SGY+   +  +++L+R++P V  VE+DS V   EFDTQN+APWGLARISHR+ 
Sbjct: 214 FNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHRER 273

Query: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260
           L+LGSFNKYLYDD AG GV SY+IDTG+N+ HK+FE RA WGKTIP ND D DGNGHGTH
Sbjct: 274 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 333

Query: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320
           CAGTIASKHYGVAK ANV+AVKVLRSNGSG+MSDV+ GVE+AAK H  +A+   K FKGS
Sbjct: 334 CAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGFKGS 393

Query: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380
           TANMSLGGGKSP+LD  V+AAV+ G+HF+VAAGNENQDACNTSPA++++AITVGASTLSD
Sbjct: 394 TANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 453

Query: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440
           DRAYFSNWG CVD+FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLLTYFLSLQP   
Sbjct: 454 DRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSD 513

Query: 441 SQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498
           S+F    Q  +TP+QLKKKL+ YSTK +LFD+PEDTPN LIYNGGG DLS FW D  KKS
Sbjct: 514 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWNDT-KKS 572

Query: 499 HKPLFAHEYDN---VWASSDAMFEQVRAMFGKLNIF 531
           H     HE +    + + +D +FEQVR +  KLNI 
Sbjct: 573 HPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLNII 608

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/507 (59%), Positives = 371/507 (73%), Gaps = 25/507 (4%)

Query: 49  RGRPHHGPKHEKDEHRPCK--HGKEAHDEEELAPLYTPGXXXXXXXXXX--NKYIILFKE 104
           +G+ HHG KH   E    K  HGK+ H   +LAPL +              N+YII+FK+
Sbjct: 159 KGKEHHGKKHHGKELEKGKEPHGKDHH-RGKLAPLVSTEQFNPDAITKIIPNRYIIVFKK 217

Query: 105 GVTAEQISAHKQLLQQVLLE--------------TSDVSAQGIVAD-VLDSFDLEGVLSG 149
            V  E+ + H++ +QQ  L+              T D +     A  + DSF+++ + SG
Sbjct: 218 DVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSG 277

Query: 150 YVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKY 209
           Y+   +  +++L+R++P V  VE+DS V   +FDTQN+APWGLAR+SHR+ L+LGSFNKY
Sbjct: 278 YIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKY 337

Query: 210 LYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKH 269
           LYDD AG GV SY+IDTG+NV HK+FE RA WGKTIP ND D DGNGHGTHCAGTIASKH
Sbjct: 338 LYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKH 397

Query: 270 YGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGG 329
           YGVAK ANV+AVKVLRSNGSG+MSDV+ GVE+AAK H  +A+   K FKGSTANMSLGGG
Sbjct: 398 YGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGG 457

Query: 330 KSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWG 389
           KSP+LD  V+AAV+ G+HF+VAAGNENQDACNTSPA++++AITVGASTLSDDRAYFSN+G
Sbjct: 458 KSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYG 517

Query: 390 SCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQ- 448
            CVD+FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLLTYFLSLQP   S+F    Q 
Sbjct: 518 KCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQD 577

Query: 449 -ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEY 507
            +TP+QLKKKL+ YSTK +LFD+P+DTPNALIYNGGG DLS FW D  K      F  E 
Sbjct: 578 SLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQEL 637

Query: 508 ---DNVWASSDAMFEQVRAMFGKLNIF 531
              + + + +D +FEQVR +  KLNI 
Sbjct: 638 NLDEFIGSKTDLIFEQVRDVLDKLNII 664

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/461 (62%), Positives = 343/461 (74%), Gaps = 26/461 (5%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQV-------------LLETSDVSAQGIVAD-----VL 138
           +YI++FK+ V  E++  H +++ +                E +     GI+A      +L
Sbjct: 83  RYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGIL 142

Query: 139 DSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHR 198
           DSFD+ G+L GY+   +  +++ +R +P V  VEQDS V+ NEFDTQN APWGL+RISHR
Sbjct: 143 DSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHR 202

Query: 199 DPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHG 258
           + L+LGSFNKYLYDDAAG+GV SY+IDTGIN+ HK+FEGRA WGKT+P ND D+DGNGHG
Sbjct: 203 EKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHG 262

Query: 259 THCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFK 318
           THCAGTIASKHYGVAK ANV+AVKVLRSNGSGSMSDV+ GVEFAAK H    K N K FK
Sbjct: 263 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFK 322

Query: 319 GSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTL 378
           GSTANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQDACN+SPAA+E AITVGASTL
Sbjct: 323 GSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTL 382

Query: 379 SDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPE 438
           +DDRAYFSNWG CVDIFAPGLN+LSTY GS+ ATATLSGTSMASPHVAGLLTYFLSLQP+
Sbjct: 383 ADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPD 442

Query: 439 KSSQ-FGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD---- 493
             S+ F  +  ITP QLKKKL+ YSTK  L DLPEDT N LIYNGGG DL DFW      
Sbjct: 443 SDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEE 502

Query: 494 ---KGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
                K +    F    D +   +D ++E++R +F  LNI 
Sbjct: 503 KVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/490 (59%), Positives = 363/490 (74%), Gaps = 32/490 (6%)

Query: 71  EAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQLLQQV------LLE 124
           E  +E +LAPL +            ++YII+FK+  T E+IS HK+++ +        L+
Sbjct: 58  EKGEEVKLAPLVS---SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLD 114

Query: 125 TSD--------------VSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQL 170
           + D              ++A+     + +SFD+  +L+GY+   +  V++ +R + +V+ 
Sbjct: 115 SKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEF 174

Query: 171 VEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINV 230
           +E+DS V  +EFDTQN APWGL+RISHR+ L+LGSFNKYLYDD AG+GV SY+IDTGINV
Sbjct: 175 IEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINV 234

Query: 231 KHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSG 290
            HK+F GRA WGKT+P ND D DGNGHGTHCAGTIAS+HYGVAK A V+A+KVLRSNGSG
Sbjct: 235 NHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSG 294

Query: 291 SMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSV 350
           +MSDV+ GVEFAA+ H   +K N K FKGSTANMSLGGGKSP+LD  V+AAVK G+HF+V
Sbjct: 295 TMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAV 354

Query: 351 AAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDD 410
           AAGNENQDACNTSPAA+E AITVGASTLSDDRAYFSNWG CVDIFAPGLN+LSTY GS+ 
Sbjct: 355 AAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSET 414

Query: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDL 470
           ATATLSGTSMASPHVAGLLTYFLSLQP+  S+F  ++ ITP QLKKKL+ YSTK VL++L
Sbjct: 415 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYEL 474

Query: 471 PEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYDNVWAS---------SDAMFEQV 521
           PEDTPN LIYNGGG DLSDFWG   ++  +     ++ +   S         +D +FE+V
Sbjct: 475 PEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEV 534

Query: 522 RAMFGKLNIF 531
           R++F KLNI 
Sbjct: 535 RSVFDKLNII 544

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/589 (52%), Positives = 390/589 (66%), Gaps = 74/589 (12%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGR-----PHHG 55
           MK+ +  L ++A   VA + ++P   DER +       R   V +HG+ G       H G
Sbjct: 1   MKLEKTSLVSLATISVASSFLIPA--DERML-------RDKLVPQHGKAGADAEHAKHKG 51

Query: 56  PKHEKDEHRPCKHGKEA-------------------------------------HDEEEL 78
            +H   +H   KH K++                                     ++   +
Sbjct: 52  GQHSVVKHNSAKHHKQSRKQMRVHKHDDSDSGSDSDSGSDSDGDGDGDGDGDGNYESPAI 111

Query: 79  APLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQ----LLQQVLLET-------SD 127
           APLY+            ++YII FK+ V  E+I  H+Q    L QQ + +        + 
Sbjct: 112 APLYS--QSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169

Query: 128 VSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNN 187
           V    +   ++DSF++  +L GY+   +  V++ +R +P VQ VEQDS V+ NEFDTQN 
Sbjct: 170 VEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229

Query: 188 APWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPD 247
           APWGLARISHR+ L+LGSFNKYL+DD AGEGV +Y+IDTG+NV+H +FEGRA WGKTIP+
Sbjct: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289

Query: 248 NDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHA 307
           ND D DGNGHGTHCAGTIASKHYGVAK ANV+AVKVLRSNGSGSMSDV+ GVE+A   H 
Sbjct: 290 NDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHL 349

Query: 308 SKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAAS 367
           +  K+    FKGSTANMSLGGGKSPSLD  V+AAVK G+HF+VAAGNENQDACNTSPA++
Sbjct: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409

Query: 368 ERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAG 427
           + AITVGASTLSDDRAYFSNWG CVD+FAPGLNILSTY GSDDATATLSGTSMASPHVAG
Sbjct: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469

Query: 428 LLTYFLSLQPEKSSQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGA 485
           LL+YFLSLQPE+ S+F TS +  ITP QLKK+L+ Y TK +L D+PE TPN L++NG G 
Sbjct: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529

Query: 486 DLSDFWGDKGKKSHKP--LFAHE-YDNVWASSDAMFEQVRAMFGKLNIF 531
           DLSDFW        KP  L ++E Y N+    D +++Q   +F K+N+ 
Sbjct: 530 DLSDFWNIS-----KPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/572 (54%), Positives = 388/572 (67%), Gaps = 52/572 (9%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRG--RPHHGPKH 58
           MK    +L   AL+ VA ALV+PE+  E      +HG +   +++H      +P H   H
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNREN-----KHGDKSVAIKDHASSDLDKPQH---H 52

Query: 59  EKDEHRPCKHGKEAHDEE------------ELAPLYTPGXXXXXXXXXXNKYIILFKEGV 106
              + R    G+ A  ++             LAPL T            N+YII+FK+  
Sbjct: 53  ANGKARSKSRGRCADSKKFDKLRPVDDASAILAPLST---VNDIANKIPNRYIIVFKKDA 109

Query: 107 TAEQISAHKQLLQ----QVLLETSD----------------VSAQGIVADVLDSFDLEGV 146
           +A+++  H++L+     + L   +D                V A  +   + DSFD+ G 
Sbjct: 110 SADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGS 169

Query: 147 LSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSF 206
           LSGYV   +  V++ +RRSP V+ VE+DS V +N F+TQN+APWGLARISHR+ L+LGSF
Sbjct: 170 LSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSF 229

Query: 207 NKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIA 266
           NKYLYDD AG+GV +Y++DTG+NV HK+F+GRA WGKTIP +D D DGNGHGTHCAGTI 
Sbjct: 230 NKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIG 289

Query: 267 SKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSL 326
           S HYGVAK A+++AVKVLRSNGSG+MSDV+ GVE+ A+ H    +   K FKGSTANMSL
Sbjct: 290 SVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSL 349

Query: 327 GGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFS 386
           GGGKSP+LD  V+AAVK G+HF+VAAGNENQDACNTSPAA+E AITVGASTLSD+RAYFS
Sbjct: 350 GGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFS 409

Query: 387 NWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQ-FGT 445
           NWG CVDIF PGLNILSTY GSD ATATLSGTSMA+PHV GLLTYFLSLQP+  S+ F  
Sbjct: 410 NWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHA 469

Query: 446 SAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK---GKK-SHKP 501
           +  ITP QLKKKL+D+STK VL DLPEDT N LIYNGGG DL D WG     GK+ S  P
Sbjct: 470 AGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANP 529

Query: 502 LFAHE--YDNVWASSDAMFEQVRAMFGKLNIF 531
            F+ E   +++ + +DA+F+ VR +  + NI 
Sbjct: 530 EFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/469 (59%), Positives = 343/469 (73%), Gaps = 34/469 (7%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET----------------------------SDV 128
           +YI++FK+ ++ E++  HKQ++ +  L++                               
Sbjct: 82  RYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSF 141

Query: 129 SAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNA 188
           SAQ     + DSFD+ G+L+GY+   +  +++ +R +P V  VEQDS V   EF TQN A
Sbjct: 142 SAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGA 201

Query: 189 PWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDN 248
           PWGL+RISHR+ L+LGSFNKYLYDD AG+GV SY+IDTG+NV HK+FEGRA WGKTIP N
Sbjct: 202 PWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTN 261

Query: 249 DFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHAS 308
           D D+DGNGHGTHCAGTIASKHYGVAK ANV+AVKVLRSNGSGSMSDV+ GVEFAAK H  
Sbjct: 262 DLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQD 321

Query: 309 KAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASE 368
             K N K FKGSTANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQDACN+SPA++E
Sbjct: 322 AVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAE 381

Query: 369 RAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGL 428
            A+TVGASTL+DDRAYFSNWG CVDIFAPGLN+LSTY GSD ATATLSGTSMASPHVAGL
Sbjct: 382 NAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGL 441

Query: 429 LTYFLSLQPEKSSQ-FGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADL 487
           LTYFLSLQP+  S+ F  +  ITP QLKKKL+ YSTK VL D+P+DT N LI+NGGG  L
Sbjct: 442 LTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGL 501

Query: 488 SDFWG-----DKGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
            DFWG     D+ + +         D +   +D ++E++R +F  +NI 
Sbjct: 502 DDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/556 (54%), Positives = 374/556 (67%), Gaps = 33/556 (5%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRR---GRPHHGPK 57
           MK  + V+    L  +  AL++PE+    G ++ E    R D   +G          GP 
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELT---GSNEYEKRPERTDDVNNGESVVATSFEKGPS 57

Query: 58  HEKDEHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQL 117
            ++      K  +E  D    APL  P           N+YIILFK+GV  ++I  H++L
Sbjct: 58  KDELAVFASKLTQEVQDR--FAPLVVP---EDTLGVLENRYIILFKKGVNPQEIGFHREL 112

Query: 118 LQQV-LLETSDVSAQ-----GIVAD-VLDS--------FDLEGVLSGYVAELSPMVLELV 162
           ++QV L E S +  +     GI  D V DS        FD+ G+L GY       VL+++
Sbjct: 113 IEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVI 172

Query: 163 RRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSY 222
           R SP +++VEQDS V+T + DT+N APWGLARISHR+ L+LGS+NKYLYD+  G GV SY
Sbjct: 173 RMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSY 232

Query: 223 IIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVK 282
           +IDTG+NV H +F GRA+WGKTIP  D DEDGNGHGTHCAGTI S  YGVAK A+++AVK
Sbjct: 233 VIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVK 292

Query: 283 VLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAV 342
           VLRSNGSGSMSDV+ GVE+AA+ H +  K     FKGSTANMSLGGGKSPSLD+ V+AAV
Sbjct: 293 VLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAV 352

Query: 343 KLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNIL 402
             GL+F+VAAGNE+QDACNTSPA++   ITVGASTLSDDRAYFSN+G CVD+FAPGLNIL
Sbjct: 353 AAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL 412

Query: 403 STYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYS 462
           STY GSD +TATLSGTSMASPHVAGLL YFLSLQP   S+F   + I+P+QLKKKLL +S
Sbjct: 413 STYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFS 472

Query: 463 TKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKP------LFAHEY-DNVWASSD 515
           TK VL D+P  TPN LIYNGGG DLS FWG K             L  H+  D + + +D
Sbjct: 473 TKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELGSKTD 532

Query: 516 AMFEQVRAMFGKLNIF 531
           A+F Q+R +  +L+I 
Sbjct: 533 AVFGQIRGLMDRLDII 548

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 324/416 (77%), Gaps = 14/416 (3%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLETSD--------VSAQGIVAD------VLDSF 141
           N+YI++FK+ +  E++  HK+L+ Q+ LE++          SA  I  +      +L +F
Sbjct: 101 NRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILTTF 160

Query: 142 DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPL 201
           ++  +L+GYV   +  VLEL+R +P V+ VE+DS V   EFD QNNAPWGLARISHR+ L
Sbjct: 161 NISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERL 220

Query: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261
           +LGSFNKYLYDD AG+GV  Y+IDTGIN +H +F  RA WGKTIP ND D DGNGHGTHC
Sbjct: 221 NLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHC 280

Query: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGST 321
           AGTIAS HYGVAK A V+AVKVLRSNGSGSMSDVI GVEFAA+ H   AK   K FKGST
Sbjct: 281 AGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGST 340

Query: 322 ANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDD 381
           ANMSLGGGKSP+LD  V+AAV  G+HF+VAAGNENQDACNTSPA++ERAITVGASTLSDD
Sbjct: 341 ANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDD 400

Query: 382 RAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSS 441
           RAYFSNWG CVDIFAPGLNILSTY G DDATATLSGTSMASPHVAGLLTYFLSLQP   S
Sbjct: 401 RAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDS 460

Query: 442 QFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKK 497
           +F    ++TP Q+KKKL++YS+K VLFDLPE TPN LI+NG G +L D W  K ++
Sbjct: 461 EFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/564 (52%), Positives = 369/564 (65%), Gaps = 56/564 (9%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK 60
           MK+ + V  AVAL      L+LP+  DE  V++               RG+       E 
Sbjct: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAH-------------RGQLVQWMAREN 47

Query: 61  DEHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQLLQQ 120
            E       ++A   E+ +PL+             +KYI++F+EGV+ E+ + H +L++ 
Sbjct: 48  QE-------RKAQGAEQQSPLF---RVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEA 97

Query: 121 VLLET---------------SDVSAQGIVAD-----VLDSFDLEGVLSGYVAELSPMVLE 160
              E+                + +  GI A      +   F L   L GYV   +  ++ 
Sbjct: 98  AHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVG 157

Query: 161 LVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVD 220
           L+R +P V  VE+DS V  ++F TQN APWGLAR+SHR+ L+ GSFNKYLYDD +GEGV 
Sbjct: 158 LLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVT 217

Query: 221 SYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIA 280
           SY+IDTGIN+ H +FE RA WGKTIP+ND D DGNGHGTHCAGTIASK YGVAK+ANV+A
Sbjct: 218 SYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVA 277

Query: 281 VKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDA 340
           VKVLRSNG+GSMSDV+ GVE+A K H   A+  DK FKGSTANMSLGGG+S +LD  VDA
Sbjct: 278 VKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDA 337

Query: 341 AVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLN 400
           AV  G+HF+VAAGNENQDACNTSPAAS++AITVGASTL+DDRAYFSNWG CVD+FAPG+N
Sbjct: 338 AVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMN 397

Query: 401 ILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLD 460
           ILSTY GSD A ATLSGTSMASPHVAGLLTYFLSLQP+  S+F     I+PE LKKK++D
Sbjct: 398 ILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVID 457

Query: 461 YSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYD------------ 508
           + TK  L  LP  T N LIYNGGGADLSDFWG+K KK   P F +  D            
Sbjct: 458 FGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLI 517

Query: 509 -NVWASSDAMFEQVRAMFGKLNIF 531
             + +S+DAMF   R +  ++NI 
Sbjct: 518 HELESSTDAMFSGFRTILDRMNII 541

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/506 (56%), Positives = 363/506 (71%), Gaps = 25/506 (4%)

Query: 50  GRPHHGPKH------EKDE------HRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNK 97
           GR H+ PK       E D+       +  +  +++ ++ + APL++            NK
Sbjct: 176 GRKHNPPKQPVYNIKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNK 235

Query: 98  YIILFKEGVTAEQISAHKQLLQQVLLE---TSDVSAQGIVADVLDSFDLEGVLSGYVAEL 154
           YII+FK+ V+ + +  HK L+ +   +    SD ++  I+  + ++F++  +  GY+   
Sbjct: 236 YIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGYIGHF 295

Query: 155 SPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA 214
           +  +++ +R SP V  VEQDS VH NE DTQNNAPWGLARISHRD L+LGS+NKYLYDD 
Sbjct: 296 NEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDV 355

Query: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAK 274
           AGEGV +Y+IDTGIN+KHKEF GRA WGKTIP+ND D DGNGHGTHCAGTIASK+YGVAK
Sbjct: 356 AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAK 415

Query: 275 RANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSL 334
            A V+AVKVLRS+GSG+MSDV+ GVE+AA  H    +   K FKGSTANMSLGGGKS SL
Sbjct: 416 NAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSL 475

Query: 335 DRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDI 394
           D  VDAAVK G+HF+VAAGNENQDACN+SPAASE AITVGASTLSDDRAYFSNWG CVD+
Sbjct: 476 DLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDV 535

Query: 395 FAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSA--QITPE 452
           FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLL+YFLS+QP+  S+F +S    I+P 
Sbjct: 536 FAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPA 595

Query: 453 QLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKP-LFAHEY---- 507
           QLKKKL+ YSTK +  DLPE TPN L+YN  G ++SDFW  K + S +P   A E+    
Sbjct: 596 QLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELED 654

Query: 508 --DNVWASSDAMFEQVRAMFGKLNIF 531
             D+    +D     ++ +F ++++F
Sbjct: 655 LVDSAQWIADTWLNGIQQVFERMDLF 680

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/458 (60%), Positives = 335/458 (73%), Gaps = 39/458 (8%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQVLLETSDV---------------------SAQGIVA 135
           +YII+FK+GV+ EQI  HK+L+  + L+ S                       S  GIV+
Sbjct: 61  RYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVS 120

Query: 136 DVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARI 195
           D    FD+  +LSGY+A LS  +L  +R +P +  +E D+ VHT +F+TQNNAPWGLARI
Sbjct: 121 D----FDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176

Query: 196 SHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGN 255
           SHR+ L+L +FNKYLYDD AG+ VD+Y+IDTG++V H EF  RA WGKTIP ND D DGN
Sbjct: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236

Query: 256 GHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDK 315
           GHGTH AGTI S+HYGVAK  N+IAVKVLRSNGSGSMSDV+ GVEFA   H  + K N+K
Sbjct: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMK-NEK 295

Query: 316 KFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGA 375
             KGS ANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQ+ACN+SPA++E+A+TVGA
Sbjct: 296 NLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA 355

Query: 376 STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS-DDATATLSGTSMASPHVAGLLTYFLS 434
           ST+SD+RAYFSNWG CVDIFAPGLNILSTY G+ DD TATLSGTSMASPHVAGLL Y+LS
Sbjct: 356 STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLS 415

Query: 435 LQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK 494
           LQPEKSS+F T A I+  QLKKKL++Y+TK VL DLPE TPN LIYNGGG DLSDFW  +
Sbjct: 416 LQPEKSSEFSTRA-ISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQ 474

Query: 495 GKK-SHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
             K        + Y          F +++ +F  LN +
Sbjct: 475 NSKIPGSNYIGYNY----------FSKLKTLFDDLNFY 502

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/491 (58%), Positives = 349/491 (71%), Gaps = 37/491 (7%)

Query: 77  ELAPLYTPGXXXXXXXX-------XXNKYIILFKEGVTAEQISAHKQLLQQV-------- 121
           +LAPL TP                  NKYII+FK+ +  ++IS HK+L+ ++        
Sbjct: 215 KLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRL 274

Query: 122 -----LLETSDVSAQGIVAD--VLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQD 174
                   ++    +    +  ++ SF++  +LSGY    +  V++L+R +P V+ VE+D
Sbjct: 275 PPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERD 334

Query: 175 SEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKE 234
           S V T EF+TQNNAPWGL+RISHR+ L+LGSFNKYLYDD AG+GV  ++IDTGINV H +
Sbjct: 335 SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVD 394

Query: 235 FEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSD 294
           F  RA WGKTIP ND D DGNGHGTHCAGTIAS HYGVAK A V+AVKVLRSNGSGSMSD
Sbjct: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSD 454

Query: 295 VIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGN 354
           VI GVEFAA+ H +  K N K +KGSTANMSLGGGKSP+LD  V+AAV+ G+HFSVAAGN
Sbjct: 455 VIKGVEFAAETHLNNEK-NKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513

Query: 355 ENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS-DDATA 413
           ENQDACN+SPA++E AITVGASTLSDDRAYFSNWG CVD+FAPGLNILSTY G  +D TA
Sbjct: 514 ENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTA 573

Query: 414 TLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTS---AQITPEQLKKKLLDYSTKGVLFDL 470
           TLSGTSMASPHVAGLLTYFLSLQP+  S F  S    +ITPEQLKKKL+ YST  +L+DL
Sbjct: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDL 633

Query: 471 PEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHE----------YDNVWASSDAMFEQ 520
           P+ TPN LIYNG G D+SD W  K ++      AHE           D++   +D  F+Q
Sbjct: 634 PDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQ 693

Query: 521 VRAMFGKLNIF 531
           +R +F K+NI 
Sbjct: 694 IRNVFEKMNII 704

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/465 (60%), Positives = 348/465 (74%), Gaps = 31/465 (6%)

Query: 97  KYIILFKEGVTAEQIS--------AHKQLLQQVLLE---TSDVSAQGIV-ADVLDSFDLE 144
           KYI++ K+GV+ E ++        AH   ++ +  E    + V+A+G+    + D F++ 
Sbjct: 5   KYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPRGGIKDLFNIN 64

Query: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLG 204
            +  G +      V++L+ +S  V+ VE+DS VH + FDTQNNAPWGLARISHRD L+LG
Sbjct: 65  DLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLG 124

Query: 205 SFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGT 264
           +FNKYLYD+A GEGV +Y+IDTGINVKH EF+GRAQWGKTIP ND D DGNGHGTHCAGT
Sbjct: 125 NFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGT 184

Query: 265 IASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANM 324
           IASKHYG+AK+ANV+AVKVL+S+GSG+MSDVI GVE+AA+ H  ++K N+KKFKGSTANM
Sbjct: 185 IASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESK-NNKKFKGSTANM 243

Query: 325 SLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAY 384
           SLGGGKSP+LD  V+AAV  G+HF+VAAGNENQDACNTSPA++E+AITVGASTLSDDRAY
Sbjct: 244 SLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAY 303

Query: 385 FSNWGSCVDIFAPGLNILSTYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQF 443
           FSNWG CVDIFAPGLNILSTY G ++  TA+LSGTSMASPHVAGLLTYFLSLQP+  S+F
Sbjct: 304 FSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEF 363

Query: 444 GTSAQ--ITPEQLKKKLLDYSTKGVLFDLPE-DTPNALIYNGGGADLSDFW----GDKGK 496
             +++  +TP QLKKKL+ YSTK VL DLP+ D+PN LIYNG G DL  FW     D+  
Sbjct: 364 YDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSADEQS 423

Query: 497 KSHKPL----------FAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
             H              A    +  A++D++F QVR +  K+NI 
Sbjct: 424 AEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/578 (50%), Positives = 374/578 (64%), Gaps = 50/578 (8%)

Query: 1   MKITQPVLWAVALNRVAEALVLP----EIRDERGV-SQGEHGG----RRHDVEEHGR-RG 50
           MK+   VL     + +  AL+LP    EIR + G+  +G HG       H + EHGR RG
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 51  RPHHGPKH------EKDEHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKE 104
           + HH          E+D+  P     E    ++   +              ++YI++FK+
Sbjct: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKL-ASLSDNSRAIPHRYIVIFKD 119

Query: 105 GVTAEQISAHKQLLQQVLLET-------------------SDVSAQGIVADVLDSFDLEG 145
           GVT   +  H+ L+    +ET                     +SA+ +   + + F++ G
Sbjct: 120 GVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAG 179

Query: 146 VLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGS 205
            L GY    +  +L+L+R S  V+L+EQDS VH ++F+TQ  APWGLAR+SHR+ L+LGS
Sbjct: 180 SLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGS 239

Query: 206 FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTI 265
           FNKYLYDD AG+GV +Y+IDTGIN+ H EFEGRAQWGKTIP ND D DGNGHGTHCAGTI
Sbjct: 240 FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTI 299

Query: 266 ASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMS 325
           ASK YGVAK A V+AVKVLR+NG+G+MSDV+ GVE+   +H  +  S D  FKGSTANMS
Sbjct: 300 ASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKASGDPNFKGSTANMS 357

Query: 326 LGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYF 385
           LGGGKS +L+  VDAAV  G+HF+VAAGNENQDACNTSPA+S++ ITV ASTLSDDRAYF
Sbjct: 358 LGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYF 417

Query: 386 SNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGT 445
           SNWGSCVDIFAPGLNILSTY GSD A ATLSGTSMASPHVAGLL YFLSLQP+  S++ T
Sbjct: 418 SNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT 477

Query: 446 SAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK--GKKSHKPLF 503
            + I+PE LKKK++ Y +K +L ++P  T N LI+NGGG  L  FW  K  G +  K   
Sbjct: 478 GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSS 537

Query: 504 AHE----------YDNVWASSDAMFEQVRAMFGKLNIF 531
           +H            D + ++S ++F ++R    +L++ 
Sbjct: 538 SHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  521 bits (1341), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 288/562 (51%), Positives = 378/562 (67%), Gaps = 42/562 (7%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQG-EHGGRRHD------VEEHGRRGRPH 53
           MK+   ++ AV    VAEALV+P +   RG     +HG   ++      +          
Sbjct: 35  MKLQNTLVSAVIAASVAEALVIPALDQGRGRGHALDHGPNNNNNVPAFMMRAAAAPASAM 94

Query: 54  HGPKHEKDEHRPC-KHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQIS 112
              K   D+     +H   A    ELA L+  G          ++YII+FK+GV  EQ+ 
Sbjct: 95  EMVKDVTDQILAYYQHASPASRGLELAALHDNGVGTADH----DRYIIVFKKGVFKEQVD 150

Query: 113 AHKQLLQQVLLETSD----VSAQGIVA------DVLDSFDLEGVLSGYVAEL-SPMVLEL 161
            H +++  +    S+     +A G  A       V+D+F++ G  SGY+A + SP +++ 
Sbjct: 151 QHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDF 210

Query: 162 VRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLY-DDAAGEGVD 220
           +R +P V  VE+DS VH+ + +TQNNAPWGLARISHR+ L+LG+FNKYLY  ++AG+GV 
Sbjct: 211 IRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVT 269

Query: 221 SYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIA 280
           +Y++DTGI+V H EF  RA+WGKTIP ND+D DGNGHGTHCAGTI S+HYGVAK AN++A
Sbjct: 270 AYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVA 329

Query: 281 VKVLRSNGSGSMSDVIMGVEFAAKQHAS----KAKSNDKKFKGSTANMSLGGGKSPSLDR 336
           VKVLRS+GSG+MSDV+ GVE+ A +H        K  +  +KG+TANMSLGGGKSP+LD+
Sbjct: 330 VKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQ 389

Query: 337 VVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFA 396
            V+AAVK G+HF+VAAGNENQDACN+SPAA+E AITVGASTLSDDRAYFSN+G CVDIFA
Sbjct: 390 AVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFA 449

Query: 397 PGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGT-SAQITPEQLK 455
           PGLNILSTY G++DATATLSGTSMASPHVAGLLTY LSLQP+K S+F   ++++TP Q+K
Sbjct: 450 PGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMK 509

Query: 456 KKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEY------DN 509
           KK++DY+TK  L DLP DTPN LIYN GG + +DFW          +  + Y      D+
Sbjct: 510 KKIIDYATKNALADLPADTPNKLIYN-GGFNSTDFWASAAAPQSHKVKTNRYSLGSFLDS 568

Query: 510 VWASSDAMFEQVRAMFGKLNIF 531
           +  S++  F      F  +NIF
Sbjct: 569 IQDSNNHWFN-----FDNMNIF 585

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 260/454 (57%), Positives = 315/454 (69%), Gaps = 33/454 (7%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET----------------SDVSAQGIVADVLDS 140
            YI++F EGVT  +IS H + + Q+ L++                SDV++ G++  V D 
Sbjct: 38  NYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDM 97

Query: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200
           F +   L GY    +  V+E +R SP V+ +E+DS VHT E  TQ NAPWGLARISHR  
Sbjct: 98  FKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSR 157

Query: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260
           L+L +FNKYLYDD  G+GV +Y+IDTGIN+ + +F GRA WGKTIP  + + DGNGHGTH
Sbjct: 158 LNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTH 217

Query: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320
            AGTIAS HYGVAK+  V AVKVLRSNG+GSMSDV+ GVE+    H     +    FKGS
Sbjct: 218 VAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDVGT--AGFKGS 275

Query: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380
            ANMSLGGGKS SLD  V+AAV  G+HF+VAAGNENQDACNTSPAA+ERAITVGASTLSD
Sbjct: 276 VANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVGASTLSD 335

Query: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440
            RAYFSNWG CV IFAPGLNILSTY GS DATATLSGTSMASPH+AGL+ YFLSLQP   
Sbjct: 336 SRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVK 395

Query: 441 SQF---GTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKK 497
           SQF   G +  ITP+QLKKK++ + TK  L DLP +TPN + YNG G  L DFW      
Sbjct: 396 SQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN----- 450

Query: 498 SHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531
                 A++Y   +  S  + EQ++ +  K+NIF
Sbjct: 451 ------ANDYVKNY-QSLVITEQLQFILNKMNIF 477

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  457 bits (1177), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 297/414 (71%), Gaps = 24/414 (5%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQV-------------LLETSDVSAQ------GIVADV 137
           +YII+F E +T   I +H Q++Q+               L T   SA       GI  D+
Sbjct: 72  RYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGI--DI 129

Query: 138 LDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISH 197
             SFD+ G+  GY    +  V+E+V + P V+ +E +S V  +    Q +APWGL RISH
Sbjct: 130 --SFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISH 187

Query: 198 RDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGH 257
           R+    G   +YLY+DAAG GV SY++DTGI+ +H++FEGRA+WG  IP+ND   D NGH
Sbjct: 188 RERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGH 247

Query: 258 GTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKF 317
           GTHCAG I S+H+GVAK  N++AVKVLRSNG G++SDVI G+E+ AK H + +K    KF
Sbjct: 248 GTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKF 307

Query: 318 KGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGAST 377
           KGSTAN+SLG  KSP+++  V+AAV  G+HF++AAGNE++DAC +SPA +E++ITVGAST
Sbjct: 308 KGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAST 367

Query: 378 LSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQP 437
            SDDRA+FSNWG+CVD+FAPG+NI+STY GS +AT +LSGTSMA+PHVAG+L+Y LSLQP
Sbjct: 368 FSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQP 427

Query: 438 EKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491
            + S+F     ++P+QLK+K+L +ST+GVL D+ E+TPN L+YNGGG  L +FW
Sbjct: 428 AQDSEFFYDT-VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/413 (53%), Positives = 294/413 (71%), Gaps = 24/413 (5%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET-----------------SDVSAQGIVADVLD 139
           +YII F E  +   I +HK+++Q+V  E+                 SD+   GI     D
Sbjct: 70  RYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGI-----D 124

Query: 140 SF-DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHR 198
           SF D+ G+  GY    +  V++ V + P ++ +EQ+S V       Q  APWGL RISHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 199 DPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHG 258
           +    G   +YLY+DAAG GV SY++DTGI++ H++FEGRA WG  IPDND   D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 259 THCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFK 318
           THCAG I S+H+GV K  N++AVKVLRSNG G++SDVI G+E+  K H   +K    KFK
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 319 GSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTL 378
           GSTAN+SLG  KSP+++  V+AAV+ G+HF++AAGNE++DAC +SPA +E++ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 379 SDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPE 438
           SDDRA+FS+WG+CVD+FAPG+NILSTY GS +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 439 KSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491
             S+F  S  ++P+QLK+K++++ST+GVL D+ EDTPN LIYNGGG  L +FW
Sbjct: 425 SDSEFFDST-VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  451 bits (1160), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/410 (51%), Positives = 297/410 (72%), Gaps = 16/410 (3%)

Query: 97  KYIILFKEGVTAEQISAHKQLLQQ-------------VLLE--TSDVSAQGIVADVLDSF 141
           +YI++F E ++ + I +H++++Q+             V LE  +S ++    +  +  SF
Sbjct: 70  RYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGGIDSSF 129

Query: 142 DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPL 201
           D+ G+  GY    +  +L LV + P ++ +EQ+S V  +    Q +APWGL RISHR+  
Sbjct: 130 DINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRISHREKA 189

Query: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261
             G   +YLY+DAAG GV SY++DTGI+ +H++FEGRA WG  IP ND   D NGHGTHC
Sbjct: 190 KYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNGHGTHC 249

Query: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGST 321
           AG I SKHYGVAK   ++AVKVLRSNG G++SDVI G+E+ A++H   ++   K+FKGST
Sbjct: 250 AGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKEFKGST 309

Query: 322 ANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDD 381
           AN+SLG  KS +++  VDAAV  G+HF++AAGNEN+DAC +SPA ++++ITVGAST SDD
Sbjct: 310 ANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDD 369

Query: 382 RAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSS 441
           RA+FSNWG+CVD+FAPG+NI+STY GS +AT +LSGTSMA+PHVAG+L+YFLSLQP   S
Sbjct: 370 RAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDS 429

Query: 442 QFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFW 491
           ++  +A ++P++LK+K+L +ST GVL D+ ++TPN LIYNGGG  L D W
Sbjct: 430 EYFDNA-LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 226/503 (44%), Positives = 320/503 (63%), Gaps = 49/503 (9%)

Query: 6   PVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEKDEHRP 65
           P+LWA         +++P+        +   G R     E    G   H P +   EH+ 
Sbjct: 8   PILWA----NCCLCMIIPDFDGIVRFIENIDGTRSVRAGE----GLGQHDPGNFHTEHQH 59

Query: 66  CKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQLLQQ----- 120
             H      + E  P                +Y+I+F E ++ +QI +H Q++Q+     
Sbjct: 60  VAH------KTEFLPY---------------RYVIVFNEDISLQQIQSHMQVVQKDHSTS 98

Query: 121 ------------VLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFV 168
                       V+  +    +Q     + + FD+ G+  GY    +  +++++ + P +
Sbjct: 99  VGKLTENDAFWRVISSSVSSKSQ--FGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPII 156

Query: 169 QLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGI 228
           + VEQ++ V  +    Q  APWGL R+SHR+    G   +YLY+DAAG+GV SY++DTGI
Sbjct: 157 KFVEQETTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGI 216

Query: 229 NVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNG 288
           + +H++FEGRA+WG  IP ND   D NGHGTHCAG I SKH+GVAK   ++AVKVLRSNG
Sbjct: 217 DTEHEDFEGRAEWGAVIPANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNG 276

Query: 289 SGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHF 348
            G++SDVI G+E+  K+H   +K  +K+FKGSTAN+SLG  KS +++  V+AAV  G+HF
Sbjct: 277 EGTVSDVIKGIEYVTKEHIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHF 336

Query: 349 SVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS 408
           ++AAGNE++DAC +SPA +E++ITVGAST SDDRA+FSNWG+CVD+FAPG+NI+STY GS
Sbjct: 337 AIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGS 396

Query: 409 DDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLF 468
            +AT +LSGTSMASPHVAG+L+YFLSLQP   S+F   A  +P++LK+K+L +ST+GVL 
Sbjct: 397 RNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLG 455

Query: 469 DLPEDTPNALIYNGGGADLSDFW 491
           D+ +DTPN LIYNGGG  L  FW
Sbjct: 456 DIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  420 bits (1079), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/414 (52%), Positives = 287/414 (69%), Gaps = 22/414 (5%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQV-----LLETSD---------VSAQGIVADVLDSF 141
           N+YI+LFK+ VT ++I +H   ++++      L+ SD         +S +GI   +   F
Sbjct: 76  NRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGI--GLQHEF 133

Query: 142 DLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPL 201
            +   ++GY+   +    + +  SP V+LVE DS V  N +  Q + PWGL RIS R+ L
Sbjct: 134 SIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREKL 193

Query: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261
            +     Y YDD  G+   +++IDTGI V H++FEGRA WGKTI +ND D D NGHGTHC
Sbjct: 194 PILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGHGTHC 253

Query: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQH--ASKAKSNDKKFKG 319
           AGTIASKHYG+AK+A VIAVKVLRS+GSGSMSDVI GVE+  + +    K KSN    KG
Sbjct: 254 AGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTKSN---LKG 310

Query: 320 STANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLS 379
           +  NMSLG  KS +L+R +DAA   G+ F+VAAGNE+ DACN+SPA++   ITVG STLS
Sbjct: 311 AAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTLS 370

Query: 380 DDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEK 439
           DD A+FSN+G CVDIFAPG+NI+STY GS +AT +LSGTSM+SPHVAG+L Y+LSLQP+ 
Sbjct: 371 DDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQPDH 430

Query: 440 SSQF-GTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWG 492
            SQF    + I+P+ LKKK+L+Y+T G L  LP +T N L+YNGGG +LS FWG
Sbjct: 431 KSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/476 (45%), Positives = 292/476 (61%), Gaps = 40/476 (8%)

Query: 19  ALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEKDEHRPCKHGKEAHDEEEL 78
           +L+LPEI   RG+            E   ++ R     + E  EH   K      D+   
Sbjct: 19  SLLLPEIFQCRGI------------ETISQKDRDSTFSRTEVLEHLSAKQNDIIKDQ--- 63

Query: 79  APLYTPGXXXXXXXXXXNKYIILFKE-GVTAEQISAHKQLLQQVLLETSDVSAQGIVADV 137
                              YI++FK   + AE+    KQL   +   + +   +      
Sbjct: 64  -------------------YIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSN 104

Query: 138 LDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISH 197
           L+ F +   LSGY+       L+L+R+ P VQL+E DS+VH  +   Q + PWGL+RIS 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 198 RDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGH 257
           R  + +G    Y YDDA    V +Y++DTGI + H++F GRA+WGKTI  ND DED +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 258 GTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKF 317
           GTH AG IAS  +GVAK   V+AVKVLRSNG G MSDV+ G+EF    H+     N    
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHS----KNKNYS 280

Query: 318 KGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGAST 377
           KGS  N+SLG  KSP+L   +DAA+   +HF+VAAGNEN DAC TSPA + RAITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 378 LSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQP 437
            SD+RA+FSNWG CVD+FAPG+N++STY GSD+AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 438 EKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD 493
           +K S + T  ++TP +LK+K++ + +K VL++LPE+TPN +IYNG G +LS FW D
Sbjct: 401 DKDSGYFT-GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  401 bits (1031), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 262/403 (65%), Gaps = 11/403 (2%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELS 155
           N+YI+LFK   T  Q   H   L   LL T           +L SF L   L GY + L 
Sbjct: 55  NQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT------ILHSFQLAHDLQGYTSRLP 108

Query: 156 PMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA- 214
             ++  +   P +Q +EQDS VH      Q ++PWGLARIS R+ L L     Y YDD+ 
Sbjct: 109 EQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSG 168

Query: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTI-PDNDFDEDGNGHGTHCAGTIASKHYGVA 273
           A      YI+DTGIN  H EF+GRA+WG    P     ED NGHGTHCAG I S  YGVA
Sbjct: 169 ASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVA 228

Query: 274 KRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK-FKGSTANMSLGGGKSP 332
           K   +IAVKVL + G G MS VI G+E+  +QH    K  D+  FKGS  N+SLG GKSP
Sbjct: 229 KNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSP 288

Query: 333 SLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCV 392
           +L RV++AAVKLG+HF+VAAGNE+ DAC+TSPA S  A+TVGAS+ SDDR +FSNWG CV
Sbjct: 289 ALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCV 348

Query: 393 DIFAPGLNILSTYTGS-DDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTS-AQIT 450
           D+FAPG+NI+STY G  ++ T +LSGTSM++P V GL+ YFLSLQP+  SQF T     T
Sbjct: 349 DVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPT 408

Query: 451 PEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD 493
           P QLK K++ +ST+GVL ++PE TPN ++YNGGG  L DFW +
Sbjct: 409 PYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  385 bits (989), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/420 (50%), Positives = 285/420 (67%), Gaps = 19/420 (4%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLETSD-VSAQGIVADVLDSFDLEGVLSGYVAEL 154
           ++YI+LF+   T  QIS  +Q L  ++ E +   +     + VL  F +     G +   
Sbjct: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIR- 123

Query: 155 SPM--VLELVRRSPF-----VQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFN 207
           +P+   LE V+ + F     ++++E+DS VH N+F TQ ++ WGL+RIS R+ L L    
Sbjct: 124 APIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQ 183

Query: 208 KYLYDD-AAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFD-EDGNGHGTHCAGTI 265
            Y YDD  +G+GVD YI+DTGIN  H EFEGRA WG ++P  +   ED NGHGTHCAG I
Sbjct: 184 FYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGII 243

Query: 266 ASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSND------KKFKG 319
            SK YGVAK  N+IAVKVL   G GSMSDVI+G+EF A  H +K  +         +FKG
Sbjct: 244 GSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKG 303

Query: 320 STANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLS 379
           S  N+SLG  KSPSLD  +++A K+G+H +VAAGNE++DAC TSPA S   ITVGAS+ S
Sbjct: 304 SVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFS 363

Query: 380 DDRAYFSNWGSCVDIFAPGLNILSTYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPE 438
           DDRA+FSNWG CVD+FAPG+NI STY G +++ T +LSG+SM+SP V+GL  Y+LSLQP+
Sbjct: 364 DDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPD 423

Query: 439 KSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498
            SSQF  S  +TP+QLK+K++D+ST G+L +LP DT N L+YNGGG DLS FW    K++
Sbjct: 424 VSSQFHDSL-MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKEN 482

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  357 bits (917), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 183/390 (46%), Positives = 256/390 (65%), Gaps = 18/390 (4%)

Query: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELS 155
           N+++++FK  V  E++     +L           A        + F +   L G+  +  
Sbjct: 43  NEFLVMFKPMVDREEVEVGLSVL-----------AGRFPLAQFEQFHIADELIGFTVKNF 91

Query: 156 PM-VLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDD- 213
           P   +  + + PFV++VE +S+V+      Q + PWGL R+S RD + +G    Y YD  
Sbjct: 92  PFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTR 151

Query: 214 AAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVA 273
            + + V+ YI+DTGI V H+EFEGRA+WGKTI  ND D D NGHGTHCAG +    YGVA
Sbjct: 152 GSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVA 211

Query: 274 KRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPS 333
           K AN+IAVKVL + G G MSDVI G+EFA  +H ++   N  + +GS  N+SLG G+SP+
Sbjct: 212 KEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTR---NQDEVRGSIINLSLGAGESPA 268

Query: 334 LDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVD 393
           L RVV AA+  G+HF+VAAGNE+ +AC +SPA  +  +TVG ST SDDRA+FSNWG C+D
Sbjct: 269 LQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCID 328

Query: 394 IFAPGLNILSTYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPE 452
           +FAPG+N+ S+Y G + + T +LSGTS ++PHVAGL+ Y LSL+P+  SQF T A   P 
Sbjct: 329 VFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHT-AWSNPA 387

Query: 453 QLKKKLLDYSTKGVLFDLPEDTPNALIYNG 482
           QLK+KL+  +T+G LF++P+DT N +I+NG
Sbjct: 388 QLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  268 bits (686), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/516 (32%), Positives = 261/516 (50%), Gaps = 56/516 (10%)

Query: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQG-EHGGRRHDVEEHGRRGRPHHGPKHE 59
           M+++  +   + +  ++ A+VLP+I      S+  E+       +  G    P   P  E
Sbjct: 1   MRLSNIITLVIGIISLSNAIVLPDINTLEQTSESQEYDNFFKQSKRPGNVKAPLVAPLGE 60

Query: 60  KDEHRPCKHGKEAHDEEELAPLYTPGXXXXXXXXXXNKYIILFKEGVTAEQISAHKQLLQ 119
            DE            +  + P                +YI++FK      +I  H Q + 
Sbjct: 61  NDEI-----------QNNIVPY---------------RYIVMFKNFAYTNEIKLHIQTVA 94

Query: 120 QVLLETS----------------DVSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVR 163
           ++ L  S                + S + +   VL +FD+    +GYV   +  V+E +R
Sbjct: 95  KLQLRGSISLAPNDPFFHHTRDKEFSTEEL-GGVLYTFDIGSGFNGYVGYFTDEVVEFIR 153

Query: 164 RSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYI 223
           +   V  VE DS +  ++ +T +N+ W LARISHR  L L +FN+Y +D   G+ +D+YI
Sbjct: 154 KQSIVDYVEMDSILTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYI 213

Query: 224 IDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKV 283
           +DTG+   H  +  R   G  I  N+ + D NGHGT  AG +  +  GVA++A +I VKV
Sbjct: 214 LDTGVYQTHAYYIERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKV 273

Query: 284 LRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVK 343
           L   G G++S++I G+ F    H  + + N     G+    S+ G KS SL+   D  V 
Sbjct: 274 LNWQGRGTVSNIIKGLSFVNHHHPQRIEKNG--VLGAVVLFSISGAKSRSLNTAFDKMVS 331

Query: 344 LGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILS 403
            G+H  V AG +  +ACN+SPA+S + ITV   +++D+     NWGSCVDI+ PG  + +
Sbjct: 332 SGIHVVVGAGTKGINACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRT 391

Query: 404 TYTGSDDATAT----LSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQI--TPEQLKKK 457
           TY   +    T    ++G+S A+  VAGLL YF SLQP      GT   I  TPE+LK++
Sbjct: 392 TYPNLERNQFTNEISVTGSSAAAAQVAGLLAYFASLQP----GLGTPDVIPLTPEELKER 447

Query: 458 LLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD 493
           L+D+ TKG L +L   +PN + +NG G +L  F+ D
Sbjct: 448 LIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSFFND 483

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  205 bits (521), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 211/411 (51%), Gaps = 48/411 (11%)

Query: 100 ILFKEGVTAEQ----ISAHKQLLQQVLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELS 155
           +L  E + AE+    + + K L + +  +  D+S +  V+  +      G   G+ A+  
Sbjct: 10  LLLVEIINAEEYLVRLKSPKSLTKFMESKIGDMSLKSFVSTRISKTFSFGKFEGFTADFP 69

Query: 156 PMVLELVRRSPFVQLV------------EQDSEVHTNEFDTQNNAPWGLARISHRDPLSL 203
              +E ++++P V  V            EQ +E ++  +  Q +AP  LAR+S R PL  
Sbjct: 70  KDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPY 129

Query: 204 GS-------FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNG 256
                    FN Y      G+ V++YIIDTGI  +HK+  GRA +G  +   +   D NG
Sbjct: 130 SEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMV-GEGPGDYNG 188

Query: 257 HGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK 316
           HGTH AG + S+ +GVAK+ N++ VK L + G G+++ VI  +EF+   H  K+      
Sbjct: 189 HGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV-NHCKKSG----- 242

Query: 317 FKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGA- 375
                AN+SLG  ++  L++ V+AAV+ GL   VAAGN N +AC  SPA++  AITVGA 
Sbjct: 243 -MLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAITVGAF 301

Query: 376 STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSL 435
              +D  A FSNWG CVD+FA G+ ++S            SGTSMASP VAGL    L  
Sbjct: 302 DDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVAGLAAVLL-- 359

Query: 436 QPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL----FDLPEDTPNALIYNG 482
                      + I P  +K+K++D +T+ V           TPN + +NG
Sbjct: 360 ----------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  203 bits (517), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 192/384 (50%), Gaps = 70/384 (18%)

Query: 145 GVLSGYVAELSPMVLELVRRSPFV------------------QLVEQ-------DSEVHT 179
           G   G   ++S  V+E +R +P V                  Q ++Q       D E   
Sbjct: 59  GSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGF 118

Query: 180 NEFDT--QNNAPWGLARISHRDPLSLG---------SFNKYLYDDAAGEGVDSYIIDTGI 228
           N F    Q  AP  LAR+S R PL            SFN Y Y    G  +++YIIDTGI
Sbjct: 119 NPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGI 178

Query: 229 NVKHKEFEGRAQWGKTIPDNDFDEDG----NGHGTHCAGTIASKHYGVAKRANVIAVKVL 284
             +HK+F GRA +G+     DF  +G    NGHGTH AG + S ++GVAK+ N+I VK L
Sbjct: 179 YKEHKDFCGRAIFGR-----DFTGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKAL 233

Query: 285 RSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKL 344
            + G G+++ VI  VEFA     S  K      KG  AN+SLG  ++  +++ + AA + 
Sbjct: 234 NNRGQGNLTTVISAVEFAVNHCKSSGK------KGCVANLSLGAVRNSVINQAIKAAHEA 287

Query: 345 GLHFSVAAGNENQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILS 403
           GL   VAAGN N +AC  SPA++  AITVGA    +D  A FSNWG CVDIFA G+ + S
Sbjct: 288 GLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKS 347

Query: 404 TYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYST 463
                       SGTSMASP V GL+   L               + PE +K KL++ +T
Sbjct: 348 LSAFPPHKPIAFSGTSMASPSVTGLVAILL------------DKGVEPENIKAKLVELAT 395

Query: 464 -----KGVLFDLPEDTPNALIYNG 482
                +  LF  P  TPN + +NG
Sbjct: 396 HDLLQRRTLFFKP-GTPNRIAFNG 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  203 bits (516), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 150/385 (38%), Positives = 195/385 (50%), Gaps = 74/385 (19%)

Query: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNE-------------FD-------- 183
           G   G+  +L+  +LE ++++P V  V  +  VH  E             FD        
Sbjct: 65  GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 184 ---TQNNAPWGLARISHRDPLS---------LGSFNKYLYDD-AAGEGVDSYIIDTGINV 230
               Q  AP  LAR+S R  L          L S  KY YD  + G  V++YIID+GI +
Sbjct: 125 SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYL 183

Query: 231 KHKEFEGRAQWGKTIPDNDFDEDG----NGHGTHCAGTIASKHYGVAKRANVIAVKVLRS 286
           +H+EF GRA     IP  D   +G    NGHGTH AG + SK YGVAK+  +I +KVL  
Sbjct: 184 EHEEFNGRA-----IPGIDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNR 238

Query: 287 NGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKG-STANMSLGGGKSPSLDRVVDAAVKLG 345
            G GS++ V+ G+EFA K     +K      KG   AN+SLG  ++  L++ + AA+  G
Sbjct: 239 LGQGSLAMVLGGIEFAVKHCQETSK------KGRCVANLSLGSMRTAILNKAIKAAIDAG 292

Query: 346 LHFSVAAGNENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNI 401
           L   VAAGN N +AC  SPA++  AITVGA    DDR    A FSNWG C+DIFAPG+ I
Sbjct: 293 LVVVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVI 349

Query: 402 LSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDY 461
            S     D    T SGTSMASP VAGL    L          G SA    E++K  +L+ 
Sbjct: 350 KSLSIFKDKEDVTYSGTSMASPTVAGLAALTLDQ--------GVSA----EEVKDYILEM 397

Query: 462 STKGVL----FDLPEDTPNALIYNG 482
            T  V           TPN + +NG
Sbjct: 398 GTDNVFHRRSLLFKPGTPNKICFNG 422

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  201 bits (512), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 198/365 (54%), Gaps = 41/365 (11%)

Query: 133 IVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGL 192
           ++AD++ +F  E   +   AELS M       +   +   QD +   N    Q +AP  L
Sbjct: 118 LIADIVPNFKFEAFDTD--AELSYMF------NTTAKYAYQDIDEAQN-VTYQPDAPRHL 168

Query: 193 ARIS--HRDPLSLGS-------FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGK 243
           ARIS  H+ P  L         FN Y  D+  G+GV++YI+DTGI+ +H EFE R   G 
Sbjct: 169 ARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGV 228

Query: 244 TIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAA 303
            +    F  D NGHGTH AG + S+ +G AK+ +++ VKVL  +GSG  S+V+ G+EF  
Sbjct: 229 DLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNVLSGLEFIV 287

Query: 304 KQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTS 363
           +     ++   KK     AN+SLG  +SP ++  V+ A++ G+ F  AAGN N DA   S
Sbjct: 288 EHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWAS 344

Query: 364 PAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMAS 422
           PA++E  ITVGA     D  A FSNWG CV+IFAPG+ I S    +D+ +  LSGTSM++
Sbjct: 345 PASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDNESLVLSGTSMST 404

Query: 423 PHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGV-----LFDLPEDTPNA 477
           P V G+    L            S  I PE + +++   ST+ V     LF  P  TPN 
Sbjct: 405 PIVTGVAAVLL------------SKGIEPELIAQEIEYLSTRNVFHRRTLFFKPS-TPNQ 451

Query: 478 LIYNG 482
           ++YNG
Sbjct: 452 ILYNG 456

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  198 bits (503), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 171/313 (54%), Gaps = 32/313 (10%)

Query: 185 QNNAPWGLARISHRDPLSL---------GSFNKYLYDDAAGEGVDSYIIDTGINVKHKEF 235
           Q++AP  LARIS    L             FN Y  DD  G+ V++YI+DTGI   H EF
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 236 EGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDV 295
           E R   G  +    F  D NGHGTH AG + SK YG AK+ N++ VKVL  +GSG  S+V
Sbjct: 185 EDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 243

Query: 296 IMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNE 355
           + G+EF  +     ++   KK     AN+SLG  +SP ++  V+ A++ G+ F  AAGN 
Sbjct: 244 LSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 356 NQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATAT 414
           N DA   SPA++E  ITVGA     D  A FSNWG CV+IFAPG+ I S    + + T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV 360

Query: 415 LSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGV-----LFD 469
           LSGTSM++P V G+    L            S  I PE + ++L   ST+ V     LF 
Sbjct: 361 LSGTSMSTPIVTGVAAVLL------------SKGIEPEMIAQELEYLSTRNVFHRRTLFF 408

Query: 470 LPEDTPNALIYNG 482
            P  TPN ++YNG
Sbjct: 409 KPS-TPNQILYNG 420

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  198 bits (503), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 173/313 (55%), Gaps = 32/313 (10%)

Query: 185 QNNAPWGLARIS--HRDPLSLGS-------FNKYLYDDAAGEGVDSYIIDTGINVKHKEF 235
           Q +AP  LARIS  ++ P  +G        FN Y   D  G+ V++YI+DTGI   H EF
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 236 EGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDV 295
           E R   G  +    F  D NGHGTH AG + SK YG AKR N++ VKVL  +GSG  S+V
Sbjct: 185 EDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNV 243

Query: 296 IMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNE 355
           + G+EF  +     ++   KK     AN+SLG  +SP ++  V+ A++ G+ F  AAGN 
Sbjct: 244 LSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 356 NQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATAT 414
           N DA   SPA++E  ITVGA     D  A FSNWG CV+IFAPG+ I S    + + T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLI 360

Query: 415 LSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGV-----LFD 469
           LSGTSM++P V G+    L            S  I PE + +++   ST+ V     LF 
Sbjct: 361 LSGTSMSTPIVTGVAAILL------------SKGIEPEMIAQEIEYLSTRNVFHRRTLFF 408

Query: 470 LPEDTPNALIYNG 482
            P  TPN ++YNG
Sbjct: 409 KP-STPNQILYNG 420

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  194 bits (493), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 180/346 (52%), Gaps = 37/346 (10%)

Query: 155 SPMVLELVRRSPFVQLVEQDSE---VHTNEFDTQNNAPWGLARISHRDPLSL-------- 203
           SP+V E+V    FV   E D E    ++     Q  AP  L+R+S R  L          
Sbjct: 81  SPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDN 140

Query: 204 --GSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHC 261
             GSFN Y  +   G+G+++YIIDTGI  +H EF GRA +G+ +   +   DGNGHGTH 
Sbjct: 141 YEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLT-GEGPGDGNGHGTHV 199

Query: 262 AGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGST 321
           AG + S  YGVAK   ++ VK L + G G+++ VI  +EFA   H   ++      KG  
Sbjct: 200 AGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHCRSSEG-----KGCV 253

Query: 322 ANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGA-STLSD 380
            N+SLG  ++  +++ V AA + G+   VAAGN N +AC  SPA++  AITVGA    +D
Sbjct: 254 INLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAFDDRTD 313

Query: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440
             A FSNWGSCVDIFAPG+ + S  +         SGTSMASP + GL    L       
Sbjct: 314 SIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL------- 366

Query: 441 SQFGTSAQITPEQLKKKLLDYSTKGVL----FDLPEDTPNALIYNG 482
                   +  +++K  +L  +T  V           TPN + +NG
Sbjct: 367 -----DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNG 407

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  194 bits (493), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 196/375 (52%), Gaps = 65/375 (17%)

Query: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEV--------------HTNEFDTQNNAPW 190
           G     V +L   ++E ++++P +  +  + +V              ++++   Q  AP 
Sbjct: 61  GAFRALVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPR 120

Query: 191 GLARISHRD--PLSLGSFNKY-----LYDDAA--GEGVDSYIIDTGINVKHKEFEGRAQW 241
            L+R+S R   P  + + ++Y      Y DA   G  V++YIIDTGI  +H EFEGR ++
Sbjct: 121 HLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKF 180

Query: 242 GKTIPDNDFDEDG----NGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIM 297
                  D  ++G    NGHGTH AG + SK +GVAK+ N+I VK L   G G +S ++ 
Sbjct: 181 AI-----DLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILK 235

Query: 298 GVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ 357
            +EF  +      +S DKK     AN+S G  ++  +D  +  A   G+   VAAGN N 
Sbjct: 236 ALEFTIRHC---KESVDKK---CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNI 289

Query: 358 DACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYTGSDDA 411
           DAC  SPA+S+  ITVGA    DDR    A FSNWGSCVD+FAPG+ +  LS   GSD  
Sbjct: 290 DACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD-- 344

Query: 412 TATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL---- 467
              LSGTSMASP V+G+    L               + P+ +K K+++ STK +     
Sbjct: 345 VLLLSGTSMASPSVSGIAAILL------------DKGLNPKFVKSKIIESSTKNIFHQGT 392

Query: 468 FDLPEDTPNALIYNG 482
             +  +TPN +++NG
Sbjct: 393 IMIKPNTPNLIVFNG 407

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  193 bits (491), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 137/367 (37%), Positives = 183/367 (49%), Gaps = 51/367 (13%)

Query: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDT------------QNNAPWGL 192
           G L G    LS  VL+ ++R PFV+ V  +  V   E D             Q  AP  L
Sbjct: 59  GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHL 118

Query: 193 ARISHRDPLSLGSFNKYLYDD---------AAGEGVDSYIIDTGINVKHKEFEGRAQWGK 243
           ARIS R  L     NK  Y D         A G    +YI+DTG+   HKEFE R ++G 
Sbjct: 119 ARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFG- 177

Query: 244 TIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAA 303
           T    + + D NGHGTH AG + SK +GVAK   ++ VK L + G+G++  ++  +EFA 
Sbjct: 178 TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAV 237

Query: 304 KQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTS 363
           +       S          NMSLG  KS  L++ ++   K G+   VAAGN N +AC TS
Sbjct: 238 QDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTS 291

Query: 364 PAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTS 419
           P+++  AITVGA    DDR    A FSNWG CVDIFAPG+N+ S       +    SGTS
Sbjct: 292 PSSATGAITVGAF---DDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTS 348

Query: 420 MASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL----FDLPEDTP 475
           MASP V G++   L               + PE ++  L + +T GV           TP
Sbjct: 349 MASPIVCGMVALLL------------DDGVPPEDIRDYLQELATDGVFKKRTLVFKPGTP 396

Query: 476 NALIYNG 482
           N+++YNG
Sbjct: 397 NSVLYNG 403

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  192 bits (487), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 176/315 (55%), Gaps = 40/315 (12%)

Query: 185 QNNAPWGLARISHR-----DPLSLG----SFNKYLYDDAAGEGVDSYIIDTGINVKHKEF 235
           Q  AP  LARIS R     DP ++     +F+ Y  D+ +G  V++Y+IDTGI  +H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 236 EGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDV 295
           EGRA++G  +   +   D NGHGTH AG I S+ +GVAK  ++I VK L + G G+++ V
Sbjct: 195 EGRAKFGADLV-GEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 296 IMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNE 355
           I  +EF    H  K++      +G  AN+SLG  ++  L++ V+AA++ G+   VAAGN 
Sbjct: 254 ISAIEFTV-NHCRKSR------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 356 NQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYTGSDDA 411
           N +AC +SPA+S  AITVGA    DDR    A FSNWG+CVDIFAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 412 TATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL---- 467
               SGTSMASP V+G++   L             + I P  +K +L+D +T  V     
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL------------DSGIHPFDIKTELIDLATDSVFHKRT 411

Query: 468 FDLPEDTPNALIYNG 482
                 TPN + + G
Sbjct: 412 LLFKPGTPNRVAFTG 426

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  191 bits (485), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 175/342 (51%), Gaps = 50/342 (14%)

Query: 184 TQNNAPWGLARISHR--------DPLSLGS-FNKYLYDDAAGEGVDSYIIDTGINVKHKE 234
           TQ+ AP  LAR+S R        DP    S FN Y Y    G  V++Y++D+G+ + H +
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 235 FEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSD 294
           FEGRA +G     +    D NGHGTH AG I SK YGV+K+ N+I VKVL S GSG++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 295 VIMGVEFAAKQH------------------ASKAKSNDKKFKGSTANMSLGGGKSPSLDR 336
           V+ G+EF +                     +  +  +D + K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 337 VVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCV 392
            ++  +K G+   VAAGN N +AC TSPA+    ITVGA    DDR    A FSNWG+CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 393 DIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPE 452
           DIFAPG+ + S            +GTSMA+P V GL+   L             + I P 
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL------------DSGIKPT 443

Query: 453 QLKKKLLDYSTKGVL----FDLPEDTPNALIYNGGGADLSDF 490
           Q+KK+L + +T  +           TPN + +NG   D  D+
Sbjct: 444 QIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  192 bits (488), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 170/312 (54%), Gaps = 35/312 (11%)

Query: 185 QNNAPWGLARISHRDPLSLGS-------FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEG 237
           Q+ AP  LAR   R  L   +       FN Y   +  GE V+ YI+D+GI+  H EFEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 238 RAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIM 297
           RA +G     N+   D NGHGTH AG + SK YG AK+A +  VKV+  +G GS S++I 
Sbjct: 330 RAVFGIDTT-NEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 298 GVEFAAKQHASKAKSNDKKFKGSTANMSLGG---GKSPSLDRVVDAAVKLGLHFSVAAGN 354
           GVEFA K      K          ANMSLGG   G S +LD  V+AA++ GL F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 355 ENQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATA 413
             + AC  SPA  + AITVGA    SD  A FSN+G CVDIFAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 414 TLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFD---L 470
            L+GTSM++P  AG++   L               +  E +K++L+D STKGV      +
Sbjct: 501 VLNGTSMSAPITAGVVAVLL------------DQGVKHEDVKERLIDLSTKGVFHRRRLV 548

Query: 471 PEDTPNALIYNG 482
              TP+  ++NG
Sbjct: 549 SSRTPDRTLFNG 560

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  190 bits (482), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 134/328 (40%), Positives = 171/328 (52%), Gaps = 42/328 (12%)

Query: 183 DTQNNAPWGLARISHRDPL--------SLGSFNKYLYDDA-AGEGVDSYIIDTGINVKHK 233
           + Q  AP  L RIS R  L            F  Y Y+D   G  + +YI+DTGI  +H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 234 EFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMS 293
           +FE R   G  +   +   D NGHGTH AG + SK +GVAK   ++ VKVL   GSG+++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 294 DVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAG 353
            V+ G++FA        ++  K+     ANMSLG  ++  ++  +  A K GL   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQGKQ---CVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 354 NENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYTG 407
           N N  AC TSPA+++ AITVGA    DDR    AYFSNWG+CVDIFAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 408 SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL 467
           S     T SGTSMASP VAGL    L               + P  +K KLL  STK V 
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL------------DKGVEPFDVKDKLLHLSTKDVF 432

Query: 468 FDLP----EDTPNALIYNGGGADLSDFW 491
             L       TPN + YNG    + DF+
Sbjct: 433 NKLTLFFKYGTPNKIAYNG----IEDFF 456

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  193 bits (491), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 167/298 (56%), Gaps = 32/298 (10%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLG-------SFNKYLYDDAAGEGVDSYIIDTGINVKHK 233
           ++  Q +AP  LAR   R  L          +FN Y  ++  GEGV+ Y++D+GI   H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 234 EFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMS 293
           EF+GRA +G      +   D NGHGTH AG + S+ +G+AK+AN+  +KV+  +G GS S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 294 DVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGG---GKSPSLDRVVDAAVKLGLHFSV 350
           ++I GVEFA K H  ++       K   ANMSLGG   G S +LD  V+AA++ GL F V
Sbjct: 543 NIIAGVEFAVK-HCQQSG------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVV 594

Query: 351 AAGNENQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSD 409
           AAGN  + AC  SPA  + AITVGA    SD  A FSN+G CVDIFAPG+ + S      
Sbjct: 595 AAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPS 654

Query: 410 DATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL 467
           +    L+GTSM++P  AG++   L               I P ++K  LL  STKG+ 
Sbjct: 655 NTMRVLNGTSMSAPITAGVVAVLL------------DQGIEPHEVKDHLLSISTKGLF 700

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  189 bits (481), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 169/313 (53%), Gaps = 32/313 (10%)

Query: 185 QNNAPWGLARISHRDPLSL---------GSFNKYLYDDAAGEGVDSYIIDTGINVKHKEF 235
           Q++AP  LARIS    L             FN Y  DD  G+ V++YI+DTGI   H EF
Sbjct: 174 QSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEF 233

Query: 236 EGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDV 295
           E R   G  +    F  D NGHGTH AG + SK YG AK+ N++ VKVL  +GSG  S+V
Sbjct: 234 EDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 292

Query: 296 IMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNE 355
           + G+EF  +     ++   KK     AN+SLG  +SP ++  V+ A++ G+ F  AAGN 
Sbjct: 293 LSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 349

Query: 356 NQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATAT 414
           N DA   SPA++E  ITVGA     D  A FSNWG CV+IFAPG+ I S    + + T  
Sbjct: 350 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTLI 409

Query: 415 LSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGV-----LFD 469
           LSGTSM++P V G+    L            S  I P  + +++   ST+ V     LF 
Sbjct: 410 LSGTSMSTPIVTGVAAVLL------------SKGIEPALIAQEIEYLSTRNVFHRRTLFF 457

Query: 470 LPEDTPNALIYNG 482
            P  T N ++YNG
Sbjct: 458 KPS-TANQILYNG 469

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  185 bits (470), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 144/390 (36%), Positives = 190/390 (48%), Gaps = 67/390 (17%)

Query: 145 GVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFD--------------------- 183
           G   G    L+  V+  ++ +P V  V  + ++H  ++D                     
Sbjct: 63  GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKN 122

Query: 184 -----TQNNAPWGLARISHRDPLSLGSFNKYLYDDA---------AGEGVDSYIIDTGIN 229
                 QN AP  LAR+S R PL     +K  Y+D+          G  V++YIID+GI+
Sbjct: 123 SYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGID 182

Query: 230 VKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGS 289
           +  +EFEGRA  G  +   +   D NGHGTH AG + SK YGVAK   ++ VK L   GS
Sbjct: 183 INQEEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGS 241

Query: 290 GSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFS 349
           GS+  VI  +EF    H  K+KS     K   AN+SLG    P L+  + A V  G+   
Sbjct: 242 GSLITVISALEFVV-NHCGKSKS-----KKCVANLSLGAFMMPLLNEAIKATVDSGVVVV 295

Query: 350 VAAGNENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILSTY 405
           VAAGN N DAC  SPA+ + AITVGA    DDR    A FSNWGSCVDIFAPG+ I S  
Sbjct: 296 VAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLS 352

Query: 406 TGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYST-- 463
              +  +   SGTSMASP VAG+++  L    E             E ++  L + +T  
Sbjct: 353 IKDNQKSVEFSGTSMASPQVAGIVSILLDQGVEN------------EDIRDYLFELATDD 400

Query: 464 ---KGVLFDLPEDTPNALIYNGGGADLSDF 490
              K  L   P  TPN + +NG      DF
Sbjct: 401 VFQKRTLLFKPR-TPNRITFNGISKKDEDF 429

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  187 bits (476), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 167/319 (52%), Gaps = 38/319 (11%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLGSFN--------KYLYDDA-AGEGVDSYIIDTGINVK 231
           +F  Q  AP  LARIS RD L     N         Y YDD   GEGV +Y+IDTGI  +
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 232 HKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGS 291
           HK+FE R ++G  +   +   D NGHGTH AG I SK YGV K+  +I VK +   GS  
Sbjct: 343 HKDFEDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQ 401

Query: 292 MSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVA 351
           +S +I  +E+      S+    DKK      NMSLG      ++  V++A+  G+ F VA
Sbjct: 402 LSHIIEAIEYTVNDCNSRV---DKK--ACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 352 AGNENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYTG 407
           AGN N DAC +SP +S+ AITVGA    DDR    A FSNWG CVDIFA G+ + S  + 
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 408 SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL 467
                   SGTSMASP V G ++  L            S  + P  ++++++  STKG  
Sbjct: 514 VPYKYIKYSGTSMASPIVCGFVSILL------------SQGVKPNDVQEEMVKLSTKGDF 561

Query: 468 ----FDLPEDTPNALIYNG 482
                     T N +++NG
Sbjct: 562 TRRSLIFKPFTSNRILFNG 580

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  182 bits (463), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 177/316 (56%), Gaps = 34/316 (10%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLGSFN--------KYLYDDA-AGEGVDSYIIDTGINVK 231
           +F  Q NAP  LARIS R  L     N         Y YDD+  G  V++Y+IDTGI  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 232 HKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGS 291
           H++F+GRA++G  +   +   D NGHGTH AG I S+ YGVAK  ++I VK L + G G+
Sbjct: 189 HRQFQGRAKFGADLV-GEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 292 MSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVA 351
           ++ VI  +EF    H  K+K      +G  AN+SLG  ++  L++ V+AA++ G+   VA
Sbjct: 248 LTSVISAIEFTV-NHCRKSK------RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVA 300

Query: 352 AGNENQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDD 410
           AGN N +AC +SPA+S  AI+VGA    +D  A FSNWG+CVD+FAPG+ I S       
Sbjct: 301 AGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPF 360

Query: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL--- 467
            +   SGTSMASP V G++   L             + I P  +K++L++ +T  V    
Sbjct: 361 KSVAYSGTSMASPLVTGMVAVLL------------DSGIHPFDIKEELINTATDSVFHKR 408

Query: 468 -FDLPEDTPNALIYNG 482
                  TPN + + G
Sbjct: 409 ALLFKPGTPNRVAFTG 424

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  180 bits (456), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 168/318 (52%), Gaps = 38/318 (11%)

Query: 183 DTQNNAPWGLARISHRDPLSLG-----SFNKYL--YDDAAGEGVDS--YIIDTGINVKHK 233
           D Q  AP  L ++S R  L         F +++  Y D   +G +S  YIIDTG+  +HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 234 EFEGRAQWGKTIPDNDFDEDG----NGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGS 289
           EF  R  +G      DF  +G    NGHGTH AG I SK +GVAK   +  VKVL   G 
Sbjct: 208 EFGNRVHFG-----GDFIGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGF 262

Query: 290 GSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFS 349
           G+++ V+ G+EFA      K +      K    NMSLG  ++P ++  +  A   G+   
Sbjct: 263 GNLTSVLEGIEFAVNNCKLKQQPMG---KNCVINMSLGTIRNPIINEAIKEAFLSGITPV 319

Query: 350 VAAGNENQDACNTSPAASERAITVGA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS 408
           VAAGN N  AC TSPA+S  AITVGA    +D  A FSNWG CVDIFAPG+ I S     
Sbjct: 320 VAAGNNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRM 379

Query: 409 DDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLF 468
            +     SGTSMASP VAGL+   +    EK  +         +++K+KL+D S+K +  
Sbjct: 380 LENGVIHSGTSMASPIVAGLVAILM----EKGYK--------CDEIKQKLIDDSSKSIFS 427

Query: 469 DL----PEDTPNALIYNG 482
            L       TPN +IYNG
Sbjct: 428 KLTLFFKYGTPNRVIYNG 445

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  174 bits (441), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 119/316 (37%), Positives = 163/316 (51%), Gaps = 39/316 (12%)

Query: 184 TQNNAPWGLARISHRDPLSL---------GSFNKYLYDDAAGEGVDSYIIDTGINVKHKE 234
            Q+ AP  LARIS RD L            SFN Y   +  G  V +YI+D+G++    +
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 235 FEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSD 294
           FEGR ++G      D + D NGHGTH AG + SK YGVAK   ++ VK L   G G++  
Sbjct: 178 FEGRVEFGFDFT-GDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 295 VIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGN 354
           V+  +EFA          ++   K   AN+SLG  K+  +++ + AA + G+   VAAGN
Sbjct: 237 VLSAIEFAVND------CHEHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGN 290

Query: 355 ENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYTGSDD 410
            N +AC TSPA++E AITVGA    DDR    A FSNWG CVDI+APG+ + S       
Sbjct: 291 FNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMV 347

Query: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVL--- 467
              + SGTSMASP V G +   L               I  + +K  L+  +T  V    
Sbjct: 348 KNISYSGTSMASPIVCGQVAILL------------DKGIPNDDIKSTLIKMATDDVFQKR 395

Query: 468 -FDLPEDTPNALIYNG 482
                 +TPN +++NG
Sbjct: 396 TLLFKPNTPNRVLFNG 411

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  171 bits (434), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/330 (38%), Positives = 178/330 (53%), Gaps = 44/330 (13%)

Query: 179 TNEFDTQNNAPWGLARISHRDPLSL------GSFNKYLY-DDAAGEGVDSYIIDTGINVK 231
           +++F +Q+ AP  LARIS R  L +       S  KY Y ++  GEGV  Y++D+G+N  
Sbjct: 148 SDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHD 207

Query: 232 HKEFEGRAQWGKTIPDNDFDEDGN--GHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGS 289
           H +FEGRA  G    D   +  G+  GHGTH AG I SK YGVAK+ N++ VKVL S G 
Sbjct: 208 HPDFEGRAMKGI---DTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGK 264

Query: 290 GSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGG-GKSPSLDRVVDAAVKLGLHF 348
           G+++++I G+E+   Q   K +           NMSLG  G    LD+ V A ++ G+  
Sbjct: 265 GTVTNIIEGLEYVVNQCIGKKRK-------CVINMSLGAPGTHSILDKAVSAVIEEGVVV 317

Query: 349 SVAAGNENQDACNTSPAASERAITVGASTLSDDR----AYFSNWGSCVDIFAPGLNILST 404
            VA GN   +AC  SPA   +AITV A    DDR    A FSNWG+C+DI+APG+N+ S 
Sbjct: 318 VVAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKS- 373

Query: 405 YTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLDYSTK 464
            +     T  LSGTSMASP VAG    +L    +            P +++K L   +T+
Sbjct: 374 LSNKGRGTFVLSGTSMASPIVAGAAAIYLDQGAD------------PAEVRKILSKTATR 421

Query: 465 GVL----FDLPEDTPNALIYNGGGADLSDF 490
           GV       +   TPN ++Y G   +  +F
Sbjct: 422 GVFKKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  151 bits (381), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 146/259 (56%), Gaps = 12/259 (4%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQ 240
           E+  Q +AP  LAR+S +  L  GS   Y+Y    G GVD Y++DTGI+  H E EGR Q
Sbjct: 89  EYIVQEHAPAHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQ 147

Query: 241 WGKTIPDNDFDE-DGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGV 299
               +  N     D +GHGT  AG I S  +G AK+ N+  V+V  S G+ ++  VI  +
Sbjct: 148 KIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRAL 207

Query: 300 EFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVK-LGLHFSVAAGNENQD 358
           E     HASK  S  ++   S   +     K+  L+  ++A ++   L   VA GN NQ+
Sbjct: 208 E-----HASKLASVTQR--PSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQN 260

Query: 359 ACNTSPAASERAITVGA--STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLS 416
           AC++SPA++  A+T+G+   T  D  A F+N+G C+D FA G+NI S  TG  ++    S
Sbjct: 261 ACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYS 320

Query: 417 GTSMASPHVAGLLTYFLSL 435
           GTS+++   +G++ Y++SL
Sbjct: 321 GTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  146 bits (368), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 159/291 (54%), Gaps = 17/291 (5%)

Query: 153 ELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFN---KY 209
           E    +LE   RS  +  +  D  +   E+  Q +AP  LAR+S +  L  G+ +    Y
Sbjct: 61  EFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGAY 120

Query: 210 LYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDE-DGNGHGTHCAGTIASK 268
           +Y   AG GVD Y++DTGI+  H  FEGR Q       +     D +GHGT  AG I S 
Sbjct: 121 IYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGSS 180

Query: 269 HYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGG 328
            +GVAK+ N+  V+V  S G  S+  V+  +E     HASK  +  K  + S   + L  
Sbjct: 181 VFGVAKKCNLFDVRVANSTGHASLIGVLRALE-----HASKLAAVTK--RPSLITIPLEM 233

Query: 329 GKSPSLDRVVDAAVK-LGLHFSVAAGNENQDACNTSPAASERAITVGASTLS--DDRAYF 385
            ++  L+  V+A V+ L +   VAAGNEN+ AC+ SPA +  A+T+G+  ++  D  A F
Sbjct: 234 PRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARNDALAPF 293

Query: 386 SNWGSCVDIFAPGLNILSTYTGSDDATA-TLSGTSMASPHVAGLLTYFLSL 435
           +N+  CVD+F  G+++ +   G D ++   LSGTS+++   +GL+ Y++S+
Sbjct: 294 TNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVAYYMSI 342

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  147 bits (372), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 129/258 (50%), Gaps = 11/258 (4%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLGS---FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEG 237
           ++ TQ NAP  L+R S    L   S   +N Y   D  G  V  Y++D+GI + H EFEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 238 RAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIM 297
           R        D+    D  GHGT  AG I SK YGVAK  N+I +KVL + G G++  ++ 
Sbjct: 201 RILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 298 GVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ 357
           G++F  K        N         N SLG      L++  +     G+    AAGN   
Sbjct: 260 GLQFITKHCEENTNGN------CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 358 DACNTSPAASERAITVGASTLSDDR-AYFSNWGSCVDIFAPGLNILSTYTGSDDATATLS 416
           +AC  +PA S+   TVG+    DD  A FSNWG CVD+ APG+ + +    +   +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 417 GTSMASPHVAGLLTYFLS 434
           GTS+++P V GL    LS
Sbjct: 374 GTSVSTPIVTGLAAILLS 391

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  124 bits (310), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 153/317 (48%), Gaps = 30/317 (9%)

Query: 136 DVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARI 195
           ++ D F+L G    +  + S  +L+ +   P V  + +D  +   E   QNNAP  L  +
Sbjct: 44  EITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGL 102

Query: 196 SHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEG-----RAQWGKT-IPDND 249
           S   PLS      ++Y    G GVD Y++DTGI++KH           A   ++ +P   
Sbjct: 103 SSISPLS---HQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQG- 158

Query: 250 FDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASK 309
              D  GHGT  AG IAS+ +GV K+ N++ V+V  SNG   +S ++  +    ++H   
Sbjct: 159 --TDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEG 215

Query: 310 AKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPA---- 365
                K+       + +  G +P L   + A+    +   + AGN  QDA N SPA    
Sbjct: 216 T----KRPSVVVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNP 270

Query: 366 ASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNI-------LSTYTGSDDATATLSGT 418
             +  I VG+  ++++   F+N+GS VD+F  G  I       L +   S+  T  +SGT
Sbjct: 271 KPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGT 330

Query: 419 SMASPHVAGLLTYFLSL 435
           S +S   AG++ Y++SL
Sbjct: 331 SASSAITAGVIGYYMSL 347

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  121 bits (304), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 159/302 (52%), Gaps = 24/302 (7%)

Query: 149 GYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISH---RDPLSLGS 205
           G+  E    V+  +   P V  +  D  ++  E+  QN+AP  LAR+S+      +S  +
Sbjct: 63  GFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKN 122

Query: 206 FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTI--PDNDFDE-DGNGHGTHCA 262
            N +++   AG GVD YI+D+GI+ +H  F  R    K I   DN     D +GHGT  A
Sbjct: 123 ENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHGHGTAIA 181

Query: 263 GTIASKHYGVAKRANVIAVKVLRSNGSG-SMSDVIMGVEFAAKQHASKAKSNDKKFKGST 321
           G + S  +GV K+AN+  V+V+ +  +G  +S ++  +EF   ++ S+A       + S 
Sbjct: 182 GLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI--ENHSRA-----TMRPSV 234

Query: 322 ANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAA---SERAITVGASTL 378
           A +     K+  L+  +++     +   V AGN++  ACN SPA+   S+  ++VG+   
Sbjct: 235 AVLPFSMSKNAILNSAIESMPN-SIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDY 293

Query: 379 --SDDRAYFSNWGSCVDIFAPG--LNILSTYTGSD-DATATLSGTSMASPHVAGLLTYFL 433
             S + A FSN+G CVD+F  G  ++ L   T SD +  + +SGTSM+    AG + Y++
Sbjct: 294 RSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYM 353

Query: 434 SL 435
           SL
Sbjct: 354 SL 355

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 139/272 (51%), Gaps = 35/272 (12%)

Query: 185 QNNAPWGLARISHRDPLSLGSF----NKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRA- 239
           Q +AP  L R++ +D +    +    N+Y++ D +G GVD YI+DTGI+++H  +     
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 240 -----QWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGS-GSMS 293
                     IP  DF    NGHGT  AG I S  +GV K AN++ V+V+ +N    +MS
Sbjct: 156 HKLIDLTTSPIPSGDF----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMS 211

Query: 294 DVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAG 353
            V+  +    K          K  + S   +     K+  L+  ++   K  +   + AG
Sbjct: 212 RVLSALSLIEKHE-------QKTMRPSIIVLPFQTEKNTILESAIENISK-KIPVIIPAG 263

Query: 354 NENQDACNTSPAASER---AITVGASTLSDDRAY-----FSNWGSCVDIFAPGLNILSTY 405
           N++Q+AC  SP   ++    + VG+   S+++ Y     FSN+GSCVDI+  G++I +  
Sbjct: 264 NKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLK 323

Query: 406 TGSD---DATATLSGTSMASPHVAGLLTYFLS 434
           T S+   +    ++GTS +   VAG++ Y++S
Sbjct: 324 TSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 143/292 (48%), Gaps = 27/292 (9%)

Query: 153 ELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYD 212
           E S   LE +     V  + +D ++   E+  Q  +P  L+++S     S GSF    +D
Sbjct: 59  EFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-----SGGSFT---FD 110

Query: 213 DAAGEGVDSYIIDTGINVKHKEFEG-----RAQWGKT-IPDNDFDEDGNGHGTHCAGTIA 266
             +G  VD Y+ DTGI+ KH   +       A +  + +P      D +GHGT  AG IA
Sbjct: 111 PVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---ADPHGHGTMMAGLIA 167

Query: 267 SKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSL 326
           S+ +GV K  +++ V+V   +G   +S ++ G+  A+  HA   K         T     
Sbjct: 168 SETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSVFVLPMTI---- 222

Query: 327 GGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFS 386
            G K+  LD  + A  K  +   + AGN+  DAC+ SP      + +G+    +  A FS
Sbjct: 223 -GKKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFS 280

Query: 387 NWGSCVDIFAPGLNIL---STYTGSDDATATLSGTSMASPHVAGLLTYFLSL 435
           N+G+CVD++  G +IL   ST +G++    + +GTS +    AG++ Y +S+
Sbjct: 281 NYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  103 bits (256), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 85/285 (29%), Positives = 129/285 (45%), Gaps = 34/285 (11%)

Query: 168 VQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTG 227
           +  +  D ++   E   Q +AP  L ++   +       N+++YD  AG GVD YI DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTG 135

Query: 228 INVKHKEFEGR------AQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAV 281
           I                   G  I D +  E    HGT  +G I S  +GV K+ N+I V
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEILE----HGTAMSGLIGSPAFGVLKKCNLIDV 191

Query: 282 KVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAA 341
            V   NG   MS V+ G+    +QH           + S  N S    K+  L+   D  
Sbjct: 192 NVGDENGKVFMSKVLKGLNL-VQQHVKHTN------RPSVINFSYCTLKNAILNSAFDNF 244

Query: 342 VKLGLHFSVAAGNENQDACNTSPAASER---AITVGASTLSDD---RAYFSNWGSCVDIF 395
            +  +  +VAAGN  Q  C+ SP   +R    +  G+  ++DD    + FSN+GSCV  +
Sbjct: 245 PR-DVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSY 303

Query: 396 APGLNIL------STYTGSDDATATLSGTSMASPHVAGLLTYFLS 434
           APG  +L      ++   S D    +SGTS +S   AG++ Y+++
Sbjct: 304 APGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 130/324 (40%), Gaps = 53/324 (16%)

Query: 151 VAELSPMVLELVRRSP-------FVQLVEQDSEVHTNE--FDTQNNAPWGLARISHRDPL 201
           + +L+P    +V+R+P          +V+   ++H ++  F  Q    W L  I+   P 
Sbjct: 123 LQDLTPQRDHIVKRAPVPIIDSSMEPIVQAQKQLHISDPSFPKQ----WHL--INAAFPG 176

Query: 202 SLGSFNKYLYDDAAGEGVDSYIIDTGI-----NVKHKEFEGRAQWGKTIPDNDFDEDG-- 254
           +  +  +  Y++  G G+ + I+D G+     N+K   F     W       DF+++G  
Sbjct: 177 NDVNVKQLWYENVTGTGIVAAIVDDGVDYDNDNIK-DNFSREGSW-------DFNDNGPL 228

Query: 255 -------NGHGTHCAGTIASKH------YGVAKRANVIAVKVLRSNGSGSMSDVIMGVEF 301
                  + HGT CAG IA+         GVA  A V  +++L  +G  +  D    +  
Sbjct: 229 PKPKLKDDYHGTRCAGEIAASKNNGICGVGVAYDAKVAGIRIL--SGELTAEDEAASLVH 286

Query: 302 AAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DA 359
           A   +   + S   +  G+         K   +  V +   + G  +  A+GN     D 
Sbjct: 287 ALDVNDIYSCSWGPRDDGTHLQGPTDLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDN 346

Query: 360 CNTSPAA-SERAITVGASTLSDDRAYFSNWGSCVDIFA----PGLNILSTYTGSDDATAT 414
           CN      S  +ITVGA         +S   S V +       G  I +T  G D  + T
Sbjct: 347 CNYDGYTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNT 405

Query: 415 LSGTSMASPHVAGLLTYFLSLQPE 438
             GTS A+P  AG+ T  L   PE
Sbjct: 406 HGGTSAAAPLAAGVYTLVLQANPE 429

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 103/258 (39%), Gaps = 40/258 (15%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDGN---------GH 257
           Y++  G GV + I+D G++ ++++    F     W       DF+++ N          H
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSW-------DFNDNTNLPKPRLSDDYH 213

Query: 258 GTHCAGTIASKH------YGVAKRANVIAVKVLRS--NGSGSMSDVIMGVEFAAKQHASK 309
           GT CAG IA+K        GV   A +  +++L          + +I G++       S 
Sbjct: 214 GTRCAGEIAAKKGNDFCGVGVGYNAKISGIRILSGEITTEDEAASLIYGLDTNDIYSCSW 273

Query: 310 AKSND-KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAA-S 367
             ++D +  +G +  +     K  +  R    A+ +   F+   G    D CN      S
Sbjct: 274 GPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYV---FASGNGGARGDNCNYDGYTNS 330

Query: 368 ERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYTGSDDATATLS----GTSMAS 422
             +IT+GA    D    +S   SC  + A   +  S  Y  S D     S    GTS A+
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSHGGTSAAA 388

Query: 423 PHVAGLLTYFLSLQPEKS 440
           P  AG+ T  L   P  S
Sbjct: 389 PLAAGVYTLLLEANPSLS 406

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 102/255 (40%), Gaps = 40/255 (15%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDGN---------GH 257
           Y++  G GV + I+D G++ ++++    F     W       DF+++ N          H
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSW-------DFNDNTNLPKPRLSDDYH 213

Query: 258 GTHCAGTIASKH------YGVAKRANVIAVKVLRSN--GSGSMSDVIMGVEFAAKQHASK 309
           GT CAG IA+K        GV   A +  +++L  +       + +I G++       S 
Sbjct: 214 GTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDVNDIYSCSW 273

Query: 310 AKSND-KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAA-S 367
             ++D +  +G +  +     K  +  R    A+ +   F+   G    D CN      S
Sbjct: 274 GPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYV---FASGNGGTRGDNCNYDGYTNS 330

Query: 368 ERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYTGSDDATATLS----GTSMAS 422
             +IT+GA    D    +S    C  + A   +  S  Y  S D     S    GTS A+
Sbjct: 331 IYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSAAA 388

Query: 423 PHVAGLLTYFLSLQP 437
           P  AG+ T  L   P
Sbjct: 389 PLAAGVYTLLLEANP 403

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 104/259 (40%), Gaps = 42/259 (16%)

Query: 208 KYLYDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDGN-------- 255
           K  Y++  G GV + I+D G++ ++++    F     W       DF+++ N        
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSW-------DFNDNTNLPKPRLSD 210

Query: 256 -GHGTHCAGTIASKH------YGVAKRANVIAVKVLRSN--GSGSMSDVIMGVEFAAKQH 306
             HGT CAG IA+K        GV   A +  +++L  +       + +I G++      
Sbjct: 211 DYHGTRCAGEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDTNDIYS 270

Query: 307 ASKAKSND-KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPA 365
            S   ++D +  +G    +     K  +  R    A+ +   F+   G    D CN    
Sbjct: 271 CSWGPADDGRHLQGPNDLVKKALVKGVTQGRDSKGAIYV---FASGNGGARGDNCNYDGY 327

Query: 366 A-SERAITVGASTLSDDRAYFSNWGSCVDI--FAPGLNILSTYTGSDD----ATATLSGT 418
             S  +IT+GA    D    +S   S V +  ++ G      Y  S D     + T  GT
Sbjct: 328 TNSIYSITIGAIDHKDLHPPYSEGCSAVMVVTYSSG---SGEYIHSSDINGGCSNTHGGT 384

Query: 419 SMASPHVAGLLTYFLSLQP 437
           S A+P  AG+ T  L   P
Sbjct: 385 SAAAPLAAGVYTLLLEANP 403

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 105/259 (40%), Gaps = 48/259 (18%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDGN---------GH 257
           Y++  G GV + I+D G++ ++++    F     W       DF+++ N          H
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSW-------DFNDNTNLPKPRLLDDYH 213

Query: 258 GTHCAGTIASKH------YGVAKRANVIAVKVLRSNGSGSMS------DVIMGVEFAAKQ 305
           GT CAG IA+K        GV   A +  +++L    SG ++       +I G++     
Sbjct: 214 GTRCAGEIAAKKGNNFCGIGVGYNAKISGIRIL----SGELTTEDEAASLIYGLDTNDIY 269

Query: 306 HASKAKSND-KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSP 364
             S   ++D +  +G +  +     K  +  R    A+ +   F+   G  + D CN   
Sbjct: 270 SCSWGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYV---FASGNGGAHGDNCNYDG 326

Query: 365 AA-SERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYTGSDDATATLS----GT 418
              S  +IT+GA    D    +S    C  + A   +  S  Y  S D     S    GT
Sbjct: 327 YTNSIYSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGT 384

Query: 419 SMASPHVAGLLTYFLSLQP 437
           S A+P  AG+ T  L   P
Sbjct: 385 SAAAPLAAGVYTLLLEANP 403

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 101/247 (40%), Gaps = 27/247 (10%)

Query: 212 DDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCAG 263
           ++  G GV + ++D G++ ++++    F     W       +P     +D   HGT CAG
Sbjct: 151 ENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDY--HGTRCAG 208

Query: 264 TIASKH-----YGVAKRANVIAVKVL--RSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK 316
            IA+        GVA  + V  +++L  +       + +I G++       S   S+D K
Sbjct: 209 EIAAFRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLDVNDIYSCSWGPSDDGK 268

Query: 317 FKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DACN-TSPAASERAITV 373
              +   +     K   +  V +     G  +  A+GN     D+CN      S  +ITV
Sbjct: 269 TMQAPDTLV----KKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITV 324

Query: 374 GASTLSDDRAYFSNWGSCVDI--FAPGL-NILSTYTGSDDATATLSGTSMASPHVAGLLT 430
           GA         +S   S V +  ++ G  N + T    +  + T  GTS A+P  AG+ T
Sbjct: 325 GAIDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYT 384

Query: 431 YFLSLQP 437
             L   P
Sbjct: 385 LVLEANP 391

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 99/253 (39%), Gaps = 30/253 (11%)

Query: 208 KYLYDDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGT 259
           K  Y++  GEG+   I+D G++ ++ +    F     W       +P     +D   HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADD--YHGT 229

Query: 260 HCAGTIASKH------YGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSN 313
            CAG IA+         GVA  A V  +++L  +G  +  D    +  A   +   + S 
Sbjct: 230 RCAGEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSW 287

Query: 314 DKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DACNTSP-AASERA 370
             K  G+         K   +    D   K G  +  A+GN     D CN      S  +
Sbjct: 288 GPKDDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSIYS 347

Query: 371 ITVGASTLSDDRAYFSNWGSCVDIFA------PGLNILSTYTGSDDATATLSGTSMASPH 424
           IT+GA         +S   SC  + A       G  I ST  G +  +    GTS A+P 
Sbjct: 348 ITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIG-NKCSDHHGGTSAAAPL 404

Query: 425 VAGLLTYFLSLQP 437
            AG+ +  L + P
Sbjct: 405 AAGIFSLVLQVNP 417

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCA 262
           Y++  G GV + I+D G++ + ++    F     W       +P    D+D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDY--HGTRCA 211

Query: 263 GTIAS-----KHYGVAKRANVIAVKVLRSNGSGSM--SDVIMGVEFAAKQHASKAKSND- 314
           G IA+        GVA  A +  +++L    +     + +I G++       S   ++D 
Sbjct: 212 GEIAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLDINDIYSCSWGPADDG 271

Query: 315 KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DACNTSPAA-SERAI 371
           +  +G T  +     +   +  V +   K G  +  A+GN     D CN      S  +I
Sbjct: 272 RHLQGPTDLV-----RKALVKGVQEGRDKKGALYVFASGNGGAFGDNCNYDGYTNSIYSI 326

Query: 372 TVGASTLSDDRAYFSNWGSC----VDIFAPGL-NILSTYTGSDDATATLSGTSMASPHVA 426
           TVGA  L     + S   SC    V  ++ G    + T       + T  GTS A+P  A
Sbjct: 327 TVGA--LDHKGLHPSYSESCSALMVTTYSSGSGEFIHTTDIKGQCSETHGGTSAAAPLAA 384

Query: 427 GLLTYFLSLQP 437
           G+    L   P
Sbjct: 385 GIYALILEANP 395

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 21/117 (17%)

Query: 181 EFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKE----FE 236
           EFD Q    W L  I+   P +  +     Y++  G GV + I+D G++ ++++    F 
Sbjct: 161 EFDKQ----WHL--INTNFPGNDVNVTALWYENITGHGVVAAIVDDGLDYENRDLKDNFC 214

Query: 237 GRAQW----GKTIPDNDFDEDGNGHGTHCAGTIASKH-----YGVAKRANVIAVKVL 284
               W       +P     +D   HGT CAG IA+        GVA  A V  +++L
Sbjct: 215 AEGSWDFNDNTPLPKPRLRDD--YHGTRCAGEIAAVKNDACGVGVAYNAKVAGIRIL 269

>Skud_4.646 Chr4 (1149707..1151188) [1482 bp, 493 aa] {ON} YDR376W
           (REAL)
          Length = 493

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 128 VSAQGIVADVLDSFDLEGVL-SGYVAEL------SPMVLELVRRSPF--VQLVEQDSEVH 178
           VS  GI+ +   + D+  VL S  + E+      SP+ L+LVR++P   V+L+ +   VH
Sbjct: 169 VSKVGIIGNGNVALDITRVLISSQIDEIWKATDISPLALKLVRKAPVKDVRLIARRDFVH 228

Query: 179 TNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYD 212
           +   + +    W L +   R  +    F K ++D
Sbjct: 229 SRFTNKELRELWELEKFGIRGSIGSKFFQKEMFD 262

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCA 262
           Y++  G GV + I+D G++ + ++    F     W       +P     +D   HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDN--HGTRCA 211

Query: 263 GTIASKH-----YGVAKRANVIAVKVLRSN 287
           G IA+        GVA  A V  +++L ++
Sbjct: 212 GEIAAAKNKVCGVGVAYNAKVSGIRILSAD 241

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 96/246 (39%), Gaps = 29/246 (11%)

Query: 215 AGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCAGTIA 266
            G+GV + I+D G++   ++    F     W     K +P     +D   HGT CAG IA
Sbjct: 162 TGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEIA 219

Query: 267 SKH-----YGVAKRANVIAVKVL--RSNGSGSMSDVIMGVEFAAKQHASKAKSND-KKFK 318
           +        GVA  A V  +++L  +       + ++ G++       S    +D K  +
Sbjct: 220 AVKNEYCGLGVAYGAKVAGIRILSGQITAEDEAASLMYGLDINDIFSCSWGPPDDGKHLQ 279

Query: 319 GSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAA-SERAITVGAST 377
           G +  +     K     R    ++ +   F+   G    D CN      S  +IT+GA  
Sbjct: 280 GPSDLVKKAMIKGTQEGRNEKGSIYV---FASGNGGHYGDNCNYDGYTNSIYSITIGAID 336

Query: 378 LSDDRAYFSNWGSCVDIFAPGLNILS-TYTGSDDATATLS----GTSMASPHVAGLLTYF 432
                  +S   SC  + A   +  S  Y  S D  +  S    GTS A+P  AG+    
Sbjct: 337 HKGLHPPYSE--SCSAVLAVTYSSGSGEYIHSTDIKSQCSDRHGGTSAAAPLAAGIYALV 394

Query: 433 LSLQPE 438
           L   PE
Sbjct: 395 LEANPE 400

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 25/92 (27%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDG---------NGH 257
           Y++  G  V   ++D G++ + ++    F     W       DF+++G         + H
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSW-------DFNDNGPMPKPRLSDDYH 207

Query: 258 GTHCAGTIASKH-----YGVAKRANVIAVKVL 284
           GT CAG IA+        GVA  A V  +++L
Sbjct: 208 GTRCAGEIAAVKNKACGIGVAYNAKVAGIRIL 239

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 96/249 (38%), Gaps = 28/249 (11%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCA 262
           Y +  G+GV + ++D G++ ++ +    F     W       +P     +D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY--HGTRCA 209

Query: 263 GTIASKH------YGVAKRANVIAVKVLRS--NGSGSMSDVIMGVEFAAKQHASKAKSND 314
           G IA+         GVA  A V  +++L          + +I  ++       S    +D
Sbjct: 210 GEIAAVKNNGICGIGVAYDAKVAGIRILSGEITAEDEAAALINALDINDIYSCSWGPQDD 269

Query: 315 KKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DACNTSPAA-SERAI 371
                  +++     K   +  V D     G  +  A+GN     D CN      S  +I
Sbjct: 270 GTHLQGPSDLV----KKALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYTNSIYSI 325

Query: 372 TVGASTLSDDRAYFSNWGSCVDI--FAPGL-NILSTYTGSDDATATLSGTSMASPHVAGL 428
           TVGA    D    +S   S V +  ++ G    + T   ++       GTS A+P  AG+
Sbjct: 326 TVGAIDHKDLHPPYSESCSAVMVVTYSSGSGEYIHTTDINNKCNDRHGGTSAAAPLAAGI 385

Query: 429 LTYFLSLQP 437
            T  L   P
Sbjct: 386 YTLLLQANP 394

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 97/251 (38%), Gaps = 30/251 (11%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQW----GKTIPDNDFDEDGNGHGTHCA 262
           Y +  G GV   I+D G++ ++ +    F     W      T+P     +D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 263 GTIASKH------YGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK 316
           G IA+         GVA  + V  +++L  +G  +  D    + +A   +   + S   +
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRIL--SGPLTPEDEAASLMYALDVNDIFSCSWGPQ 280

Query: 317 FKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQ--DACNTSPAA-SERAITV 373
             G          +   +  V +   K G  +  A+GN     D CN      S  +IT+
Sbjct: 281 DDGRHLQGPSELVRKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYSITI 340

Query: 374 GASTLSDDRAYFSNWGSCVDIFA------PGLNILSTYTGSDDATATLSGTSMASPHVAG 427
           GA         +S   SC  + A       G  I ST   +D  +    GTS A+P  AG
Sbjct: 341 GAIDHKGLHPPYSE--SCSAVMAVTYSSGSGEFIHSTDI-NDQCSDRHGGTSAAAPLAAG 397

Query: 428 LLTYFLSLQPE 438
           +    L   PE
Sbjct: 398 IYALLLEANPE 408

>TDEL0B06940 Chr2 complement(1225910..1228648) [2739 bp, 912 aa]
           {ON} Anc_2.601 YKL064W
          Length = 912

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 28/99 (28%)

Query: 57  KHEKDEHRPCKHGKEAHDEE-----ELAPLYTPGXXXXXXXXXXNKYIILFKEGV----- 106
           K EK++    K+ +++ D       EL PL              N YII+F+ GV     
Sbjct: 581 KDEKEQEEKQKYKRKSGDRHKPRQGELEPL--------------NVYIIVFRTGVLTFHF 626

Query: 107 --TAEQISAHKQ--LLQQVLLETSDVSAQGIVADVLDSF 141
             T   I+  ++  LL+  L  TSD  A  ++ D+ DSF
Sbjct: 627 APTPHPINVRRRARLLKDYLSVTSDWIAYALIDDITDSF 665

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 25/92 (27%)

Query: 211 YDDAAGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDEDGN---------GH 257
           Y+   G+GV   I+D G++ + ++    F     W       DF+E+ N          H
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSW-------DFNENQNLPKPLLYDDYH 209

Query: 258 GTHCAGTIASKH-----YGVAKRANVIAVKVL 284
           GT CAG IA+        GVA  + V  +++L
Sbjct: 210 GTRCAGEIAAAKNEYCGLGVAYGSKVSGIRIL 241

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 95/255 (37%), Gaps = 48/255 (18%)

Query: 215 AGEGVDSYIIDTGINVKHKE----FEGRAQWGKTIPDNDFDED---------GNGHGTHC 261
            G+GV + IID G++    +    F     W       DF+E+          + HGT C
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSW-------DFNENQQLPMPLLSDDNHGTRC 221

Query: 262 AGTIAS---KHY---GVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDK 315
           AG IA+    +Y   GVA  A V  +++L    SG ++      E A+  HA        
Sbjct: 222 AGEIAAIRNNNYCGVGVAYDAKVSGIRIL----SGPLT---AEDEAASLVHALDVNDIYS 274

Query: 316 KFKGSTANMSLGGGKSPSLDRVVDAAVKLG-------LHFSVAAGNENQDACNTSP-AAS 367
              G T +     G SP + + +   V  G         F+   G  + D CN      S
Sbjct: 275 CSWGPTDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNS 334

Query: 368 ERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYTGSDDATATL----SGTSMAS 422
             +ITVGA         +S   SC  +     +  S  Y  S D          GTS A+
Sbjct: 335 IYSITVGAIDHKGLHPPYSE--SCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAA 392

Query: 423 PHVAGLLTYFLSLQP 437
           P  AG+    L   P
Sbjct: 393 PIAAGIYALVLEANP 407

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,545,330
Number of extensions: 2525665
Number of successful extensions: 5273
Number of sequences better than 10.0: 100
Number of HSP's gapped: 5197
Number of HSP's successfully gapped: 112
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)