Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C066405.708ON54754729640.0
Suva_11.3345.708ON54854427050.0
YKR097W (PCK1)5.708ON54954427010.0
Smik_11.3615.708ON54954426970.0
Skud_11.3375.708ON54954426890.0
NDAI0E050805.708ON55153626440.0
CAGL0H06633g5.708ON54454726270.0
NCAS0A031605.708ON55253626190.0
TDEL0B021205.708ON54854426010.0
SAKL0E15048g5.708ON54253425190.0
KLLA0A00484g5.708ON54353525130.0
KAFR0H001605.708ON54954725050.0
ZYRO0B16456g5.708ON54854424860.0
Ecym_40135.708ON54253424440.0
AFR292W5.708ON54153024020.0
KLTH0E00902g5.708ON54453523830.0
Kwal_55.196635.708ON54454323400.0
TBLA0E017005.708ON57654123270.0
TPHA0E001705.708ON57852523180.0
Kpol_1043.755.708ON55851822750.0
Suva_7.275singletonON961131484e-11
SAKL0B05126g8.762ON706119751.8
NDAI0A005601.67ON71495741.9
KAFR0C052205.500ON149939707.2
NCAS0F00410singletonON1531157707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06640
         (547 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1146   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1046   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1045   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1043   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1040   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...  1023   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...  1016   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...  1013   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...  1006   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   974   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   972   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   969   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   962   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   946   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   929   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   922   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   905   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   900   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   897   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   880   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    62   4e-11
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    33   1.8  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    33   1.9  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    32   7.2  
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                32   7.6  

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/547 (100%), Positives = 547/547 (100%)

Query: 1   MPSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALI 60
           MPSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALI
Sbjct: 1   MPSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALI 60

Query: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120
           AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV
Sbjct: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120

Query: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180
           DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH
Sbjct: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180

Query: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240
           TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK
Sbjct: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240

Query: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300
           NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE
Sbjct: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300

Query: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360
           IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII
Sbjct: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360

Query: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420
           LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP
Sbjct: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420

Query: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480
           IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE
Sbjct: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480

Query: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540
           SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV
Sbjct: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540

Query: 541 LAAGPIL 547
           LAAGPIL
Sbjct: 541 LAAGPIL 547

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/544 (90%), Positives = 517/544 (95%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK N+ A     VEQKIR+EL LS EV TIRRNAPAAVLYED L E+KTVI+SSGALIA
Sbjct: 3   PSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGIKN
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKN 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           FDAIRFG+VLENV YDE SH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 303 FDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLA KMS+H+ANAYLINTGWTGSSYVSGG RC LKYTRAILD+IHDGSLA+A+YES
Sbjct: 423 RYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYES 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LPIFNL+VPT VNGVP ELLNPAKNW+QGEAKY GAV+NLA+LFVENFKIYQD+ATPDVL
Sbjct: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/544 (89%), Positives = 515/544 (94%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK N+       VEQKIR+EL LS EV TIRRNAPAAVLYED L E KTVI+SSGALIA
Sbjct: 3   PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+N
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           FDAI+FGSVLENV YDEKSH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 303 FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLA KMS+HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA   YE+
Sbjct: 423 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LPIFNL+VPT VNGVP ELLNPAKNW+QGE+KY GAV+NLA+LFV+NFKIYQD+ATPDVL
Sbjct: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/544 (89%), Positives = 514/544 (94%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK N        VEQKIR+EL LS EV TIRRNAPAAVLYED L E+KTVI+SSGALIA
Sbjct: 3   PSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+N
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           FDAI+FG+VLENV YDEKSH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 303 FDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLAAKMS+HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA   YES
Sbjct: 423 RYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYES 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LPIFNL+VPT V GVP ELLNPAKNW+QGE KY GAV++LA+LFVENFKIYQD+ATPDVL
Sbjct: 483 LPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPDVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/544 (89%), Positives = 514/544 (94%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK ++       VEQKIR+EL LS EV TIRRNAPAAVLYED L E+KTVI+SSGALIA
Sbjct: 3   PSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 63  YSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+N
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           FDAI+FG+VLENV YDEKSH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 303 FDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLA KMS HK+NAYLINTGW+GSSYVSGGKRCPLKYTRAILD+IHDGSLA   YES
Sbjct: 423 RYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYES 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LPIFNL+VPT V GVP ELLNPAKNW+QGEAKY G+V+NLA+LFVENFKIYQD+ATPDVL
Sbjct: 483 LPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPDVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/536 (88%), Positives = 512/536 (95%)

Query: 10  TDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGR 69
           TD+  VEQKIR+EL+LSK+V TIRRNAPAA+LYEDALHER T+I+S+GAL+AYSGEKTGR
Sbjct: 14  TDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGR 73

Query: 70  SPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPK 129
           SP+DKRIVEEETSKD++WWGPVNKPCSERTW INRERAADYLRTRDHLYIVDAFAGWDP+
Sbjct: 74  SPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPE 133

Query: 130 YRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKST 189
           YRIKVRVVCARAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HTQDMSSK+T
Sbjct: 134 YRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTT 193

Query: 190 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFG 249
           IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI+NGDVTLFFG
Sbjct: 194 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFG 253

Query: 250 LSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGS 309
           LSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPEIF+AI++GS
Sbjct: 254 LSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGS 313

Query: 310 VLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 369
           +LENV YD K+  V YDDST+TENTRCAYPIE+IPSAKIPCLAD+HP NIILLTCDASGV
Sbjct: 314 ILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGV 373

Query: 370 LPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAA 429
           LPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYA MLA 
Sbjct: 374 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAK 433

Query: 430 KMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEV 489
           K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA+  +E+LP+FNL+V
Sbjct: 434 KISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQV 493

Query: 490 PTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545
           PT VN VP ELLNPAKNWAQGEAKYN AVSNLASLFVENFKIYQDKATP+VLAA P
Sbjct: 494 PTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAP 549

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/547 (87%), Positives = 511/547 (93%), Gaps = 3/547 (0%)

Query: 1   MPSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALI 60
           MPSKS+ +     SVE++IR EL LSKEV  IRRNAPAAVLY+DAL E+KTVI+S+GALI
Sbjct: 1   MPSKSSVSGN---SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALI 57

Query: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120
           AYSGEKTGRSPKDKRIVEEETS+DNVWWGPVNKPCSERTW INRERAADYLRTR+ LY+V
Sbjct: 58  AYSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVV 117

Query: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180
           DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELANFGEPDFTVWNAGQFPAN  
Sbjct: 118 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANAR 177

Query: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240
           TQDM+SK+TIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGIK
Sbjct: 178 TQDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIK 237

Query: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300
           NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPE
Sbjct: 238 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPE 297

Query: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360
           IFDAIRFGSVLENV YD +SHEVDYDDS+ITENTRCAYPI++IPSAKIPCLA +HPKNII
Sbjct: 298 IFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNII 357

Query: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420
           LLTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP
Sbjct: 358 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHP 417

Query: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480
           +RYA MLA KM EH ANA+LINTGWTGSSYVSGGKRC LKYTRAILDAIHDGSLA+A +E
Sbjct: 418 MRYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFE 477

Query: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540
           SLPIFNL+VP AV GVP ELLNPA+NW++GEAKY  AVS LA LFVENFK YQDKAT DV
Sbjct: 478 SLPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDV 537

Query: 541 LAAGPIL 547
           LAAGP L
Sbjct: 538 LAAGPQL 544

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/536 (87%), Positives = 510/536 (95%)

Query: 10  TDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGR 69
           +D+  VEQ IR+EL LS++V TIRRNAPAAVLYEDALHERKTVIASSGALIAYSG KTGR
Sbjct: 15  SDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGR 74

Query: 70  SPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPK 129
           SP+DKRIVEEETSKDNVWWGPVNKPCSE+TW INRERAADYLRTRDHLYIVDAFAGWDPK
Sbjct: 75  SPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPK 134

Query: 130 YRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKST 189
           YRIKVRVVCARAYHA+FMTNMLIRP++EELA FGEPDFT+WNAGQFPAN +TQDMSSK+T
Sbjct: 135 YRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTT 194

Query: 190 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFG 249
           IEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI+NGDVTLFFG
Sbjct: 195 IEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFG 254

Query: 250 LSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGS 309
           LSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEIF+AI++GS
Sbjct: 255 LSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGS 314

Query: 310 VLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 369
           +LENV YD+ +  VDYDD++ITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV
Sbjct: 315 ILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 374

Query: 370 LPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAA 429
           LPPV+KL+PEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFLALHPIRYA MLA 
Sbjct: 375 LPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAE 434

Query: 430 KMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEV 489
           K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA+ +YE+LPIFNL V
Sbjct: 435 KISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSV 494

Query: 490 PTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545
           PTAVNGVP E+LNPAKNW++GEAKY+ AVS L SLFVENFK YQD+ATPDVLAAGP
Sbjct: 495 PTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/544 (85%), Positives = 509/544 (93%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK N + TD   VEQKIR EL+LS EVITIRRNAPAA+LYEDAL+E+KT IASSGALIA
Sbjct: 3   PSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG+KTGRSPKDKRI+EEETSKDN+WWGPVNKP  E+TW INRERAADYLRTR HLYIVD
Sbjct: 63  YSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVD 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           AFAGWDP+YRIKVRVVCARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN HT
Sbjct: 123 AFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           Q MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+ 
Sbjct: 183 QGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQK 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
            DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+AEKEPEI
Sbjct: 243 NDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           ++AI+FGS+LENV YD K+ +VDY+DS+ITENTRCAYPIE+IPSAKIPCLADSHP+N++L
Sbjct: 303 YNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPP++KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI
Sbjct: 363 LTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPI 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLA KMSEH+ANA+LINTGWTGSSYV+GGKRCPLKYTRAILDAIHDGSLA+ +YE+
Sbjct: 423 RYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYET 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LP FNL +PT VNGVP ELLNP+KNW +GEAKYN AV+NLA LFVENFKIYQD+ATP+VL
Sbjct: 483 LPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/534 (84%), Positives = 494/534 (92%)

Query: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73
           S EQ+IR EL+LS EV+TIRRNAPAA+LYEDAL ERKT I+SSGALIAYSGEKTGRSP+D
Sbjct: 9   SAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRD 68

Query: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133
           KRIV+E TS DNVWWGPVNK CSERTW+INRERAADYLRTRDHLYIVDA+AGWDP+YRIK
Sbjct: 69  KRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIK 128

Query: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193
           VRVVCARAYHALFMTNMLIRP+++ELA FGEPDFTVWNAGQFPAN HT  M+SK+T+EIN
Sbjct: 129 VRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEIN 188

Query: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253
           FK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI + DVTLFFGLSGT
Sbjct: 189 FKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGT 248

Query: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313
           GKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEPEI++AI+FGSVLEN
Sbjct: 249 GKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLEN 308

Query: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373
           V Y+ ++ EVDY+DS+ITENTRCAYPI+YIPSAKIPCLAD+HP NI+LLTCDASGVLPPV
Sbjct: 309 VIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPV 368

Query: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433
           ++L+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KM++
Sbjct: 369 SRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAK 428

Query: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493
           H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA+  YE+LP FNLE+PT V
Sbjct: 429 HNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRV 488

Query: 494 NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
           N VP ELLNPAKNW +GEAKY  AV NLA LFVENFK YQD+AT  VL+AGP L
Sbjct: 489 NNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/535 (84%), Positives = 494/535 (92%), Gaps = 1/535 (0%)

Query: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73
           S E+ IR EL LS EV+TIRRNAPAA+LYEDAL ER T I+++GALIAYSG+KTGRSP+D
Sbjct: 9   SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGDKTGRSPRD 68

Query: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133
           KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDH+YIVDA+AGWDP+YRIK
Sbjct: 69  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAGWDPRYRIK 128

Query: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193
           VRVVCARAYHALFMTNMLIRPSKEEL NFGEPDFTVWNAGQFPAN HT  M+SK+T+EIN
Sbjct: 129 VRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMTSKTTVEIN 188

Query: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253
           FK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI++ DVTLFFGLSGT
Sbjct: 189 FKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVTLFFGLSGT 248

Query: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313
           GKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LSAEKEPEIF+AI+FGSVLEN
Sbjct: 249 GKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLEN 308

Query: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373
           + YD  + EVDY+DSTITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTCDASGVLPPV
Sbjct: 309 IIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPV 368

Query: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433
           +KL+P+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP++YA MLA KM+E
Sbjct: 369 SKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAE 428

Query: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493
           H ANA+LINTGWTGSSYV+GGKRCPLKYTRAILDAIHDGSLA+  YE LPIFNL++P AV
Sbjct: 429 HNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAV 488

Query: 494 -NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
            + VP  LLNP+KNWA+GEAKY   V +LA+LFVENFK YQDKAT  VLAAGP L
Sbjct: 489 GDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAGPQL 543

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/547 (81%), Positives = 502/547 (91%), Gaps = 1/547 (0%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALH-ERKTVIASSGALI 60
           PSK  +   D  +VEQKIR+EL+LS  V TIRRNAP +VLYEDAL  E+ T+I+S+GALI
Sbjct: 3   PSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALI 62

Query: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120
           AYSGEKTGR PKDKRIVEE  SK+++WWGPVNKPCSERTWEINRERAADYLRTR+H+YIV
Sbjct: 63  AYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIV 122

Query: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180
           DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP+K+EL NFG+PDFTVWNAGQFPAN H
Sbjct: 123 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFH 182

Query: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240
           T+DMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+GI+
Sbjct: 183 TEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIE 242

Query: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300
             DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPE
Sbjct: 243 KKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPE 302

Query: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360
           IF++I+FGS+LENV YD KS EVDYDDS+ITENTRCAYPIE+IPSAKIPC+A+SHPKNII
Sbjct: 303 IFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNII 362

Query: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420
           LLTCDASGVLPPV+KL+ +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLALHP
Sbjct: 363 LLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHP 422

Query: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480
           ++YA MLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILDAIHDGSL + ++E
Sbjct: 423 MKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFE 482

Query: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540
           +LPIFNL+VP  VN VP +LLNP+KNW +GE KY+GAV  L+ LF+ENFK Y+DKAT +V
Sbjct: 483 TLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEV 542

Query: 541 LAAGPIL 547
           LAAGP L
Sbjct: 543 LAAGPRL 549

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/544 (81%), Positives = 489/544 (89%)

Query: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61
           PSK     TD   VE++IR+EL L  EV+TIR NAPAA LYED L E+KT + SSGAL A
Sbjct: 3   PSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAA 62

Query: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121
           YSG KTGRSPKDKRI+EEETSK+ VWWGPVNKP SE+TW INRERAADYLRTRDHLYI+D
Sbjct: 63  YSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIID 122

Query: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181
           A+AGWDP+YRIKVRV+CARAYHALFMTNMLIRPS EELANFGEPDFTVWNAGQFPAN +T
Sbjct: 123 AYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNT 182

Query: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241
           + M+SK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+ 
Sbjct: 183 EGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIER 242

Query: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301
           GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+AEKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEI 302

Query: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361
           ++AI+FGSVLENV +D  + EVDY D++ITENTRCAYPI+YIPSAKIPCLAD HP NI+L
Sbjct: 303 YNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVL 362

Query: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP+
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPM 422

Query: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481
           RYA MLA KM +H ANA+L+NTGWTGSSY +GGKRCPLKYTRAILD+IHDGSL++A+YE+
Sbjct: 423 RYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYET 482

Query: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541
           LPIFNL  P  VNGVP  LLNPAK+W +G  KYN AV  LA+ F ENFKIYQD+ATPDVL
Sbjct: 483 LPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVL 542

Query: 542 AAGP 545
           AAGP
Sbjct: 543 AAGP 546

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/534 (82%), Positives = 487/534 (91%)

Query: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73
           S E+KIR EL LS  V+ IRRNAPAA+LYEDAL ER T I+S+GALIAYSGEKTGRSPKD
Sbjct: 9   SPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKD 68

Query: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133
           KRIV+E TS + VWWGPVN+  SERTW+INRERA DYLRTR+HLYIVDAFAGWDP+YRIK
Sbjct: 69  KRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIK 128

Query: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193
           +R+VC RAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HT+ MSSK+T+EIN
Sbjct: 129 IRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEIN 188

Query: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253
           FKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI  GDVTLFFGLSGT
Sbjct: 189 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGT 248

Query: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313
           GKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEPEIF+AIR+GSVLEN
Sbjct: 249 GKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLEN 308

Query: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373
           V Y+  S  VDYDDS+ITENTRCAYPIEYIPSAKIPCL++SHP NI+LLTCDASGVLPPV
Sbjct: 309 VVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPV 368

Query: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433
           +KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KMS+
Sbjct: 369 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQ 428

Query: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493
           H ANA+LINTGWTG+SYVSGGKRCPLKYTRAILDAIH GSLA A+YE+LP+F L +P AV
Sbjct: 429 HNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAV 488

Query: 494 NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
            GVP ELLNP++NW +GE KY+ AV++LA+LFV+NFKIYQD+AT +VL AGP L
Sbjct: 489 EGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/530 (81%), Positives = 481/530 (90%), Gaps = 1/530 (0%)

Query: 16  EQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKR 75
           E+KIR EL LS  V+TIRRNAPAAVLYEDAL ERKT I+S+GALIAYSGEKTGRSPKDKR
Sbjct: 11  EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKR 70

Query: 76  IVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVR 135
           IV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTR+HLYIVDA+AGWDP+YRIK+R
Sbjct: 71  IVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIR 130

Query: 136 VVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFK 195
           +VC RAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HT+ MSSK+T+EINF+
Sbjct: 131 IVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFR 190

Query: 196 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGK 255
           AMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG  N DVTLFFGLSGTGK
Sbjct: 191 AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGK 249

Query: 256 TTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVA 315
           TTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AI++GSVLENV 
Sbjct: 250 TTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVV 309

Query: 316 YDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAK 375
           YD  +  VDY+DS+ITENTRCAYPIEYIPSA+IPCL+++HP NI+LLTCDASGVLPPV++
Sbjct: 310 YDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSR 369

Query: 376 LSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHK 435
           L+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KMS+H 
Sbjct: 370 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 429

Query: 436 ANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNG 495
           A+A+LINTGWTGSSY +GGKRCPLKYTRAILD+IHDG+LAQA YE+LP+F L +P AV G
Sbjct: 430 ASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEG 489

Query: 496 VPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545
           VP ELLNPAKNW +GE KY  AVS LAS F ENFKIYQD+AT +V+ AGP
Sbjct: 490 VPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/535 (79%), Positives = 477/535 (89%)

Query: 13  ISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPK 72
           +S +  IR+EL L +EV+TIRRNAPAA+LYEDAL E KT IASSGALIA+SG KTGRSPK
Sbjct: 10  VSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPK 69

Query: 73  DKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRI 132
           DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTRDHLYIVDA+AGWDP+YRI
Sbjct: 70  DKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRI 129

Query: 133 KVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEI 192
           K+RVVCARAYHALFMTNMLIRP+KEEL NFGEPDFTVWNAGQFPAN HT  M+SK+T+EI
Sbjct: 130 KIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEI 189

Query: 193 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSG 252
           NF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI++ DVTLFFGLSG
Sbjct: 190 NFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSG 249

Query: 253 TGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLE 312
           TGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AI+FGSVLE
Sbjct: 250 TGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLE 309

Query: 313 NVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPP 372
           NVAYD  +  VDY+D  ITENTRCAYPIEYIPSAKIPCLA+SHPKNI+LLTCDASGVLPP
Sbjct: 310 NVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPP 369

Query: 373 VAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMS 432
           V+KL+P QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALHP++YA MLA KMS
Sbjct: 370 VSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMS 429

Query: 433 EHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTA 492
           +H+ANA+LINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLAQ ++E+LP F L VP  
Sbjct: 430 QHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRH 489

Query: 493 VNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
           VN VP  +LNPAKNW +GE KY   V  LA LF ENFK YQD+A+ DV++AGP+L
Sbjct: 490 VNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/543 (76%), Positives = 477/543 (87%)

Query: 5   SNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSG 64
           S S   + +SV+ +IR+EL L +EV+TIRRNAPAA+LYEDAL E KT I++SGALIA+SG
Sbjct: 2   SPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSG 61

Query: 65  EKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFA 124
            KTGRSPKDKRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTRDHLYIVDA+A
Sbjct: 62  SKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYA 121

Query: 125 GWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDM 184
           GWDP+YRIK+RVVCARAYHALFMTNMLI+P+ +EL  FGEPDFTVWNAGQFPAN HT  M
Sbjct: 122 GWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGM 181

Query: 185 SSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDV 244
           +SK+TIEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI++ DV
Sbjct: 182 TSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDV 241

Query: 245 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDA 304
           TLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+A
Sbjct: 242 TLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNA 301

Query: 305 IRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTC 364
           IRFGSVLENVAYD  + EVD+++  ITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTC
Sbjct: 302 IRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTC 361

Query: 365 DASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYA 424
           DASGVLPPV+KL+PEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALHP++YA
Sbjct: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYA 421

Query: 425 KMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPI 484
            MLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILDAIHDG+LA+  YE+LP 
Sbjct: 422 TMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPT 481

Query: 485 FNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAG 544
           FNL +P  VN VP  +LNPA++W  GEAKY   V  LA+LFVENFK Y+  A+ +++ AG
Sbjct: 482 FNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAG 541

Query: 545 PIL 547
           P+L
Sbjct: 542 PLL 544

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/541 (77%), Positives = 479/541 (88%), Gaps = 8/541 (1%)

Query: 13  ISVEQKIRRELNL--SKE--VITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTG 68
           +S+E ++  +LN   SK+  +I I+ N  AA+LYEDAL E KTVI+SSGALIAYSG KTG
Sbjct: 34  LSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTG 93

Query: 69  RSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDP 128
           RSPKDKRIV E+ SKDNVWWGPVNKPCSE+TW+INRER  DYL TR +LY++DA+ GWDP
Sbjct: 94  RSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDP 153

Query: 129 KYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKS 188
           +YR+KVRVVCARAYHALFMTNMLIRP++EEL NF EPDFTVWNAG F AN +T DM+SK+
Sbjct: 154 RYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKT 213

Query: 189 TIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFF 248
           ++EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GI+  DVT+FF
Sbjct: 214 SVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFF 273

Query: 249 GLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFG 308
           GLSGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFDAIRFG
Sbjct: 274 GLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFG 333

Query: 309 SVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASG 368
           SVLENV Y+E +H+VDY+D  ITENTRCAYPI+YI SAKIPCLA+SHPKN+ILLTCDASG
Sbjct: 334 SVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASG 393

Query: 369 VLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLA 428
           VLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHPI YA MLA
Sbjct: 394 VLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLA 453

Query: 429 AKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLE 488
            KM ++K+NA+LINTGWTGSSY +GG RCPLKYTRAILDAIHDG+LA  NYE+LP+FNL+
Sbjct: 454 KKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQ 513

Query: 489 VPTAVNGVPHELLNPAKNWAQGEAK----YNGAVSNLASLFVENFKIYQDKATPDVLAAG 544
           +PT VNGVP+E+LNP  +W     K    YN AV+ LA+LFVENFKIYQDKAT DVLAAG
Sbjct: 514 IPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAG 573

Query: 545 P 545
           P
Sbjct: 574 P 574

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/525 (78%), Positives = 457/525 (87%), Gaps = 1/525 (0%)

Query: 24  NLSK-EVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKRIVEEETS 82
           NLS  ++I I+RN P A LYED L E KT ++S+GALIAYSG KTGRSPKDKRIVEEE S
Sbjct: 54  NLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELS 113

Query: 83  KDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAY 142
           KDN+WWGPVNK CSERTW INRERA DYL TRD LY++DAF GWDP+YRIK+RVVCARAY
Sbjct: 114 KDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAY 173

Query: 143 HALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFKAMEMVIL 202
           HALFM NMLIRP+KEEL NFG+PDFTVWNAGQF AN  T DMSSK+++EINFK MEM IL
Sbjct: 174 HALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTIL 233

Query: 203 GTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADP 262
           GTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ   NGDVTLFFGLSGTGKTTLSADP
Sbjct: 234 GTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADP 293

Query: 263 HRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVAYDEKSHE 322
           HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IF+AI+FGSVLEN  YDE++HE
Sbjct: 294 HRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHE 353

Query: 323 VDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAKLSPEQVM 382
           VDYD+STITENTRCAYPI+YI +AKIPCLAD HP N+ILLTCDASGVLPPV+KL+PEQVM
Sbjct: 354 VDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVM 413

Query: 383 YHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHKANAYLIN 442
           YHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA MLA KM +HKANA+L+N
Sbjct: 414 YHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLN 473

Query: 443 TGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNGVPHELLN 502
           TGWTGSSYVSGG RCPLKYTRAILDAIHDGSL    YE+LPIFNL++P   NGVP ELLN
Sbjct: 474 TGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLN 533

Query: 503 PAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
           PA +W      Y  AV  L  LF ENFK Y+DKAT +V+ AGP+L
Sbjct: 534 PAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/518 (78%), Positives = 454/518 (87%)

Query: 30  ITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKRIVEEETSKDNVWWG 89
           ITI+RN P A LYED L E  T ++S+GAL+AYSG KTGRSPKDKRIVEE +SKDN+WWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 90  PVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAYHALFMTN 149
           PVNKPCSE TW INRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 150 MLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFKAMEMVILGTEYAGE 209
           MLIRP+ EEL NFGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEMVILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 210 MKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGD 269
           MKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 270 DEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVAYDEKSHEVDYDDST 329
           DEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI+FGSVLEN  YDE +H VDYDDS 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 330 ITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAKLSPEQVMYHFISGY 389
           ITENTRCAYPI++I SAKIPCL D HP N+ILLTCDASGVLPPV+KL+PEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 390 TSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHKANAYLINTGWTGSS 449
           TSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA+MLA KM+ HKA+A+LINTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 450 YVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNGVPHELLNPAKNWAQ 509
           Y +GGKRCPLKYTRAILDAIH+GSLA   YE+LP+FNL +P  V  VP ELLNP+K W+ 
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 510 GEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547
            +  Y+ AV  L SLFV+NF IYQD+AT DV+AAGP L
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 56/113 (49%), Gaps = 22/113 (19%)

Query: 376 LSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHK 435
           L+ E+VMYHF SG+ S   G                 +PFLALHPI Y  ++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 436 ANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQA-----NYESLP 483
            +AYLINTG+             LK TR   D+IHD SLA+       Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 63  SGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWE-INRERAADYL---------R 112
           +  K GR  +DK I++++    N+ W   N+P  ++T+  ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 113 TRDHLYIVDAFAGWDPKYRIKVRV---VCARAYHA--LFMTNMLIRPSKEELANFGEPD 166
             + L  +      + KY   + +   V  R  H    F   +L + S EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 13/95 (13%)

Query: 236 NQGIKNGDVTLFFGLSGTGKTTLSADPHRLL-IGDDEHCWSDQGVFNIEGGCYAKCINLS 294
           N  I  G+     G SG+GK+T+++   R   + +      D  + N     Y + I  +
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 295 AEKEPEIFDAIRFGSVLENVAY-------DEKSHE 322
            ++EP +F+    GS+L+N+ Y        EK HE
Sbjct: 526 VQQEPSLFN----GSILDNIIYAIPPELTSEKQHE 556

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 220 YLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGKTTL 258
           Y +P+ H    L  + +  +K G +T   G SG GKTTL
Sbjct: 858 YDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 180 HTQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIF--TVMFYLMPVHHNVLTLHSSANQ 237
           +T + S  ++  IN+  ME     +E      + IF    + Y +P+   +  + ++ + 
Sbjct: 837 NTTEKSILNSSSINYDDME-----SEVGLSKSEAIFHWRNLCYEIPIKKEIRHILNNIDG 891

Query: 238 GIKNGDVTLFFGLSGTGKTT-LSADPHRLLIGDD------EHCWSDQGVFNIEGGCYAKC 290
            +K G +T   G SG GKTT L     R+ +G          C  D+      G C  + 
Sbjct: 892 WVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSIGYCQQQD 951

Query: 291 INLSAEKEPEIFDAIRFGSVLE---NVAYDEKSHEVD 324
           ++L   K   + +++RF + L    +V  +EK+  V+
Sbjct: 952 LHL---KTSTVRESLRFSAYLRQPFDVPVEEKNKYVE 985

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,038,328
Number of extensions: 2546870
Number of successful extensions: 6728
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6850
Number of HSP's successfully gapped: 30
Length of query: 547
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 432
Effective length of database: 40,294,809
Effective search space: 17407357488
Effective search space used: 17407357488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)