Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0E009106.46ON48648624020.0
KAFR0L004206.46ON4604876933e-85
NCAS0H009006.46ON4955076781e-82
NDAI0D008906.46ON5393416698e-81
ZYRO0C07172g6.46ON4504406583e-80
TDEL0G042406.46ON4444456574e-80
SAKL0E01980g6.46ON4654886245e-75
Smik_13.1066.46ON5064606268e-75
CAGL0J11792g6.46ON5105006191e-73
Skud_13.1056.46ON5124706076e-72
Suva_13.1176.46ON5134746051e-71
YML043C (RRN11)6.46ON5074606022e-71
Ecym_30496.46ON5014975464e-63
KLTH0C10582g6.46ON4814575438e-63
ACL020W6.46ON5394475469e-63
Kwal_56.225276.46ON4814635158e-59
KLLA0C05852g6.46ON4824474957e-56
TBLA0B005706.46ON5173654961e-55
TPHA0J005106.46ON4374644733e-53
Kpol_1037.116.46ON4014354564e-51
Suva_15.2225.312ON63230742.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0E00910
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   929   0.0  
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   271   3e-85
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   265   1e-82
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   262   8e-81
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   258   3e-80
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   257   4e-80
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   244   5e-75
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   245   8e-75
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   243   1e-73
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   238   6e-72
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   237   1e-71
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   236   2e-71
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   214   4e-63
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   213   8e-63
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   214   9e-63
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   202   8e-59
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   195   7e-56
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   195   1e-55
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   186   3e-53
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   180   4e-51
Suva_15.222 Chr15 (385545..387443) [1899 bp, 632 aa] {ON} YHR035...    33   2.0  

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/486 (93%), Positives = 453/486 (93%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60
           MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60

Query: 61  XXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNHEKPE 120
                      LYDLRDREEHGFESDSSEAQDEVGDLP           RKYFKNHEKPE
Sbjct: 61  RSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEEEIGHEERKYFKNHEKPE 120

Query: 121 DLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGY 180
           DLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGY
Sbjct: 121 DLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGY 180

Query: 181 DVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNLGVA 240
           DVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNLGVA
Sbjct: 181 DVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNLGVA 240

Query: 241 ILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWLWLSLR 300
           ILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWLWLSLR
Sbjct: 241 ILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWLWLSLR 300

Query: 301 AATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRNIHS 360
           AATEQAQEGA           DKTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRNIHS
Sbjct: 301 AATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRNIHS 360

Query: 361 DLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQ 420
           DLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQ
Sbjct: 361 DLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQ 420

Query: 421 LQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADIDAFPIEEDNSFLQALDTQP 480
           LQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADIDAFPIEEDNSFLQALDTQP
Sbjct: 421 LQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADIDAFPIEEDNSFLQALDTQP 480

Query: 481 LSDNFL 486
           LSDNFL
Sbjct: 481 LSDNFL 486

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  271 bits (693), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 176/487 (36%), Positives = 254/487 (52%), Gaps = 47/487 (9%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60
           MFE+PV + S + S     +KLRYRY N+   +++R    D NG +TPE+S  EL   + 
Sbjct: 1   MFEIPVNVNSKTLSNE---RKLRYRYINQFTRRFERKD--DRNGMITPETSEDELQQRKK 55

Query: 61  XXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNHEKPE 120
                       Y   D E  G      +  +E  +             RK+FK  +KP+
Sbjct: 56  RDWLHVIGE---YGSDDDERSG----GQQDDEEEEEEVIDEDYNLNNEERKFFKKIDKPQ 108

Query: 121 DLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGY 180
           + YE W   + R+K  IQR  ++Y+R   + R  +RKM   L+HVS      F  +IDG 
Sbjct: 109 ETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGM 166

Query: 181 DVVS---RGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWNL 237
           ++V    +G   T+F+ K I+ L  LL+ +++  NW +AYK+FA+LIR+P+VDIR+VWN+
Sbjct: 167 EIVEPLHKG--ATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNV 224

Query: 238 GVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWLWL 297
           G  IL  +D   +++FLEWM SVYS +  FIQ +N+R  P FRSGS+ HT +YT  WLW 
Sbjct: 225 GNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWN 284

Query: 298 SLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRN 357
           SL   TEQ  E             DK +E++L PP+MDD E+WFIY  C+ VKAD LS  
Sbjct: 285 SLLEYTEQLFEN---DDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSK 341

Query: 358 IHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYI 417
                TH+V     S  D+  N+V+Q I   ++ L+  +EKS          +E     I
Sbjct: 342 FD---THSV----GSMRDISMNQVIQHINDVKRYLNVCKEKS-------QGQYESNEMII 387

Query: 418 KRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADI-----DAFPIEEDNSF 472
            +QL+  E RL        +P  P   EN   GD E   D++++     + F  ++    
Sbjct: 388 TKQLKAFEVRLYK------EPVFPLEPENDLDGDNEEEVDESNVFEDSANYFEFDDTQEQ 441

Query: 473 LQALDTQ 479
           L  LDTQ
Sbjct: 442 LNDLDTQ 448

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  265 bits (678), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/507 (32%), Positives = 261/507 (51%), Gaps = 62/507 (12%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60
           MF+LP  +   S  +    +K+RY Y N++  +Y R +  + +   TPE+S +E   HES
Sbjct: 1   MFDLPTQI---SNKRIANERKIRYTYINQLSRKYNR-QDAESSSLPTPENSASE--SHES 54

Query: 61  XXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGD-----------LPXXXXXXXXXXX 109
                           + EE          ++ +G+                        
Sbjct: 55  TG--------------EDEEVRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPENQE 100

Query: 110 RKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169
           R++FK HEKP++ YE+W     +R +P+Q++F+S+++L  IE+  KR+M+  LLH S+  
Sbjct: 101 RRFFKTHEKPQESYEIWSTDNNKR-MPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFN 159

Query: 170 SSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRV 229
           +  F +   G ++V+       F  KHI+ L  LLH ++    W +AYK+FAL++R+P+V
Sbjct: 160 NICFESISQGQELVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKV 219

Query: 230 DIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289
           DIR++W +GV IL++R +TT +DFL WM+SVYS++  +IQ + HR+ P FRSGS+TH+++
Sbjct: 220 DIRSIWGIGVKILSQRAATTTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSK 279

Query: 290 YTTTWLWLSLRAATEQAQEG------AXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIY 343
           +T TWLW SL   T+   +                   +K SEL+L PP+M+D+EVWFIY
Sbjct: 280 FTITWLWKSLIYCTDTDNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIY 339

Query: 344 CSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQAR 403
             C+ VKAD LS N       N++  + S  D+ RNEV+Q+I   +  L TA  K     
Sbjct: 340 ALCHMVKADQLSLNF------NLNQSNGSARDIARNEVIQNIQLVKTFLQTAMSK----- 388

Query: 404 HRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADIDA 463
                ++E P  +I RQL   E+RL ++     +       +N    D    +   + + 
Sbjct: 389 ----GHFEYPERFITRQLNTFEERLYSKDETNSKDKDNNESDNGSSMDNGNIQLVPETNP 444

Query: 464 FPIEEDN------SFLQA---LDTQPL 481
            P  ED       SF  A   LDTQ L
Sbjct: 445 IPPAEDEYVFSDFSFTNAAHDLDTQAL 471

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  262 bits (669), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 204/341 (59%), Gaps = 36/341 (10%)

Query: 110 RKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169
           RK+FK +EKP++ +E+W     +R VPI +  ++Y +L+ IE++AKRK+ VPLLH S++ 
Sbjct: 128 RKFFKKYEKPQETFEIWQTNNLKR-VPINKSMITYTKLKKIEKQAKRKITVPLLHASKIN 186

Query: 170 SSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRV 229
              F A  +G ++V+      +F  +HI+ L TLL+ ++S ENW++AY++F LLIR+ ++
Sbjct: 187 KLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKL 246

Query: 230 DIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289
           DIR++W +GV IL+ +  T  +DFL WM+SVYS++  FIQ +N+R+ P F+SGSRTHT +
Sbjct: 247 DIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGSRTHTPK 306

Query: 290 YTTTWLWLSL------------RAATEQAQEGAXXXX--------XXXXXXXDKTSELLL 329
           YT TWLW SL              + E  ++G+                   +K SE++L
Sbjct: 307 YTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIEKISEMVL 366

Query: 330 TPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQ 389
            PP+M+DSEVWFIY  C+ V AD LS   +  +++       S  D+ RN+V+Q I + +
Sbjct: 367 IPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISN------GSRGDIERNQVIQHIQKTK 420

Query: 390 KTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTA 430
             L T+  K D         +E P  YI +QL   E+RL A
Sbjct: 421 SYLQTSMNKGD---------FEYPEKYILKQLSIYEQRLYA 452

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  258 bits (658), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 160/440 (36%), Positives = 222/440 (50%), Gaps = 42/440 (9%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQL---TPESSHTELDD 57
           MFELP+++ S    ++   +KL+Y+Y N +  +Y  I     NGQ    TPE+S TE  +
Sbjct: 1   MFELPLVITS---KRTRTSRKLKYQYINNLSKKYDGIN-GISNGQTELPTPENSATETSE 56

Query: 58  HESXXXXXXXXXXXLYDLRDREEHG-FESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNH 116
           +E                   E +   ESD  +  +EV +             RK+++ +
Sbjct: 57  NEEVGQQKRRRIRKRLKSIIGESYSDLESDEEQPVEEVDN-----------EERKFYRKY 105

Query: 117 EKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAE 176
           EKP+  +E W     R++ PIQR  ++YNR+  I+R   R+ME  L   SR   + F A 
Sbjct: 106 EKPQLTFEKWQ-CDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHAT 164

Query: 177 IDGYDVV--SRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAV 234
             GY +   + G   T F+ KHI  L +LLH ++    W LAYK FALLIR+P VD+R +
Sbjct: 165 TQGYQLFDPTYGRANT-FQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTL 223

Query: 235 WNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTW 294
           W LG  ILA R  T +++FL+WM SVYS K  F  +VN+R+ P F  GS+THT +YTTTW
Sbjct: 224 WGLGERILAERQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKYTTTW 283

Query: 295 LWLSL---RAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSCYFVKA 351
           LW  L       E  +  +           D+ SE++L PPYMDD EVWFIY  C+ VKA
Sbjct: 284 LWECLIRYANGLEDLEMDSKSAAENFQSLMDRISEMVLGPPYMDDPEVWFIYALCHMVKA 343

Query: 352 DILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWE 411
           D LS+     LT        S  D+  N+V+Q I   +  L     K           + 
Sbjct: 344 DTLSQQFDPRLT-------GSARDIASNQVIQHIQNTKSHLQQCSSKGG---------FT 387

Query: 412 LPTGYIKRQLQQIEKRLTAQ 431
            P  YI RQL   E RL  +
Sbjct: 388 FPKRYIARQLAAFEARLYGK 407

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  257 bits (657), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 162/445 (36%), Positives = 230/445 (51%), Gaps = 34/445 (7%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRI-KIHDENGQLTPESSHTELDDHE 59
           MFE PV L +     +   KKLRY+Y N +  ++ R+ +I + NG  TPE+S  E  ++E
Sbjct: 1   MFEQPVALTTRRLRNA---KKLRYQYVNNLSAKFNRLERITNTNGLPTPENSAAESSENE 57

Query: 60  SXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDL--PXXXXXXXXXXXRKYFKNHE 117
                              +    ES S    DEV +               RK+  N+E
Sbjct: 58  EALQRKKKRIRRRL-----KSAAGESYSDSESDEVDNNHDNEVVEDEEEDQERKFLNNYE 112

Query: 118 KPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEI 177
            P++ +E W     +R VPIQR  +S+ + Q + R AKRKM   +   S+          
Sbjct: 113 LPQESFEKWQDDPSKR-VPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTIS 171

Query: 178 DGYDVVSRGD-ETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWN 236
           +G+++V   D +   F+ KHI +L TLLH H+S   W+ AY  FALLIR+P+VDIR +W 
Sbjct: 172 EGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWG 231

Query: 237 LGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWLW 296
           +G  IL  R+   +++FL WM SVYS++  F ++VNHR PP F  GS+TH  ++ TTW+W
Sbjct: 232 IGDLILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKFATTWMW 291

Query: 297 LSLRAATEQAQE-GAXXXXXXXXXXXD---KTSELLLTPPYMDDSEVWFIYCSCYFVKAD 352
            SL   T+ + E G            D   + SE++L PPYMD SEVWFIY  C+ +KAD
Sbjct: 292 ESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIYGLCHLIKAD 351

Query: 353 ILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWEL 412
           ILS      L       + S  D+  N+V+Q I R +  L T   K D         ++ 
Sbjct: 352 ILSNQFDGRL-------AGSARDIASNQVIQHIQRTKSCLQTCLSKGD---------FKY 395

Query: 413 PTGYIKRQLQQIEKRLTAQ-STPRD 436
           P  YI+RQL++ EKRL  Q  TP D
Sbjct: 396 PKRYIERQLEEFEKRLDRQEDTPDD 420

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  244 bits (624), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 158/488 (32%), Positives = 247/488 (50%), Gaps = 41/488 (8%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDEN-GQLTPESSHTELDD-H 58
           MFELPV+    +  +   ++KLRY+Y N +  +++++    +  G  TPESS  E  D  
Sbjct: 1   MFELPVVR---TNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTD 57

Query: 59  ESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNHEK 118
           E               L+    H     SS  +D++ +             +     + K
Sbjct: 58  ELEDSQSKRTKRRKRRLQSILGHAV---SSSDEDDISEEENDNDYEECDYEKHVKNKYYK 114

Query: 119 PEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEID 178
           P++ YE+W    E R VP+    ++Y + + I + A R++   L + S+  ++ FSA  +
Sbjct: 115 PQETYELWTTGPENR-VPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYN 173

Query: 179 GYDVVSRGDETTHFEN---KHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVW 235
           GY+      ET+  EN    HI+ L  LLH ++  +NW +AY+ F++LIR+P VDIR++W
Sbjct: 174 GYEPY----ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIW 229

Query: 236 NLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTTWL 295
            +GV IL   D   + +FLEWM SV+S K+ F Q  NH + P FRSGS+THT ++ T+WL
Sbjct: 230 GIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWL 289

Query: 296 WLSLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSCYFVKADILS 355
           W +L   T + +              +K SEL+LTPPYMDD ++WFIY  C+ V+AD LS
Sbjct: 290 WETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLS 349

Query: 356 RNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTG 415
           +        N H  + S  D+ RN+V+Q IT  +  L T +EK           ++ P  
Sbjct: 350 Q----QFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGG---------FQFPKQ 396

Query: 416 YIKRQLQQIEKRLTAQS----TPRDQPSSPAHYENYGLGDTELAEDQADIDAFPIEEDNS 471
           +I++QL   E RL  ++       D  SS ++  N         +D  D++    EE+N 
Sbjct: 397 HIEKQLSNFENRLYQRTEDLLNNFDSDSSASNEFN--------RQDFQDVNPIVYEEENV 448

Query: 472 FLQALDTQ 479
           F +  D Q
Sbjct: 449 FGELGDAQ 456

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  245 bits (626), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 154/460 (33%), Positives = 244/460 (53%), Gaps = 43/460 (9%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQL---TPESS---HTE 54
           MFE+P+ L +   +Q   R+KL+Y+Y N    ++++I +      L   TPE+S   + E
Sbjct: 1   MFEVPITLTNKKFAQ---RRKLKYQYINHTSRRFEKI-VKKSTTALSLPTPENSAAENNE 56

Query: 55  LDDHESXXXXXXXXXXXLYDLRDREEHGF-------------ESDSSEAQDEVGDLPXXX 101
            DD E            L   + R E  +             ESDS E  +E  +     
Sbjct: 57  EDDGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEG 116

Query: 102 XXXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVP 161
                   RK++K +EKPE+ +EVW   + + K PI +Q ++Y+  + IE+ + RKMEVP
Sbjct: 117 KEEDIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVP 176

Query: 162 LLHVSRVRSSEFSAEIDGYDVVSRG-DETTHFENKHIQLLVTLLHRHISTENWNLAYKVF 220
           LLH ++     F +   G + +     E  ++  KHI  L  LLH ++S  NW+LAYK+F
Sbjct: 177 LLHCTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIF 236

Query: 221 ALLIRMPRVDIRAVWNLGVAILARRDS-TTAIDFLEWMHSVYSNKHRFIQNVNHR-LPPA 278
           A LIR+P V I+++W +GV IL    + +T++DFL+WM  +YS+K RF+Q+ N+R + P 
Sbjct: 237 ATLIRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIVPP 296

Query: 279 FRSGSRTHTAQYTTTWLWLSLRAATEQAQ------EGAXXXXXXXXXXXDKTSELLLTPP 332
           F++GSRTHT+++ TT+LW SL    +  +      +             D+ SE +LTPP
Sbjct: 297 FQTGSRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTPP 356

Query: 333 YMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTL 392
           +M+D+EVWFIY SC+ +KADILSR   +D  +          D++ N+V++ I   +  L
Sbjct: 357 FMEDAEVWFIYASCHLLKADILSRQFAND--NKTSDLIGLDRDIKINQVIKHIHYVKVFL 414

Query: 393 HTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQS 432
            T  +K           + +P   I+ QL+  E RL  ++
Sbjct: 415 QTCSDKGG---------FTVPNRLIESQLKGFESRLYGEA 445

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  243 bits (619), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/500 (31%), Positives = 251/500 (50%), Gaps = 48/500 (9%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQY---KRIKIHDENGQL-TPESSHTELD 56
           MFE+P+   +++  +  V +++RY+Y N +  +Y   +R K   +   L TPE+S  E D
Sbjct: 1   MFEVPI---TYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND 57

Query: 57  DHESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNH 116
             ES              L +         SSE +D   D             + +++ +
Sbjct: 58  QSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKD-DNEFANDMNKFEKLFYRKY 116

Query: 117 EKPEDLYEVWHVATE---RRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEF 173
           EKPE  +EVW+       ++K  +++  + Y RL  +ER AK+++E  ++H+  V    F
Sbjct: 117 EKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYF 176

Query: 174 SAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRA 233
             + +GY+V+    +   +  KHI++L  +L   +S  NW++AY+ F+LLIR+P VDIR 
Sbjct: 177 DIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRN 236

Query: 234 VWNLGVAILARRDSTT-AIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTT 292
           +W LG  IL  R  TT +++FL+WM +VYS+K  F+Q+  HR  P FRSGSRTHT +Y  
Sbjct: 237 IWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYAL 296

Query: 293 TWLWLSLRAATE----QAQEGAXXXXXXXXXXX------------DKTSELLLTPPYMDD 336
           TWLW  L   TE    + ++G                        DK SE++L PPY+DD
Sbjct: 297 TWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDD 356

Query: 337 SEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAE 396
            E+WFIY  C+ V AD LS         N    S S  D+ RN+V Q I   +  L    
Sbjct: 357 PEIWFIYSMCHMVHADYLSGKF------NCQRLSGSRRDIARNQVTQHIHYVKTYLQNCS 410

Query: 397 EKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAE 456
           +K +         +E P  +I+ +L++ EKR+    +   +P +    E+Y   +T  + 
Sbjct: 411 QKGN---------FEYPKQFIQSRLEEFEKRMYEDES---KPENMKLQESY--DNTSYSN 456

Query: 457 DQADIDAFPIEEDNSFLQAL 476
           +  + + F I+E NSFL  L
Sbjct: 457 EDDEENPFQIDESNSFLGNL 476

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  238 bits (607), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 151/470 (32%), Positives = 247/470 (52%), Gaps = 57/470 (12%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRI-KIHDENGQL-TPESSHT----- 53
           MFE+P+ L +   +Q   R+KL+Y+Y N +  ++ ++ K  +    L TPE+S       
Sbjct: 1   MFEVPITLTNKKFAQ---RRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDD 57

Query: 54  ---------ELDDHESXXXXXXXXXXXLYDLRDREEH----------GFESDSSEAQDEV 94
                    ++D+ +                R RE H            E++S   Q+E+
Sbjct: 58  DYDYDEDEEQIDEADVYRRSILQQTK-----RRRERHWKSVVGELYSSTETESDSQQEEI 112

Query: 95  GD---LPXXXXXXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIE 151
            +                RK++K HEKPE  +E+W  A+ + K PI R+ ++Y++ Q I+
Sbjct: 113 QENDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQ 172

Query: 152 RRAKRKMEVPLLHVSRVRSSEFSAEIDGYDVVSRGDETT-HFENKHIQLLVTLLHRHIST 210
           + + RK+++PLLH ++     F +   G + +     T  +++ +HI  L  LLH ++S 
Sbjct: 173 KNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSR 232

Query: 211 ENWNLAYKVFALLIRMPRVDIRAVWNLGVAILARR-DSTTAIDFLEWMHSVYSNKHRFIQ 269
            NW+LAY++FA LIR+P V ++++W  GV IL    DS++++DFL+WM  +YS+K RF+Q
Sbjct: 233 HNWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQ 292

Query: 270 NVNHR-LPPAFRSGSRTHTAQYTTTWLWLSLRAATEQAQEGAX------XXXXXXXXXXD 322
           N+NHR + P F++GSRTHTA++ TT+LW SL    +  +                    D
Sbjct: 293 NINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELID 352

Query: 323 KTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVV 382
           K SE +LTPP+M+D+EVWFIY SC+ +KADILSR   +D T           D++ N+V+
Sbjct: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKG--DLIGLDRDIKINQVI 410

Query: 383 QSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQS 432
           + I   +  L T  +K           + +P   I+ QL+  E RL  ++
Sbjct: 411 KHIHYVKVFLQTCLDKGG---------FTIPNRLIEIQLKNFELRLYGET 451

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  237 bits (605), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/474 (32%), Positives = 242/474 (51%), Gaps = 64/474 (13%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRI--KIHDENGQLTPESS------- 51
           MFE+P+ L +   +Q   R+KL+Y+Y N I  ++ RI  K +  +   TPE+S       
Sbjct: 1   MFEVPITLTNKKFAQ---RRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDE 57

Query: 52  ---------HTELDDHESXXXXXXXXXXXLYDLRDREEH------------GFESDSSEA 90
                    + E D  ES               R RE H              ESDS E 
Sbjct: 58  DYDDDEEERNYESDAGESSIRQQTK--------RRRERHWKSVIGELYSSTETESDSQEE 109

Query: 91  QDEVGDL---PXXXXXXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRL 147
            D+ GD                RK++K +EKPE  +EVW   +   K PI +Q ++Y+  
Sbjct: 110 DDQEGDQVEHETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNY 169

Query: 148 QTIERRAKRKMEVPLLHVSRVRSSEFSAEIDGYDVV-SRGDETTHFENKHIQLLVTLLHR 206
           + IE+ + RKME+PLLH ++     F     G + + S      +++ +HI  L  LLH 
Sbjct: 170 KKIEKNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHL 229

Query: 207 HISTENWNLAYKVFALLIRMPRVDIRAVWNLGVAILARRDS-TTAIDFLEWMHSVYSNKH 265
           ++S  NW LAYK+FA LIR+P V I+++W +GV IL    + ++++DFL+WM  VYS+K 
Sbjct: 230 NVSRHNWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKS 289

Query: 266 RFIQNVNHR-LPPAFRSGSRTHTAQYTTTWLWLSLRAATEQAQEGAXXXXXXXXXXX--- 321
           RF+QNVN+R + P F++GSRTHT+++  T+LW  L +  +  +                 
Sbjct: 290 RFVQNVNYRSVVPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLE 349

Query: 322 ---DKTSELLLTPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRR 378
              D+ SE +L PP+M+D+EV+FIY SC+ +KAD+LSR   +D  +N         D++ 
Sbjct: 350 ELIDQISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNN--DLVGLNKDIKI 407

Query: 379 NEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQS 432
           N+V+++I   +  L T  +K           + +P   I+ QL+  E RL  ++
Sbjct: 408 NQVIKNIHYVKVFLQTCLDKGG---------FTIPNRLIENQLKSFESRLYGEA 452

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  236 bits (602), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/460 (32%), Positives = 240/460 (52%), Gaps = 42/460 (9%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRI--KIHDENGQLTPESSHTELDDH 58
           MFE+P+ L +   +Q   R+KL+Y+Y N I  ++ RI  K    +   TPE+S  E +D 
Sbjct: 1   MFEVPITLTNRKFAQ---RRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDE 57

Query: 59  E---SXXXXXXXXXXXLYDLRDREEHG-------FESDSSEAQDEVGDLPXXXX------ 102
           E   +               R RE H        + +  SE   +  +            
Sbjct: 58  EEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGID 117

Query: 103 XXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPL 162
                  RK++K +EKPE  +E+W   + + K PI +Q ++Y+  + IE+   RKME+PL
Sbjct: 118 KEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPL 177

Query: 163 LHVSRVRSSEFSAEIDGYD-VVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFA 221
           LH ++     F +   G + + +   E  ++  +HI  L  LLH ++S  NW+LAYK+FA
Sbjct: 178 LHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFA 237

Query: 222 LLIRMPRVDIRAVWNLGVAILAR-RDSTTAIDFLEWMHSVYSNKHRFIQNVNHR-LPPAF 279
            LIR+P V I+++W +GV IL    +S++ +DFL+WM  +YS+K RF+QN+N+R + P F
Sbjct: 238 TLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPF 297

Query: 280 RSGSRTHTAQYTTTWLWLSLRAATEQAQEGAX-------XXXXXXXXXXDKTSELLLTPP 332
           ++GSRTHTA++  T+LW SL    +  +  +                  DK SE +LTPP
Sbjct: 298 QTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPP 357

Query: 333 YMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTL 392
           +M+D+EVWFIY SC+ +KAD LSR   +D  +N         D++ N+V++ I   +  L
Sbjct: 358 FMEDAEVWFIYASCHLLKADTLSRQFVNDNKNN--DLIGLDRDIKINQVIKHIHYVRTFL 415

Query: 393 HTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQS 432
               +K   A         +P+  I+ QL+  E RL  ++
Sbjct: 416 KICLDKGGFA---------VPSRLIENQLKSFESRLYGEA 446

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  214 bits (546), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 239/497 (48%), Gaps = 40/497 (8%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRI---------KIHDENGQLTPESS 51
           MFE P++  S++ S+   R+KL+Y+Y N +K +Y+ +            D +G  TP +S
Sbjct: 1   MFESPII--SYN-SKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNS 57

Query: 52  HTELDDHES---------XXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXX 102
             E  D +                     +      E+            E  D      
Sbjct: 58  AAEASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGY 117

Query: 103 XXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPL 162
                  + ++  +  PE+ YEVW  +   R +PIQR+ +SY+  +TIE+ A +K+   L
Sbjct: 118 LDEKDPEKIFYSKYYVPEETYEVWTTSINNR-IPIQRRSMSYHVFRTIEKYAHKKVAASL 176

Query: 163 LHVSRVRSSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFAL 222
              S+  +  F     GY+   R +  T+++  H+  LV LL+ +I   +++ AY+ F+L
Sbjct: 177 ALSSKKLTGFFEVIRSGYETCPR-ERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSL 235

Query: 223 LIRMPRVDIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSG 282
           LIRM  VD+R++WNLG  IL   +      FLEWM +V ++   F QN  ++L P FRSG
Sbjct: 236 LIRMNFVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFRSG 295

Query: 283 SRTHTAQYTTTWLWLSLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFI 342
           SRTH   +  +WLWL L  A    +E             DK SEL+L PPYMDD+EVWFI
Sbjct: 296 SRTHIPNFVLSWLWLVLENA---VKERVFSSGHDINWLLDKISELVLRPPYMDDAEVWFI 352

Query: 343 YCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQA 402
           Y  CYF+KAD LS  +  + + N      S +D+ RN+V+++I   +  L   EEK    
Sbjct: 353 YAMCYFIKADKLSLQLKQEGSLN--GLKGSQLDIARNQVIENIHHVKNHLRICEEKGG-- 408

Query: 403 RHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADID 462
                  ++ P   I+ QL + EKRL  +S+     + P  YE + L +++  ++   I+
Sbjct: 409 -------FQYPKRVIEAQLVEFEKRLYPESST--HINYPG-YETFPLEESDTEDNLVSIN 458

Query: 463 AFPIEEDNSFLQALDTQ 479
                 D   +Q  + Q
Sbjct: 459 FLQDRFDAQVIQDFNVQ 475

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  213 bits (543), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/457 (31%), Positives = 225/457 (49%), Gaps = 40/457 (8%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIK-IHDENGQL-TPESSHTEL--- 55
           MFELP++  +    +    +KLRY+Y N +  +Y++++   + N  L TPE+S  E    
Sbjct: 1   MFELPLVRNT---KRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASD 57

Query: 56  DDHESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKN 115
            DH S              L        +++ S+ + E G              +++F  
Sbjct: 58  GDHNSADATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGS----HEADQADSEKEFFTR 113

Query: 116 HEKPEDLYEVWHVATERRK-VPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFS 174
           HEKP++ +EVW+  T+R+K VP+    +SY+  + IE+ A++++   + H+S+  +  F 
Sbjct: 114 HEKPQETFEVWN--TDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQ 171

Query: 175 AEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAV 234
           A  DGY+ V+   E+ H    HI  L  LLH +I    W+ AY+ F+LLIR+P +DIR+V
Sbjct: 172 AMKDGYETVAETPESHHL--VHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSV 229

Query: 235 WNLGVAILARRDST-----TAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289
           W  G  IL    S      T+ +FL W+  ++S++  F Q +N  + P FR GS+TH A+
Sbjct: 230 WGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAK 289

Query: 290 YTTTWLWLSLRAATEQAQE---GAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSC 346
           +   WLW  L A+     E                ++ SE++L PPYM+D EVWFI+  C
Sbjct: 290 FVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVC 349

Query: 347 YFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRA 406
           + V AD LS+   S         S    D+ RN+V Q IT     + T E K ++     
Sbjct: 350 HLVSADQLSQRFISTKLRT----SELERDISRNQVTQHITNAHMCIRTCEAKKEE----- 400

Query: 407 HAYWELPTGYIKRQLQQIEKRL---TAQSTPRDQPSS 440
              +  P   I+ QL   EKRL   + +ST  D  S 
Sbjct: 401 ---FSFPRRIIEEQLACFEKRLYQNSGESTASDLGSG 434

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  214 bits (546), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 140/447 (31%), Positives = 231/447 (51%), Gaps = 37/447 (8%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIK-IHDENGQL--------TPESS 51
           MFE P++  S+S+ +S  ++ L+Y+Y + ++ +Y+++  + D + Q         TP++S
Sbjct: 46  MFESPIV--SYSK-RSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNS 102

Query: 52  HTELDDHESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPX------XXXXXX 105
             E  D ++           L   R R +      + +A++  GDL              
Sbjct: 103 AAEASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEE--GDLGSEEEDDLNGGSTA 160

Query: 106 XXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHV 165
               +++F  + KPE  YE+W  + + R VPI+R+ +SY   + IE  + ++M+  L   
Sbjct: 161 KDYEKQFFARYYKPEYTYELWATSPKNR-VPIRRKMLSYQAFKQIENYSNQRMKATLSLS 219

Query: 166 SRVRSSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIR 225
           ++  ++       GY+   + +E T+++  H+  LV LL+ +I +ENW  AY+ FALLIR
Sbjct: 220 TKKAAAYHEVMRLGYETCPK-EEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIR 278

Query: 226 MPRVDIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRT 285
           M  VD+R++WNLG  IL+  +      FLEWM +V+++   F QN  + + P FRSGSR 
Sbjct: 279 MKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRA 338

Query: 286 HTAQYTTTWLWLSLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCS 345
           HT  +   WLWL LR AT    +             +K SEL+L PPYMDD+E+WF+Y  
Sbjct: 339 HTPNFMLAWLWLVLRGAT---ADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAM 395

Query: 346 CYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHR 405
           CYF++AD LS  + S     +H    S +D+ + +V Q I   +  L +  EK +     
Sbjct: 396 CYFIQADKLSAQLASHEGIKLHG---SKLDIAKTQVTQYICSVKNCLESCREKGN----- 447

Query: 406 AHAYWELPTGYIKRQLQQIEKRLTAQS 432
               +  P   I+ QL + E+RL A +
Sbjct: 448 ----FTYPERIIQEQLLEFERRLYAGT 470

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  202 bits (515), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 149/463 (32%), Positives = 223/463 (48%), Gaps = 53/463 (11%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQL--TPESSHTE---- 54
           MFELP+   S   ++    +KLRY+Y N +  +++RI+          TPE+S  E    
Sbjct: 1   MFELPLARNS---NRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASD 57

Query: 55  --LDDHESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKY 112
              D  ++           L  L      G     SE  D V               +++
Sbjct: 58  GDQDSEDAGSRRRRRKRRILSVL------GHIDSESELSD-VDMSTESHHSELQESEKEF 110

Query: 113 FKNHEKPEDLYEVWHVATERRK-VPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSS 171
           F +HEKP+D YE W+  T+RRK V +    +SY   + IE RA+R++   + H SR+  S
Sbjct: 111 FSHHEKPQDTYETWN--TDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARS 168

Query: 172 EFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDI 231
            F++   GY++ SR  +    +  HI  L  LLH ++    W  A++ F++LIR+P VDI
Sbjct: 169 HFNSIKRGYEIYSRPSQV--HQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDI 226

Query: 232 RAVWNLGVAILARRDST-----TAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTH 286
           R++W LGV IL    ST     ++ +FL W+  +Y+++  F   +N  + P FR+GS+ H
Sbjct: 227 RSMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKH 286

Query: 287 TAQYTTTWLWLSLRAAT----EQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFI 342
           TA++ + WLW  L AA     E+ Q              +K SE++L PPYM+D E+WFI
Sbjct: 287 TAKFVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPYMEDPEIWFI 346

Query: 343 YCSCYFVKADILSRNIHSDLTHNVHAFSSST---MDLRRNEVVQSITRCQKTLHTAEEKS 399
           Y  C+ V AD LS+            +S ST    D+ RN+V Q IT     + T E K 
Sbjct: 347 YALCHLVSADELSQRF-------TFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKG 399

Query: 400 DQARHRAHAYWELPTGYIKRQLQQIEKRL---TAQSTPRDQPS 439
           D         +  P   I+ QL   E+RL      ST  +Q S
Sbjct: 400 DD--------FFFPRRIIEEQLAFFERRLYEHVGDSTTSEQDS 434

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  195 bits (495), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 136/447 (30%), Positives = 222/447 (49%), Gaps = 55/447 (12%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDE------------NGQLTP 48
           MF+LPV+      S++  R+K+RY+Y N +K +Y ++  +              NG LTP
Sbjct: 1   MFQLPVI---DRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTP 57

Query: 49  E---SSHTELDDHESXXXXXXXXXXXL---YDLRDREEHGFESDSSEAQDEVGDLPXXXX 102
           E   SS  E  D E            L    D  D E  G E  + E   E         
Sbjct: 58  ENSESSEAEAADLEKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDENDPET-------- 109

Query: 103 XXXXXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPL 162
                   +++++H KP+  +EVW+V T  R  PIQR+ ++YN ++ +E+ A + +   L
Sbjct: 110 --------QFYESHIKPQHTFEVWNVNTALR-TPIQRKKITYNAVKKLEKAATKSVTKKL 160

Query: 163 LHVSRVRSSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFAL 222
            + ++  +  F A   G+DV  +  + +  +  H+  L  LL+ ++  +NW +AY+ F++
Sbjct: 161 NYQTKKLNMYFQALKFGFDVYPKP-QLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSI 219

Query: 223 LIRMPRVDIRAVWNLGVAIL-ARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRS 281
           LIR+  VD+R++W++G  IL +  D+ +   +LEW+  V+ ++ +F Q  N+ L P FR 
Sbjct: 220 LIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRC 279

Query: 282 GSRTHTAQYTTTWLWLSLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWF 341
           GSRTHT  +  TWLW  L  AT  +   A           D+  E++L+PPYMDDSE+W+
Sbjct: 280 GSRTHTPTFVLTWLWTRLFIAT--SGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWY 337

Query: 342 IYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQ 401
           I+   + V A  LS    S    +      S  D+ RN+V+Q I   +  L         
Sbjct: 338 IFGLTHLVMASELS----SKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMC------ 387

Query: 402 ARHRAHAYWELPTGYIKRQLQQIEKRL 428
              +A++ +E P   I+ QL Q+E+ L
Sbjct: 388 ---KANSNYEFPENVIEHQLVQLERSL 411

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  195 bits (496), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/365 (28%), Positives = 195/365 (53%), Gaps = 34/365 (9%)

Query: 111 KYFKNHEKPEDLYEVWHVATE----------RRKVPIQRQFVSYNRLQTIERRAKRKMEV 160
           K+F  +++P++ +EVW+ + +            ++PI R  +S+NRL  +++   +K+E 
Sbjct: 103 KFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEA 162

Query: 161 PLLHVSRVRSSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVF 220
            L H ++   +   A  +GY+   R  +TT F N HI+ L+ LL+ +I  +N+N AY +F
Sbjct: 163 RLQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIF 222

Query: 221 ALLIRMPRVDIRAVWNLGVAILARRDSTT-AIDFLEWMHSVYSNKHRFIQNVNHRLPPAF 279
           +L+IR+P +DIR  WNLG  IL ++ S   +++FL W+HS+YS+  ++  ++N++  PAF
Sbjct: 223 SLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKTAPAF 282

Query: 280 RSGSRTHTAQYTTTWLWLSLRAA-----------TEQAQEGAXXXXXXXXXXXDKTSELL 328
              SR HT ++TT++LW++L               ++  E             +K SE++
Sbjct: 283 TQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLSEMV 342

Query: 329 LTPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRC 388
           L PP+++DSE+W+IY   +     IL+R +  +  +N  + +S   D+ +NE++ +I  C
Sbjct: 343 LAPPFIEDSEIWYIYSLSHL----ILARMLMFETRNNDISQTSVEKDITKNEIISNIQHC 398

Query: 389 QKTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYG 448
           +  L    E  +    +           I+ +L+ +EK+L   S+  +  +     +N  
Sbjct: 399 KSHLQKVRENQNDYNFKFQK--------IEIELKDMEKKLYDTSSDEEILNEEEFLDNED 450

Query: 449 LGDTE 453
           + D E
Sbjct: 451 VLDNE 455

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  186 bits (473), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 130/464 (28%), Positives = 213/464 (45%), Gaps = 73/464 (15%)

Query: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60
           MFELPV   S     +   KKLRY+Y N+I                   + H EL  +E 
Sbjct: 1   MFELPV--SSNITINAFNLKKLRYQYINDIN------------------AKHNELSKNEL 40

Query: 61  XXXXXXXXXXXLYDLRDREEHGFESDSSEAQDE---------VGDLPXXXXXXX------ 105
                        DL    EH   S+ +E   E         +G+               
Sbjct: 41  PTPVTSENDTGGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDV 100

Query: 106 ---------XXXXRKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKR 156
                        +KYF  ++KP++ +E W     +R+  + + F++Y R +   ++  +
Sbjct: 101 DNEFEDNGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDK 160

Query: 157 KMEVPLLHVSRVRSSEFSAEIDGY-----DVVSRGDETTHFENKHIQLLVTLLHRHISTE 211
           K +V  +H+++   + F   IDG+     + +SR     ++   H+ LL  L++ +I  +
Sbjct: 161 KYKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQ 220

Query: 212 NWNLAYKVFALLIRMPRVDIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHR-FIQN 270
            W++AYK F  L+R+P VDIR VWNLG  IL   D+T  IDFL+W+ +VYSNK+R F+Q 
Sbjct: 221 KWDIAYKCFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280

Query: 271 VNHRLPPA-FRSGSRTHTAQYTTTWLW--LSLRAATEQAQEGAXXXXXXXXXXXDKTSEL 327
           +N+R     F  GSR  T  YT T LW  L+L + +E  +              ++ +E+
Sbjct: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCE-------SEIDSLIEQIAEM 333

Query: 328 LLTPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSST----MDLRRNEVVQ 383
           ++ PPY +D+E+W+I+  C+ VKAD LS  ++     N       T     ++  N++  
Sbjct: 334 VVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITI 393

Query: 384 SITRCQKTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKR 427
            I  C+K L  A +  +         ++ P   I+ +L+ IE R
Sbjct: 394 CINNCKKYLRKATQDKN---------FDYPARTIETKLKTIETR 428

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  180 bits (456), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 137/435 (31%), Positives = 221/435 (50%), Gaps = 43/435 (9%)

Query: 1   MFELPVLLGSFSESQSLVR-KKLRYRYRNEIKNQYKRIKIHDENGQL--TPESSHTELDD 57
           MFE+P +    S  +S+V  KKLRY+Y N +   Y+R + +++NGQ   TP SS  E++ 
Sbjct: 1   MFEVPTI---DSTKRSVVNFKKLRYQYMNHM---YERNR-YNKNGQGLPTPVSSENEMNA 53

Query: 58  HESXXXXXXXXXXXLYDLRDREEHGFESDSSEAQDEVGDLPXXXXXXXXXXXRKYFKNHE 117
            E               +R R       +S  + +E  +             +KYF  ++
Sbjct: 54  SEDEVSHKR--------VRKRWRR-IVGESVSSDEEEEEEEEDEQEQEGDEEKKYFSRYD 104

Query: 118 KPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAEI 177
           KPED +E W   T+ RK  I R+ +SY +   + + +++K++VPL+  +R     F + I
Sbjct: 105 KPEDSFERWASNTKHRK-SINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVI 163

Query: 178 DGYDVVSRG-DETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAVWN 236
           DGY+++    +   +F   +++LL  L++  I  ENW +AY+ F LLIR+P+  IR +WN
Sbjct: 164 DGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWN 223

Query: 237 LGVAILARRDSTT-AIDFLEWMHSVYS--NKHRFIQNVNHRLPPAFRSGSRTHTAQYTTT 293
           LG  I+   +     I+FL+  ++++S   K  F Q VN+R  P F  GSR  T  Y  T
Sbjct: 224 LGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKT 283

Query: 294 WLWLSLRAATEQAQEGAXXXXXXXXXXXDKTSELLLTPPYMDDSEVWFIYCSCYFVKADI 353
            LW  +   +  ++  +           +  SEL L PP+M+DSE+W+IY   +  +A+ 
Sbjct: 284 LLWKEITTTSTSSRTSS-----NYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANE 338

Query: 354 LSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELP 413
           LS N+   + +     SSS+ D+  NEVVQ+I   QK L  A+E S           E+P
Sbjct: 339 LSMNLEHYIDN-----SSSSKDIANNEVVQNIKLAQKFLKKAKELSKI---------EVP 384

Query: 414 TGYIKRQLQQIEKRL 428
              I   ++ IE R+
Sbjct: 385 ERQITLMIKNIEGRM 399

>Suva_15.222 Chr15 (385545..387443) [1899 bp, 632 aa] {ON} YHR035W
           (REAL)
          Length = 632

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 397 EKSDQARHRAHAYWELPTGYIKRQLQQIEK 426
           EK  +A H+A +YW  P G +K+QLQ+I K
Sbjct: 159 EKKLRATHQASSYW-FPQGSLKKQLQEIPK 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,956,146
Number of extensions: 1963150
Number of successful extensions: 5628
Number of sequences better than 10.0: 28
Number of HSP's gapped: 5699
Number of HSP's successfully gapped: 28
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)