Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C066305.706ON1281128162240.0
KAFR0H001805.706ON1241102032650.0
ZYRO0B16412g5.706ON1372101629340.0
TDEL0B021405.706ON114799928660.0
NCAS0A031705.706ON1319106628520.0
Skud_11.3365.706ON1188102727130.0
Kpol_1043.735.706ON1260100726910.0
SAKL0E15004g5.706ON1196100726840.0
YKR096W5.706ON1195102226490.0
KLTH0E00968g5.706ON1148100425690.0
CAGL0G02541g5.706ON1295102425630.0
Kwal_55.196785.706ON1178100125610.0
TPHA0E001905.706ON1361101924960.0
Suva_9.375.706ON1117102224340.0
Skud_9.175.706ON1118101424190.0
Smik_9.185.706ON1118101424080.0
AFR290W5.706ON1217100924000.0
Ecym_40155.706ON1257102123680.0
KLLA0A00528g5.706ON1229101122760.0
Smik_11.3605.706ON118074022530.0
Suva_11.3335.706ON118776021760.0
YIL151C5.706ON111872419560.0
CAGL0H06611g5.706ON128272918180.0
NDAI0E050705.706ON155638213281e-158
TBLA0E017105.706ON152641310741e-123
TPHA0D046405.706ON9626112097e-16
Smik_10.371.137ON124760755.1
TBLA0D002902.116ON621145736.8
YHR206W (SKN7)4.385ON62243737.0
Skud_4.5945.370ON143759737.3
Smik_8.2964.385ON62543737.4
Skud_8.2734.385ON62343737.5
Suva_15.4124.385ON61743737.9
Kpol_265.24.385ON54970728.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06630
         (1281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  2402   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1262   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1134   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1108   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1103   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1049   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1041   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1038   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1025   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   994   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   991   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   991   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   966   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   942   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   936   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   932   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   929   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   916   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   881   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   872   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   842   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   758   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   704   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   516   e-158
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   418   e-123
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    85   7e-16
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    33   5.1  
TBLA0D00290 Chr4 (67816..69681) [1866 bp, 621 aa] {ON} Anc_2.116       33   6.8  
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    33   7.0  
Skud_4.594 Chr4 complement(1056682..1060995) [4314 bp, 1437 aa] ...    33   7.3  
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    33   7.4  
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    33   7.5  
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    33   7.9  
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    32   8.5  

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 2402 bits (6224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1167/1281 (91%), Positives = 1167/1281 (91%)

Query: 1    MPQLLAAQLIPXXXXXXXXXXXXXXXXXXXXXXFVHQQNNSVIFPRDSKKTLDGISCIIA 60
            MPQLLAAQLIP                      FVHQQNNSVIFPRDSKKTLDGISCIIA
Sbjct: 1    MPQLLAAQLIPNNSTGNNNNSNSNVRNNGSASGFVHQQNNSVIFPRDSKKTLDGISCIIA 60

Query: 61   SVEKEMEAHCQGDDGANHSGQKRHGSASYSFANANFPSKRRIANAEEDSKRISSYSDNLL 120
            SVEKEMEAHCQGDDGANHSGQKRHGSASYSFANANFPSKRRIANAEEDSKRISSYSDNLL
Sbjct: 61   SVEKEMEAHCQGDDGANHSGQKRHGSASYSFANANFPSKRRIANAEEDSKRISSYSDNLL 120

Query: 121  LQQNTPRRSRDVARKXXXXXXXXXXXXXXXXXXPQESPFCMEFTSLANVDPLPTTGGAAT 180
            LQQNTPRRSRDVARK                  PQESPFCMEFTSLANVDPLPTTGGAAT
Sbjct: 121  LQQNTPRRSRDVARKSASGSASGCRSASGSGSAPQESPFCMEFTSLANVDPLPTTGGAAT 180

Query: 181  GVNTPGGLGVDNISSGKQTVFIDKSIGATHRYATETQQGEIDNNGEGEVXXXXXXXXXXX 240
            GVNTPGGLGVDNISSGKQTVFIDKSIGATHRYATETQQGEIDNNGEGEV           
Sbjct: 181  GVNTPGGLGVDNISSGKQTVFIDKSIGATHRYATETQQGEIDNNGEGEVAGNNDNADNDG 240

Query: 241  LPTXXXXXXXXXXXXXXXXXXXXXXXXXXXYPADQSDAQNTSVTRKSSQALVQKLQDIYK 300
            LPT                           YPADQSDAQNTSVTRKSSQALVQKLQDIYK
Sbjct: 241  LPTNGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNTSVTRKSSQALVQKLQDIYK 300

Query: 301  VIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALLPSQPAQDILX 360
            VIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALLPSQPAQDIL 
Sbjct: 301  VIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALLPSQPAQDILI 360

Query: 361  XXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSAILIDIPPKH 420
                         LWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSAILIDIPPKH
Sbjct: 361  GEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSAILIDIPPKH 420

Query: 421  AIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLE 480
            AIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLE
Sbjct: 421  AIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLE 480

Query: 481  AFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLIDYLKHSEVMLL 540
            AFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLIDYLKHSEVMLL
Sbjct: 481  AFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLIDYLKHSEVMLL 540

Query: 541  PSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRHAPAFAESHIL 600
            PSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRHAPAFAESHIL
Sbjct: 541  PSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRHAPAFAESHIL 600

Query: 601  QLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVSSTAPKTVDDQATDNVNE 660
            QLVGFGNPKNPFALLFELPKYL              TSTADVSSTAPKTVDDQATDNVNE
Sbjct: 601  QLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSSTAPKTVDDQATDNVNE 660

Query: 661  GTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSLDFINMTSLKCSMIVLKKFLH 720
            GTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSLDFINMTSLKCSMIVLKKFLH
Sbjct: 661  GTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSLDFINMTSLKCSMIVLKKFLH 720

Query: 721  GPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYV 780
            GPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYV
Sbjct: 721  GPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYV 780

Query: 781  LDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADT 840
            LDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADT
Sbjct: 781  LDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADT 840

Query: 841  FAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAG 900
            FAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAG
Sbjct: 841  FAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAG 900

Query: 901  VYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGE 960
            VYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGE
Sbjct: 901  VYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGE 960

Query: 961  NIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDL 1020
            NIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGE        TDNNAVSEGQGDL
Sbjct: 961  NIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDL 1020

Query: 1021 AANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSY 1080
            AANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSY
Sbjct: 1021 AANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSY 1080

Query: 1081 LVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK 1140
            LVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK
Sbjct: 1081 LVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK 1140

Query: 1141 SKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVI 1200
            SKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVI
Sbjct: 1141 SKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVI 1200

Query: 1201 EAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTF 1260
            EAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTF
Sbjct: 1201 EAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTF 1260

Query: 1261 STDFVFSLCSKLGMSLDLCTN 1281
            STDFVFSLCSKLGMSLDLCTN
Sbjct: 1261 STDFVFSLCSKLGMSLDLCTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1262 bits (3265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/1020 (61%), Positives = 764/1020 (74%), Gaps = 65/1020 (6%)

Query: 278  AQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDL 337
             + TSVT+K+S+ L++KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTTELKNLW+IYK+NTDL
Sbjct: 271  VEETSVTKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDL 330

Query: 338  INNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEV 397
            INNY TFITTALLPSQ  QDI               LWVYGTITFLDVLKNFSNFMDPEV
Sbjct: 331  INNYITFITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 390

Query: 398  CSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA 457
            CSQFITHVFISLS +LID+PPKH+IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA
Sbjct: 391  CSQFITHVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA 450

Query: 458  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR 517
            MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR
Sbjct: 451  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR 510

Query: 518  NTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMF 577
            N  GN RN DLIDYLKHSEVMLLPSFL ++DLQQVVLNYF DRFG+DY++NNIF+TQDMF
Sbjct: 511  NKNGNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570

Query: 578  FQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXT 637
            FQ P+ LRF+FRHAPAFAESHILQLVGFGNPKNPFALLF+LP +L              +
Sbjct: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSS 630

Query: 638  STADVSSTAPKTVDDQA-TDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDICTW 696
            +  ++S+ +  T D +    N +   N+ + +T      EY DNI++L+  I+ P+I  W
Sbjct: 631  T--EISTMSIDTNDSRGPILNTSAYVNEGNIVT------EYFDNIDSLRLPIDHPNILVW 682

Query: 697  IKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFW 756
            +KSL+ +NMTSLKCS+IVL+KFL GPLLIALPH LPWT FIIA  +K    +N  + KFW
Sbjct: 683  LKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFW 742

Query: 757  RILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMD-LDDMLAHFNKSEDL 815
             I+M+RI PW+T+TSFLNVLLAY+LDN+  T  I +LC  YS+ +   ++L +FN++E+L
Sbjct: 743  TIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENL 802

Query: 816  PEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRA 875
            PE+WKCWGTLW+D I NK +++ADTF G GI DHMFLDFP+DGI FD  DETG  FW RA
Sbjct: 803  PEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRA 862

Query: 876  LRVIFLFKGISKKFDFGLKISHEAGVYCRNEKA-ADSPLRRFTFKLESYDEPTS-----S 929
            LR++FLFKGI++    GL++S  A V+CR +    +  L+ F+FK+E +DE +      S
Sbjct: 863  LRIVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFS 922

Query: 930  KFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSI 989
              N+ +PL E +   N D  A P LSVV+GENIFEY+GY+ L L+ +SFD+NGE+VSSSI
Sbjct: 923  TINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSI 982

Query: 990  YTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQD-- 1047
            YT+W+ID            ++N+++  QG+                 T+   +T  Q   
Sbjct: 983  YTAWVID------------NDNSLNNSQGN---------------QYTSNMQMTQQQRQL 1015

Query: 1048 -PGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNL-----WESSVDELDRLKTFFI 1101
             P   +N   + F S  D  D +    +      L KN+     W ++ DE++R  T+F+
Sbjct: 1016 LPPEQQNFQMRNFASNEDTED-DFNFELYMNPEKLNKNMDQASIWTTANDEINRNITYFV 1074

Query: 1102 FDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLY 1161
            FDATSWLRHFAHIYK++TN VL F VCLTTFQELRFLRKSKDENVV AAARAIITMRQLY
Sbjct: 1075 FDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLY 1134

Query: 1162 RENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEE 1221
             E +LLPLRFTGNVA DIEEHLEFEEQITWRSHVDEFVIEAV+KAQ+KF +A E+     
Sbjct: 1135 SEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANES----- 1189

Query: 1222 EGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
                   V L  K F++V LVT+D NMKRKAQ+QGIKTF+T F+FS+C KLG+  ++CTN
Sbjct: 1190 -------VTL-RKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1016 (57%), Positives = 709/1016 (69%), Gaps = 71/1016 (6%)

Query: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
            +++SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKIN+DLINNY T
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 344  FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
            F+TTALLPSQ  QDIL              LWVYGTITFLD+ KNFSNFMDPEVC QFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
            HVFIS+S +L DIPPK+ IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR FV+RN  GN+
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERN-NGNH 648

Query: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583
            RN  LI+YLKHSEVMLLPSFL S DLQQVVL YF+ +FG D +  NIFDT+ MF Q P  
Sbjct: 649  RNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDY 708

Query: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVS 643
            LR+FFRHAPAFAESHILQLVGFG+PKNPFALLFELP++L                    S
Sbjct: 709  LRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKK-------EKRRTKS 761

Query: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPE-YLDNIETLKYAIETP-DICTWIKSLD 701
            +T  +T    A D++ +  +D       +S PE +  NIETL++    P ++  W +SL+
Sbjct: 762  TTVTETSSTMAIDDLEDEQSD------RMSTPEGFFGNIETLRFPYSVPSNLEIWNESLN 815

Query: 702  FINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMK 761
            +INMTSLKCSM+VL+KFL GPL++ALPHF+PWT FII+   K+ +L +E + KFW   + 
Sbjct: 816  YINMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVD 875

Query: 762  RIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKC 821
            RIFPW+TI SFLNVL+AY+LDN   +++++ LC QYS M L+D+L +FN +E LPEVWKC
Sbjct: 876  RIFPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKC 935

Query: 822  WGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFL 881
            WGTLW+D ICNK     +     GI +HMFLD PIDGI FDA DE+G  FWKRA R+IFL
Sbjct: 936  WGTLWFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFL 995

Query: 882  FKGISKKFDFGLKISHEAGVYCR-NEKAADSPLRRFTFKLESYD----------EPTSSK 930
            FKG+++ F  G+ +S  A VYCR N+ +    L+ F+FKL              +P+++ 
Sbjct: 996  FKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTA 1055

Query: 931  FN-----EFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIV 985
             +       + + EE S  N      P LSV++GE+IF+Y GYR L  D  S+DKNGE +
Sbjct: 1056 IDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFL 1115

Query: 986  SSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDD 1045
            S+S+YTSW               +NN  +   G + A+G+ + +   A       H+   
Sbjct: 1116 SASLYTSWY-------------ANNN--TNNTGVIPAHGSDVDSQRDAVQSVQEMHI--- 1157

Query: 1046 QDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDAT 1105
                      F + M  G       Y        +L   L++++        T+F+ D T
Sbjct: 1158 ----------FNQIMEPG-------YCGGFADDLFLRDALYQTAHSS----TTYFVLDTT 1196

Query: 1106 SWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENR 1165
            +WLRHF HIYK+A++GVLKF +CLTTF ELRFLRK KDENVVEAA RAIIT+RQLY E +
Sbjct: 1197 TWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGK 1256

Query: 1166 LLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTG 1225
            LLPLRFTGNVA  IEEHLEFEE+ITWRSHVDEFVIEAV KAQ KF    + +  +EE   
Sbjct: 1257 LLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQH 1316

Query: 1226 PPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
              R         +V LVT+D NM++KAQDQ ++TFST FVFSLC+ +G+   +CTN
Sbjct: 1317 QLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/999 (56%), Positives = 675/999 (67%), Gaps = 85/999 (8%)

Query: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
            ++KSSQALVQKLQDIYKVIVKQEIELQERCSQLT SQTTELK LW IYK+N+DLINNY T
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 344  FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
            FITTALLP Q  QD+               LWVYGTITFLDVLKNFSNFMDPEVC+QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
            HVFIS+S +L DIP ++AIPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR FV+RN  GN+
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNH 471

Query: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583
            RN  LI+YLKHSEVMLLPSFL S DLQQVVL YF+D+FG+D +ENNIFDT+ MF Q P  
Sbjct: 472  RNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQ 531

Query: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVS 643
            L++FFRHAPAFAESHILQLVGFG+PKNPFALLFELP+ L              + T + S
Sbjct: 532  LKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETS 591

Query: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYA-IETPDICTWIKSLDF 702
            S             ++E    D   +      ++ DNI++L    +  P +  W  SL +
Sbjct: 592  SAMA----------IDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKY 641

Query: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762
            +N+TSL CSMIVLKKFL GP+++ALPH LPW  FIIA   KV  + +  + +FW  L+ R
Sbjct: 642  LNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNR 701

Query: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822
            IFPW+TI +FLNVL+AY LDN   +  I+ LC + S M LD ++ HFN +EDLPEVWKCW
Sbjct: 702  IFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCW 761

Query: 823  GTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882
            G LW+DAIC+K+ V  D++   GI DHMFLD PIDGI FD +DE+G KFWKRA RVIFLF
Sbjct: 762  GLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLF 821

Query: 883  KGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIPLCEEVS 942
            K I++ F   L +S +A V+CR     +  L+ F FKL      ++S     I + EE S
Sbjct: 822  KRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEVFEEGS 881

Query: 943  AINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEXXX 1002
              N D   TP LSV++ E+IF Y+GY+ L  D + +D+ GE VS+S+YTSW  +T +   
Sbjct: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEI 941

Query: 1003 XXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSL 1062
                 T     +E   DL   G  I+ SL       T    D  +  +N  D F      
Sbjct: 942  PQSEPTQQQTANE--ADLFIEG--INTSL-------TEFNIDFPECKMNGKDTF------ 984

Query: 1063 GDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGV 1122
                                                 F+ DATSWLRHFAH+YK+A+N V
Sbjct: 985  -------------------------------------FVLDATSWLRHFAHVYKLASNQV 1007

Query: 1123 LKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEH 1182
            L+F +CLTTFQELRFLRKSKDENVVEAA RA+IT+RQLY ENR+LPLRFTGNVA  IEEH
Sbjct: 1008 LQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEH 1067

Query: 1183 LEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLV 1242
            LEFEEQITWRSHVDEFV EA+ KAQ                    R+    + FH+V LV
Sbjct: 1068 LEFEEQITWRSHVDEFVFEAIKKAQ-------------------ARLSQENRDFHHVVLV 1108

Query: 1243 TNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
            T+D NM+RKAQ   I T ST FVF+ C+ +G  L +CTN
Sbjct: 1109 TDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1066 (55%), Positives = 703/1066 (65%), Gaps = 109/1066 (10%)

Query: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344
            +K+ +ALV+KLQDIYKVIVKQEIELQERCSQLTTSQTT+LKNLWTIYK+N DLINNY TF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 345  ITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404
            ITTALL SQ  QD+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464
            VFISLS +L DIP K++IPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN G N R
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN-R 532

Query: 525  NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFG--------------IDYSENN- 569
            N  LI+YLKHSEVMLLP+FL + +LQQVVL YFQ++FG              I+   NN 
Sbjct: 533  NLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNT 592

Query: 570  ----IFDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXX 625
                +F ++DMF Q P  L++FFRHAPAFAESHILQLVGFG+PKNPFALLFELPKYL   
Sbjct: 593  RTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKER 652

Query: 626  XXXXXXXXXXXTSTADVSSTAPKTVDDQ--ATDNVNEGTNDDHELTA-----TLSGPEYL 678
                        S ++ ++ A    D    + DN   G +D + L +      ++  E+ 
Sbjct: 653  KDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFF 712

Query: 679  DNIETLKYAIETPD-ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFI 737
             NIE L++    P+ +  W+ SL+ IN+ SLKCSMIVLKKFLHGPLLIALPH LPW  FI
Sbjct: 713  QNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFI 772

Query: 738  IACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTT--------- 788
            I+  +K   L +E +  FW  ++K IFPW+ I +FLNVLL Y LDN G  T         
Sbjct: 773  ISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQ 832

Query: 789  -----IIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADTFAG 843
                  I +LC +YS M   D+L HFN++EDLPEVWKCWGTLW+D I NKN +DAD+F  
Sbjct: 833  KDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFEN 892

Query: 844  FGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKFD-FGLKISHEAGVY 902
             GI DHMFLDFPIDGI +  EDETG  FWKR LR+IFLFKGI++ FD  GLK+S+ AG  
Sbjct: 893  LGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTE 952

Query: 903  CRNEKA-ADSPLRRFTFK----------------LESYDEPTSSKFNEFIPLCEEVSAIN 945
             RN     D+ L+ F+FK                LE Y     ++  EF+ + E +   N
Sbjct: 953  YRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETN 1012

Query: 946  NDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEXXXXXX 1005
             +    P  S++  E+IF+Y GY+ L  +  SFDKNGE  S SIYT+W +D  +      
Sbjct: 1013 LNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQL----- 1067

Query: 1006 XXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDP 1065
                                 I A  +      T  +T          DLF   +S+ + 
Sbjct: 1068 ---------------------ILAQNNNNNTNATDEMT----------DLFTGTLSIDEL 1096

Query: 1066 RDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKF 1125
              R +       KS L+ +   +S +  +R KT+F+FDATSWLRHFAHIYK+A+N VLKF
Sbjct: 1097 SFRQLKRPEFRDKSTLLSS---TSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKF 1153

Query: 1126 GVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEF 1185
             VCLTTFQELRFLRKSKD NVVEA+ RAIITMRQLY +  LLPLRFTGNVA DIEEHLEF
Sbjct: 1154 AVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEF 1213

Query: 1186 EEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEG----------TGPPRVPLGGKR 1235
            EEQITWRSHVDEFVIEAVMKAQ+KF  +   +  E             T           
Sbjct: 1214 EEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNL 1273

Query: 1236 FHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
            F YV L+T+D +M+ KAQ +GI TF T  VFS+CS +G+   +CTN
Sbjct: 1274 FKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 29/60 (48%), Gaps = 15/60 (25%)

Query: 81  QKRHGSASYSFANANFPSKRRIANAEEDSKRISSYSDNL------------LLQQNTPRR 128
           QKRH S SYS A  N   KRRIA  EE S +   Y DN+            + QQ TP +
Sbjct: 54  QKRHSSNSYSNAKNNPAVKRRIAKPEEVSLK---YIDNMEYGTATTGNNSIICQQQTPSK 110

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1049 bits (2713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1027 (54%), Positives = 692/1027 (67%), Gaps = 107/1027 (10%)

Query: 273  ADQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYK 332
            A++ DA  ++ +++SS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+
Sbjct: 251  AEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYR 310

Query: 333  INTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNF 392
            INT+LINNY TFITTALLPSQP  D+L              LWVYGTITFLDVLKNFSNF
Sbjct: 311  INTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNF 370

Query: 393  MDPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEH 452
            MDPEVC QFITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEH
Sbjct: 371  MDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEH 430

Query: 453  WYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR 512
            WY EAMK+ Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR
Sbjct: 431  WYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQR 490

Query: 513  TFVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFD 572
             FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VV++YF ++FGID +  NIF+
Sbjct: 491  AFVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549

Query: 573  TQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXX 632
             +DMF Q P   ++FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPKYL          
Sbjct: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYL---------K 600

Query: 633  XXXXTSTADVSSTAPKTVDDQATDNVNEGTNDDHEL---TATLSG----PEYLDNIETLK 685
                      SS    +V + +T N     NDD E+   TA++S      E+ ++I+TL+
Sbjct: 601  ERKDKKERKKSSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLR 660

Query: 686  YAIETPDICT---WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGI 742
              I  P + T   W+++L F+NMTSLKC MIVL+KFLHGPL IALPH LPW  FIIA  +
Sbjct: 661  RPI-LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCL 719

Query: 743  KVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDL 802
            K N+L +  +  FW I++KR+FPWDTI +F+NVL+AY+LDN     II ELC +Y  ++L
Sbjct: 720  KSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNL 779

Query: 803  DDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGI 859
              +L  FN+SE+LPE+W CWGTLW+D IC KN+      D F   GI D+M LD P DGI
Sbjct: 780  AGLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGI 839

Query: 860  EFDAEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFK 919
             FD +DE+G KFWKRA R+IFLF+ +S+ F  G+ +S++  + C + +++   LR   +K
Sbjct: 840  IFDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSS-IILRNLVYK 898

Query: 920  LESY-----DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLD 974
            LE       + P  +     + + E  S  N D  A P LSV  G+NIF Y GY+ L  D
Sbjct: 899  LEPLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPD 958

Query: 975  KNSFDKNGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAA 1034
               FD+NGE +S+S+YT W +                           NG  IS +L   
Sbjct: 959  YTCFDRNGEFLSASLYTRWYL--------------------------PNGNNISEAL--- 989

Query: 1035 GKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELD 1094
                   V  D + G  + DLF + M    P                           +D
Sbjct: 990  -------VNSDIEKG--DEDLFLECMKPDCP--------------------------GID 1014

Query: 1095 RLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAI 1154
               T+F+FDATSWLRH A I+K+A N +LKF +CLTTFQELRFLRKSKDENV+EAA R I
Sbjct: 1015 FETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGI 1074

Query: 1155 ITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAG 1214
            IT+RQLY E+++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++ KAQ+K   AG
Sbjct: 1075 ITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAG 1134

Query: 1215 ETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGM 1274
            +          P   P   +  +YV L+++D  MK+KA+++ IKT ST FVFSLC+KLG 
Sbjct: 1135 Q----------PHVTP---RHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGE 1181

Query: 1275 SLDLCTN 1281
               LCT+
Sbjct: 1182 KRHLCTD 1188

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1041 bits (2691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1007 (54%), Positives = 695/1007 (69%), Gaps = 90/1007 (8%)

Query: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344
            RKSSQALVQKLQDIYK+I+KQE+ELQERCSQLT SQTTE+KNLW IYK+N DLINNY TF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 345  ITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404
            ITTAL PSQ   D+L              LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464
            VFIS+S++L DIP K+AIPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQR F DRN+  N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 525  NPD-LIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNI--FDTQDMFFQPP 581
            N   L+DYLKHSEVMLLP+F+ S DLQQVVL YF ++FGIDY+ NN+  F  + MF Q  
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 582  SCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTA- 640
              L+F+FRHA AFAE+ ILQLVG+GNPKNPFALLF LPKYL                   
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGE 671

Query: 641  DVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD-ICTWIKS 699
            D SST   +V       VN  TN        L   ++ +NI+ L      P+ I  W  S
Sbjct: 672  DGSSTTFSSVSGMEY-MVNMETN------VFLGSEDFFNNIDKLAINNFMPNSISLWNDS 724

Query: 700  LDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRIL 759
            L + N T+ KCSMIVL+KFL+GPL++ALPH LPW  F+I+  +++ + ++    +FW   
Sbjct: 725  LKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAF 784

Query: 760  MKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVW 819
            +KRIFPW+++  FLNVLLAY++DN  + + + ELC QY  ++L+++L +FN +EDLPEVW
Sbjct: 785  IKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVW 844

Query: 820  KCWGTLWYDAICNK-NSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRV 878
            KC G+LW+D I  K NS + D++   GI D+ FLDFP+DGIEFD  DE G KFWKR++RV
Sbjct: 845  KCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRV 904

Query: 879  IFLFKGISKKFD-FG-LKISHEAGVYCRNEKAADSPLRRFTFKLES------YDEPTSSK 930
            IFLF+GI ++F+ FG L IS+ A V  R     +S L  ++FKL +      +D+   S 
Sbjct: 905  IFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSN 964

Query: 931  FNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIY 990
            F       EE+ + N+D  A P LS++ GENIFEY+GY+ +  D  SFDKNG+++S+S Y
Sbjct: 965  F-------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFY 1017

Query: 991  TSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGL 1050
             +W I+                      D   NG P+S + S++   ++       DP +
Sbjct: 1018 NTWSINQ---------------------DTGVNGGPLSNNSSSSNAASS-------DP-M 1048

Query: 1051 NENDLFKK-----FMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDAT 1105
            NE +LF K     + S+ +  ++ +Y ++  G+ + ++ L+E          T+FI DAT
Sbjct: 1049 NEKELFNKCFDPEYDSVDEFWNKEIYDDI--GRKFGME-LYED---------TYFILDAT 1096

Query: 1106 SWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENR 1165
            SWLRHFAH+YKIATN +LKF +CLTTFQELRFLRKSKDENVVEAA RAIIT+RQL+ E +
Sbjct: 1097 SWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGK 1156

Query: 1166 LLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTG 1225
            LLPLRFTGNVA  IEEHLEFEEQITWRSHVDEFVIEAV+KA        ETK+ E+E   
Sbjct: 1157 LLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKA--------ETKRKEQE--- 1205

Query: 1226 PPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKL 1272
                 +   +   + LVT+D NMK KA ++G KTFST FVF++ + L
Sbjct: 1206 -----MHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1007 (53%), Positives = 695/1007 (69%), Gaps = 60/1007 (5%)

Query: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344
            + +SQALVQKLQDIY+ IVKQEIELQERCSQLT SQTT++KNLW IYK+N +LINNY +F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 345  ITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404
            ITTALLPSQP QD+L              LWVYGTITFLDVLKNFSNFMDPEVC QFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464
            VF+S+S +L D+PP+++IPWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +TY H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR F +R +GG+ R
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER-SGGSSR 478

Query: 525  NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL 584
            N  +++YLKHSEVMLLPSFL S +LQ+VVL +FQ RFG+  +  + FD + +F Q    L
Sbjct: 479  NFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKL 538

Query: 585  RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVSS 644
            R+FF HAPAFAESHILQLVGFG+P+NPFA+LFELPK+L                 +  S 
Sbjct: 539  RYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFL------KERKERKERRRSKSSP 592

Query: 645  TAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFI 703
              P  +DD    N +   + DH          Y +NI++ +     P DI  W +SL ++
Sbjct: 593  PLPTNLDD---GNGSSSISVDH----------YFENIDSHRVPYSFPQDIQIWQQSLSYL 639

Query: 704  NMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRI 763
            N+TS++CSM VLKKFLH PLL ALPH LPW  F+++  I+++ L ++   KFW + M+RI
Sbjct: 640  NLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRI 699

Query: 764  FPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWG 823
            FPW+++ SFLN L+A++LDN  N + +E+LC +Y+ MDL  ++ HF  SE+LPEVWKCWG
Sbjct: 700  FPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWG 759

Query: 824  TLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFK 883
            TLW+D I NK+ + A +    GI DH+FLD PIDGI FD +DE+G KFWKRA RVIF+FK
Sbjct: 760  TLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFK 819

Query: 884  GISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLE----SYDEPTSSKFNEFIPLCE 939
            G++K+F +G+++S +  +  R +      L+RF+FK E     +D     + + FI + E
Sbjct: 820  GMAKEFHYGIRVS-DTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFE 878

Query: 940  EVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMID--- 996
             +S IN++  A PSLS++ GE+IFE+ GYR +  D   F+KNG++++ S+YTS +++   
Sbjct: 879  PISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVA 938

Query: 997  -TGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDL 1055
              G          +N  +      LAA+ +P+  +     +T  + V   +   LN   +
Sbjct: 939  IQGGDDFNVKRHVENGVL------LAAHNSPVDCN----ERTPETMVEYAERKWLNMC-M 987

Query: 1056 FKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIY 1115
               FM     RD    H  +   +              D   T+F+ DATSWLRHFAH+Y
Sbjct: 988  DPAFME--SLRDSRFPHGDLACNA--------------DSNVTYFVLDATSWLRHFAHVY 1031

Query: 1116 KIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNV 1175
            K+ATN VLKF +CLTTFQELRFLRKSKDE+VVEAA RA+IT RQLY E +LLPLRFTGN+
Sbjct: 1032 KLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNI 1091

Query: 1176 ANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTG-PPRVPLGGK 1234
            A  +EEHLEFEEQITWRSHVDEFVIEAV K+Q KF   G   Q  ++G    P  P    
Sbjct: 1092 ATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKF--KGLNLQARDQGQEYIPTDPKDDD 1149

Query: 1235 RFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
            +F++V LVT+D NM+ KA+   I  FS+ F+F+ C++LG +  +C N
Sbjct: 1150 KFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1022 (53%), Positives = 677/1022 (66%), Gaps = 98/1022 (9%)

Query: 274  DQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 333
            +++D+   +  ++S  AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIYKI
Sbjct: 258  EENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKI 317

Query: 334  NTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFM 393
            NTDL+NNY TFITTALLPSQP  D++              LWVYGTITFLDVLKNFSNFM
Sbjct: 318  NTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 377

Query: 394  DPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 453
            DPEVC QFITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHW
Sbjct: 378  DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHW 437

Query: 454  YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRT 513
            Y EAMK+ Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR 
Sbjct: 438  YTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRA 497

Query: 514  FVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDT 573
            FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ 
Sbjct: 498  FVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNA 556

Query: 574  QDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXX 633
            +DMF Q P   ++FFRH P+FA+SHILQ+VGFG PKNPFA+LFELPKYL           
Sbjct: 557  EDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKK 616

Query: 634  XXXT-STADVSSTAPKTVDDQATDNVNEGTND--DHELTATLSGPEYLDNIETLKYAIET 690
                 S+   SST     D++  D +   T    DH+L A     E+ ++I+TL+  I  
Sbjct: 617  SSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLA-----EFFNDIDTLRRPI-L 670

Query: 691  PDICT---WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNEL 747
            P + T   W+++L F+NMTSLKC +IVL+KFLHGPL IALPH LPW  FII+  +K ++L
Sbjct: 671  PSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQL 730

Query: 748  ENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLA 807
             +  + +FW I++KR FPWDT+ +F+NVL+ Y+LDN  + +II +LC  Y  + L ++L 
Sbjct: 731  SDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLE 790

Query: 808  HFNKSEDLPEVWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGIEFDAE 864
             FN+ E+LPE+  CWGTLW+D IC KN+      D F   GI D+M LD P DGI FD +
Sbjct: 791  LFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEK 850

Query: 865  DETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESY- 923
            DE G KFWKRA R IFLF+ +S+ F  G+ I ++  +Y R+     + L    FKLE   
Sbjct: 851  DENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIY-RSSFQNTNILGSLVFKLEPLC 909

Query: 924  ----DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFD 979
                + P        I + E  S  N D  A P LSV +G+NIF Y+GY+ L  D   FD
Sbjct: 910  NIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFD 969

Query: 980  KNGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTT 1039
            KNGE                                           +SASL        
Sbjct: 970  KNGEF------------------------------------------LSASLYTTWYVPN 987

Query: 1040 SHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTF 1099
            S+ T+ +D                     N+ +N       L     +S   E+D   T+
Sbjct: 988  SNNTNIED---------------------NINYNSEKENEGLFLECIKSDYPEIDFKTTY 1026

Query: 1100 FIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQ 1159
            F+FDATSWLRH A I+K+A N +L+F +CLTTFQELRFLRKSKDENV+EAA R IIT+RQ
Sbjct: 1027 FVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQ 1086

Query: 1160 LYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQP 1219
            LY EN++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE+VMKAQ+K  +A E    
Sbjct: 1087 LYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASE---- 1142

Query: 1220 EEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLC 1279
                   PR  L  +RF+YV L+++D  MK+KA+++ IKT ST FVFSLC+KLG    LC
Sbjct: 1143 -------PR--LSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLC 1193

Query: 1280 TN 1281
            T+
Sbjct: 1194 TD 1195

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1004 (52%), Positives = 675/1004 (67%), Gaps = 68/1004 (6%)

Query: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
            + ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+NT+LINNY  
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 344  FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
            FITTALLPSQP QD+L              LWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
            HVFIS+S +L D+P K A PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN GGN 
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQ 445

Query: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583
            RN  +++YLKHSEVMLL SFL S +LQ+VVL++FQ++FGI  +  + F  Q +F Q    
Sbjct: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505

Query: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVS 643
             ++FFRHAPAFAESHILQ+VGFGNPKNPFALLFELPK+L              +++   S
Sbjct: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSF-TS 564

Query: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDF 702
              AP                         S  EYL+++++ ++  E P D+  W +SL  
Sbjct: 565  MEAPSPT----------------------SPIEYLESVDSPRFVYEFPTDLAIWQQSLSH 602

Query: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762
            IN TS+KCS +VL+KFLHGPL+ A  H LPW  F+++  I+++EL + +   FW  L ++
Sbjct: 603  INTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQ 662

Query: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822
            +FPW++I +FLN+++A+ LDN   T+ I+ LC Q+  +D+  ++ HF+++EDLPEVWKCW
Sbjct: 663  VFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCW 722

Query: 823  GTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882
            G LW+D I +K+ V  +      + DHMF D P+DGI FD +DETG++FWKRA R++F+F
Sbjct: 723  GALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIF 782

Query: 883  KGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFI----PLC 938
            KGI+++F+ GL ++    +  R   AA  PL+ F FK E  D P  S+    I    P  
Sbjct: 783  KGIAQEFNMGLTLA-SVPLQSRRSLAAGHPLQNFCFKFE--DPPVDSESYALISTQMPAF 839

Query: 939  EEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTG 998
            E +S  N D  A P  S+++G+++FE  GYR L  D   F+K G +++ S+YTS  ++ G
Sbjct: 840  ENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKG 899

Query: 999  EXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKK 1058
                     T+  + S+   +L     P    +    K     +    +P   E     K
Sbjct: 900  PIHGGDDFNTERYSRSD---ELNKADNP---QIKELDKMERMWLDTCMNPEFIEQTYDMK 953

Query: 1059 FMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIA 1118
            F   GD     +  N  +G SY                   F+ DATSWLRHFAH+YK+A
Sbjct: 954  F-PFGD-----LSCNCDSGVSY-------------------FVPDATSWLRHFAHVYKLA 988

Query: 1119 TNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVAND 1178
            TNGVL+F +CLTTFQELRFLRKSKDE+VVEAA RA+IT+RQLY E RLLPLRFTGNVA  
Sbjct: 989  TNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH 1048

Query: 1179 IEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKR-FH 1237
            +EEHLEFEEQITWRSHVDEFVIEAV KAQ+KF    E    + +  G   +P   +  FH
Sbjct: 1049 LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF----EALNAQAKEGGHDFIPTTEEEPFH 1104

Query: 1238 YVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
            ++ LV++D NM+ KA  Q I+TFS+ F+F++C+++G++   CTN
Sbjct: 1105 FIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1024 (50%), Positives = 690/1024 (67%), Gaps = 97/1024 (9%)

Query: 273  ADQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYK 332
            ++ +D  N S   K +QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L ++W+IY+
Sbjct: 354  SNSNDKANNS--NKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYR 411

Query: 333  INTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNF 392
            IN +L+ NY TFI+TALL SQ   D++              LWVYGTITFLDVLKNFS+F
Sbjct: 412  INVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSF 471

Query: 393  MDPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEH 452
            MDPEVCSQFITHVFIS+S +L DIP K++IPW+QRLGDLSRMAIALYPSGFIDWKLS+E+
Sbjct: 472  MDPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEY 531

Query: 453  WYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR 512
            WY +A+K+TY +GKLYYHMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQR
Sbjct: 532  WYNQALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQR 591

Query: 513  TFVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFD 572
             F++R +  N RN  LI+YLKHSEVMLLP+F+G+++LQ+VV+ YF+ +FG D  + NIF 
Sbjct: 592  AFIERGS-NNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQ 650

Query: 573  TQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXX 632
             +D+F Q P  L++FFRHAPAFAESHILQ VGFG+ KNPFALLF+LPK            
Sbjct: 651  PRDIFLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPK-FLKEKKDKKDR 709

Query: 633  XXXXTSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYA-IETP 691
                +S    S+ +  ++D+ +TD++             +S  +Y  N+E++++  +  P
Sbjct: 710  KKTKSSGEPTSNESVMSLDNISTDSL-------------ISSDQYFSNLESMQHPYLPPP 756

Query: 692  DICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEK 751
                W+KSL ++N+T+++C +IVL+KFLHGP ++ALPH + WT FII+  +K   L +E+
Sbjct: 757  RYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEE 816

Query: 752  NYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNK 811
            +  FW   M+R+ P ++I SFLNVL+AY LDN   +T+I  +  +   MDL ++L  FN 
Sbjct: 817  SRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNN 876

Query: 812  SEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKF 871
            +E+LPEVWKCWGTLW+DAI +K++ D +++   G+ DH+F D PIDGI FD++DE G KF
Sbjct: 877  NEELPEVWKCWGTLWFDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKF 936

Query: 872  WKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAA-DSPLRRFTFKLESY------- 923
            WKRALR+IFLFK I++ FD G+ +SH A VYCR +    +  L  F+FK+E +       
Sbjct: 937  WKRALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTV 996

Query: 924  DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGE 983
                 +     I + E  + +N    ATP +S+ + ENIFEY GY+ +  +  +FDKNGE
Sbjct: 997  QVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGE 1056

Query: 984  IVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASL---SAAGKTTTS 1040
            + S++ YTSW                           A    P SA+    S AG +   
Sbjct: 1057 LRSAANYTSWYS-------------------------AQEIVPKSAASPENSVAGSS--- 1088

Query: 1041 HVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLK--- 1097
                   PG       + F S      ++V  N+ +    +  N  E+S   LD L    
Sbjct: 1089 -------PG-------RSFQS------QDVEENIFS----VFTNEEENSTSLLDGLNLET 1124

Query: 1098 TFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITM 1157
            T F+ DATSWLRH AHIYK+A+N  L F +CLTTFQELRFLRKSKDENV+EAAARAII +
Sbjct: 1125 TSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIII 1184

Query: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETK 1217
            RQLY + +++PLRFTGN+A  IEEHLEFEEQITWRSHVDEFVIE++ KAQ KF       
Sbjct: 1185 RQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFL------ 1238

Query: 1218 QPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLD 1277
            QP  +       P+      +V LV++D+NMKRKA ++ I+TF+T FVF+LCS++G    
Sbjct: 1239 QPFVQN------PVDNDSRFFV-LVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRL 1291

Query: 1278 LCTN 1281
            +CTN
Sbjct: 1292 ICTN 1295

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1001 (52%), Positives = 672/1001 (67%), Gaps = 68/1001 (6%)

Query: 287  SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFIT 346
            +SQALVQKLQDIY+ IVKQE+ELQERC+QLTTSQTT+LKNLW IYKIN +LINNY  FIT
Sbjct: 240  TSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFIT 299

Query: 347  TALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVF 406
            TALLPSQP QD+L              LWV+GTITFLDVLKNFSNFMDPEVC QFITHVF
Sbjct: 300  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 359

Query: 407  ISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGK 466
            IS+S +L D+P K + PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGK
Sbjct: 360  ISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGK 419

Query: 467  LYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNP 526
            LYYHMSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQR F +RN GGN+RN 
Sbjct: 420  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN-GGNHRNS 478

Query: 527  DLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRF 586
             +++YLKHSEVMLL SFL S +LQ+VVL++FQ +FG+  S  + F+ +DMF Q    +++
Sbjct: 479  LMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKY 538

Query: 587  FFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVSSTA 646
            FFRHAPAFAESHILQ VGFG+PKNPFALLFELPK+L              +     S T+
Sbjct: 539  FFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSH----SFTS 594

Query: 647  PKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFINM 705
             +T                   T+ LS  EYL+N+++ +YA E P D+  W +SL  IN+
Sbjct: 595  IET-------------------TSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINI 635

Query: 706  TSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFP 765
            TS +CS IV +KFL GPL++A+ H LPW+ F+++  +K++ L + +   FW  L+++IFP
Sbjct: 636  TSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFP 695

Query: 766  WDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTL 825
            W++I  FLN+L+A+VLDN   T+ I+ LC Q   +D   ++ HF++ EDLPE+W+CWG L
Sbjct: 696  WNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGAL 755

Query: 826  WYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGI 885
            W+D I +K++ +       G  DH F D P DGI FD +DE G KFWKRA R+IF+FKGI
Sbjct: 756  WFDVIADKSNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGI 815

Query: 886  SKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEF----IPLCEEV 941
            +++F  GL +S  A    R    A  PL+ F+F  E    P  S+   F    IPL EE+
Sbjct: 816  AQEFSLGLTLSAFAP-QSRRPMTAGHPLQNFSFNFEEI--PAQSQIQSFVRNQIPLFEEI 872

Query: 942  SAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEXX 1001
            +  N D    P  S+++GE+IF++ GYR +  D   F+K+G ++S S+YTS  ++ G   
Sbjct: 873  ATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQ 932

Query: 1002 XXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMS 1061
                  T+    SE       +  P +A ++   +     + +  +P   E     KF  
Sbjct: 933  GGDDFNTERYGRSED------SNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKF-P 985

Query: 1062 LGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNG 1121
             GD     +  N  +G SY                   F+ DATSWLRHFAH++K+ATN 
Sbjct: 986  FGD-----LSCNCDSGVSY-------------------FVLDATSWLRHFAHVFKLATNN 1021

Query: 1122 VLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEE 1181
            VL+FG+CLTTFQELRFLRKSKDE+VVEAA RA+IT+RQLY + +LLPLRFTGNVA  +EE
Sbjct: 1022 VLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEE 1081

Query: 1182 HLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKR-FHYVT 1240
            HLEFEEQITWRSHVDEFVIEAV KAQ KF    E    + +  G   +    +  FH+V 
Sbjct: 1082 HLEFEEQITWRSHVDEFVIEAVYKAQKKF----EAINAQAKEAGHDFIATTDEEPFHFVA 1137

Query: 1241 LVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
            LV++D NM+ KA  Q I+TFST F+F++C+++G++   CTN
Sbjct: 1138 LVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1019 (50%), Positives = 667/1019 (65%), Gaps = 83/1019 (8%)

Query: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344
            RKSSQ LVQKLQDIYK IVKQEIELQERC +LT SQTTELKNLWTIY++N++L++NY TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 345  ITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404
            ITTA+ P+QP  D                LWVYGTITFLD+LKNFSNFMDPEVC QFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464
            VFIS+S +L DIP K+ + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524
            GKLYYHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQR + D N   N R
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 525  NPD-LIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDY--SENNIFDTQDMFFQPP 581
            N   L+DY+KH EV LLP+F  S++LQQVVL YF D+FG+DY  S NN+F ++ MF Q  
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 582  SCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTAD 641
               + F+R++ AFAES ILQ+VG+GN K+PF+LLFELPKYL                   
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 642  VSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD-ICTWIKSL 700
            +  T P+         +    N++  LTA     E+ +NI+T+ Y    P+ +  W  SL
Sbjct: 738  I--TQPRLYHRWVGTTLPTMPNNNVFLTA----EEFFENIDTINYPSFMPNSVDIWNHSL 791

Query: 701  DFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILM 760
             + N  S+KCSMIV KKFLH P +IALPH LPW  FII+  +++++ +N    +FW   +
Sbjct: 792  QYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFV 851

Query: 761  KRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWK 820
            +RIFPW++I  FLNVLLAY++DN    +I+ ELC  Y+ M LD++L +FN++E+LPEVWK
Sbjct: 852  RRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWK 911

Query: 821  CWGTLWYDAICNKNSVDADT--------------FAGFGIGDHMFLDFPIDGIEFDAEDE 866
            C G+LW+D I  K++++ D               + G G+ D+ F DFPIDG +FD  DE
Sbjct: 912  CRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDE 971

Query: 867  TGAKFWKRALRVIFLFKGISKKFD--FGLKISHEAGVYCRNE-----KAADSPLRRFTFK 919
             G +FWKRA RVIFLFK +++ +    GL +S+EA V+ R +           L  F+FK
Sbjct: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFK 1031

Query: 920  LESYDEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFD 979
            L +  +      ++ I   E    +N D   TP LS+V G++IF+Y+GY+ +  +  SFD
Sbjct: 1032 LNASSDGV--MLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFD 1089

Query: 980  KNGEIVSSSIYTSWMID--TGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKT 1037
            KNG+ +S+S + SW I   T E          ++A+S G G+            SAA  T
Sbjct: 1090 KNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGN-----------DSAAAST 1138

Query: 1038 TTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELD-RL 1096
                   + DP +NE  +F +     DP+ +       T + +  + ++  S   +  + 
Sbjct: 1139 -------NNDP-MNELLVFNECF---DPKYK-------TLEEFWSQEIYPDSQTNISLQG 1180

Query: 1097 KTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIIT 1156
            KT+FI DATSWLRHFAHIYKIAT+ +LKF +CLTTFQELR+LRKSKD NVVEAA RAIIT
Sbjct: 1181 KTYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIIT 1240

Query: 1157 MRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFT----- 1211
            +RQLY EN LLPLRFTGNVA  IEEHLEFEEQITWRSHVDEFVIEAV+KA++K T     
Sbjct: 1241 LRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLND 1300

Query: 1212 TAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCS 1270
               +T + E+   G             + LVT+D  MK KA D+ IKTFST F+FS+ +
Sbjct: 1301 INMDTDEKEKSIFG-------------IILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1022 (48%), Positives = 649/1022 (63%), Gaps = 118/1022 (11%)

Query: 282  SVTRK-----SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTD 336
            SVTR+      +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IYK+NT+
Sbjct: 192  SVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTE 251

Query: 337  LINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPE 396
            LI NY  FI TALL +QP  D++              LWVYG ITFLDVLK+FSNFMDPE
Sbjct: 252  LIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPE 311

Query: 397  VCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 456
            VC QFIT+ FI +S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E
Sbjct: 312  VCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTE 371

Query: 457  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVD 516
            +MK+ Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+D
Sbjct: 372  SMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFID 431

Query: 517  RNTGGN------YRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNI 570
            R++G        +RN  LIDYLKH+EVMLLPSFL + DLQ VVL YF+D+FG D++ N++
Sbjct: 432  RSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDV 491

Query: 571  FDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXX 630
            F T+DMF Q P  LR++FRHAPAFAES ILQL+GFGNPKNPFALLF+LPK+L        
Sbjct: 492  FSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHL----KFKK 547

Query: 631  XXXXXXTSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIET 690
                   S A          DDQ                   S   Y  NI+TL      
Sbjct: 548  DKREKKKSGAAEIPHYRDPFDDQG------------------SSESYFQNIDTLNSDFND 589

Query: 691  P--DICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELE 748
            P  +I  W+ SL++INMTS++CS+ VL KFLH PL +ALPHFL W  FIIA   K+  + 
Sbjct: 590  PPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETIN 649

Query: 749  NEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAH 808
            +E+   FW   ++R  PW+++ +F NVL+ Y+LDN      +E+   ++  ++LDD++ +
Sbjct: 650  SEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNLH--PFLEKQLEKFYSLELDDLIEY 707

Query: 809  FNKSEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETG 868
            FN++E+LPEVWKCWG+LW+DA+        D     G+ DH+F D P+DGI FD +DE G
Sbjct: 708  FNENENLPEVWKCWGSLWFDAV-----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIG 762

Query: 869  AKFWKRALRVIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEP 926
             KFW R++R I   KGI+KKF D GLK++ +A V+C RN+ + D  L+  TFKL+ Y+E 
Sbjct: 763  EKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEED 822

Query: 927  TSSKFNEF------IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDK 980
              +  NE       I + E +  +N D  ATP LSVV GE+IFEY GY  L  D + FDK
Sbjct: 823  AFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDK 882

Query: 981  NGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTS 1040
            NG   S+ IYT W                             NG  +  S  +   +TT+
Sbjct: 883  NGGFNSAFIYTQW-------------------------SNVGNGVTLDVSSESLYDSTTN 917

Query: 1041 HVTDDQDPGLN-ENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTF 1099
                  D  L+    LF K  ++G                         + D+      +
Sbjct: 918  ------DLSLHWAKILFDKVFTIG------------------------KNTDDDGSCSVY 947

Query: 1100 FIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQ 1159
            F+ DATSWLRHFAHI+K+A N +LKF +CLTTFQELR+LR SKD+NVVEAA R++IT+RQ
Sbjct: 948  FVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQ 1007

Query: 1160 LYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQP 1219
            LY E +++P+RFTGN+A  IEE+LEFEEQITW++HVDEFVI+A+ K    F T     + 
Sbjct: 1008 LYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKN 1067

Query: 1220 EEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLC 1279
            +            G+   +  LVT+D NM +KA+D+ IKT +T ++FSL SKLG++  LC
Sbjct: 1068 K------------GRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLC 1115

Query: 1280 TN 1281
            TN
Sbjct: 1116 TN 1117

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1014 (48%), Positives = 641/1014 (63%), Gaps = 115/1014 (11%)

Query: 286  KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345
            + +Q  ++KLQ+IY++IV QE ELQ+RC  LTTSQTTELK+LW IY++NT+LI NY  FI
Sbjct: 202  QPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 346  TTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405
             TALL +QP  D++              LWVYG ITFLDVLKNFSNFMDPEVC QFI + 
Sbjct: 262  ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 406  FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465
            FIS+S++L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  G
Sbjct: 322  FISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 466  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGN--- 522
            KLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR++ G    
Sbjct: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNN 441

Query: 523  ---YRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQ 579
               +RN  LIDYLKH+EVMLLPSFL + DLQ VVL YF+D+FG D++ N+IFDT+DMF Q
Sbjct: 442  ETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQ 501

Query: 580  PPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTST 639
             P  LR++FRHAPAFAES +LQL+GFGNPKNPFALLF+LPKYL              T  
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEV 561

Query: 640  ADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDICT---- 695
                       DDQ                  +S   Y  NI++L    +  DI T    
Sbjct: 562  PQYRD----PFDDQ------------------ISSESYFQNIDSLTSNFD--DIPTNLNI 597

Query: 696  WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKF 755
            W+ SL+ INMTS++CS+ VL KFLH PL++ALPHFL W  FI+A   K+  + ++    F
Sbjct: 598  WLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGF 657

Query: 756  WRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDL 815
            W   ++R  PW+++ +  NVL+ Y+LDN      +E    ++  ++LDD++ +FN++E+L
Sbjct: 658  WIHFLRRTMPWNSMVNLANVLVCYMLDNIH--PFLERELERFYSLELDDLIEYFNENENL 715

Query: 816  PEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRA 875
            PE+WKCWG+LW+DAI        D     G+ DH+F D P+DGI FD +DE G +FW R+
Sbjct: 716  PEIWKCWGSLWFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRS 770

Query: 876  LRVIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEPTSSKFNE 933
            +R I + KG++KKF D GLK++ +A V+C RN+ + D  L+ FTFKL+ Y+E   +  NE
Sbjct: 771  IRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNE 830

Query: 934  F------IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSS 987
                   I + E++  +N D  ATP+LSVV GENIFEY GY  L  D + FDKNG   S+
Sbjct: 831  LDELYDTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSA 890

Query: 988  SIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQD 1047
             IY+ W                        G+         +   AA    + H      
Sbjct: 891  FIYSQW---------------------SNVGNGMVLDVSSESMYDAANNNLSPHW----- 924

Query: 1048 PGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSW 1107
                E   F +  + G   D+N                             +F+ DATSW
Sbjct: 925  ----EKIFFDRITTAGHNGDKN------------------------GNCSVYFVIDATSW 956

Query: 1108 LRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLL 1167
            LRHFAHI+K+A N +LKF +CLTTFQELR+LR SKD+NVVEAA R++IT+RQLY E +++
Sbjct: 957  LRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKII 1016

Query: 1168 PLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPP 1227
            PLRFTGN+A ++EE+LEFEEQITW +HVDEFVI+A+ K    F T     + + +     
Sbjct: 1017 PLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNA-- 1074

Query: 1228 RVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
                      Y  LVT+D NM  KA+D+ IKT +T ++FSL SK+G++  LCTN
Sbjct: 1075 ----------YAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1014 (49%), Positives = 648/1014 (63%), Gaps = 115/1014 (11%)

Query: 286  KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345
            + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++NT+LI NY  FI
Sbjct: 202  QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 346  TTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405
             TALL +QP  D++              LWVYG ITFLDVLKNFSNFMDPEVC QFI + 
Sbjct: 262  ITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 406  FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465
            FIS+S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  G
Sbjct: 322  FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 466  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGN--- 522
            KLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR + G    
Sbjct: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNN 441

Query: 523  ---YRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQ 579
               ++N  LIDYLKH+EVMLLPSFL + DLQ VVL YF+++FG D++ N++FDT+DMF Q
Sbjct: 442  ETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQ 501

Query: 580  PPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTST 639
             P  LR++FRHAPAFAES +LQL+GFGNPKNPFALLF+LPKYL              T T
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATET 561

Query: 640  ADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDICT---- 695
                         Q  D  ++            S   Y  NI+ L    +  DI T    
Sbjct: 562  P------------QYRDPFHDKK----------SPESYFQNIDALSSNFD--DIPTNLNI 597

Query: 696  WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKF 755
            W++SL+ INMTS++CS+ VL KFLH P +IALPHFL W  F++A   ++  + +++   F
Sbjct: 598  WLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAF 657

Query: 756  WRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDL 815
            W   ++R  PW+++ S  NVL+ Y+LDN  +  + +EL   YS  +LDD++ HFN++E+L
Sbjct: 658  WIHFLRRTMPWNSMVSLANVLVCYMLDNL-HPFLKKELESFYS-FELDDLIEHFNENENL 715

Query: 816  PEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRA 875
            PE+WKCWG+LW+DAI        D     G+ DH+F D P+DGI FD +DE G +FW R+
Sbjct: 716  PEIWKCWGSLWFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRS 770

Query: 876  LRVIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEPTSSKFN- 932
            +R I L KGI+KKF D GLK++ +A V+C RN+   D  LR+FTFKL++YDE  ++  N 
Sbjct: 771  VRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNE 830

Query: 933  -----EFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSS 987
                 E I + E++  +N D  ATP+LSVV GE+IFEY GY  L  D + FDKNG   S+
Sbjct: 831  LDELYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSA 890

Query: 988  SIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQD 1047
             IY+ W                             NG PI  S           VTD   
Sbjct: 891  FIYSQW-------------------------SNVGNGVPIDVS-----NEPIYDVTD--- 917

Query: 1048 PGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSW 1107
                 NDL   +  +   R    Y N                 DE D    +F+ DATSW
Sbjct: 918  -----NDLSLHWEKIFFDRIAAAYKN----------------CDENDNCTIYFVVDATSW 956

Query: 1108 LRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLL 1167
            LRHFAHI+K+A N +L F +CLTTFQELR+LR SKD+NVVEAA R++IT+RQLY E +++
Sbjct: 957  LRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKII 1016

Query: 1168 PLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPP 1227
            P+RFTGN+A  +EE+LEFEEQITW++HVDEFVI+A+ K    F T     + +       
Sbjct: 1017 PMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENK------- 1069

Query: 1228 RVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
                  K   +  LVT+D NM +KA+D+ IKT +T ++FSL SKLG++  LCTN
Sbjct: 1070 -----NKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1009 (49%), Positives = 655/1009 (64%), Gaps = 80/1009 (7%)

Query: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
             ++SSQAL++KLQ+IY+ IV+QE ELQ+RCSQLTTSQTT+LKNLW IYK+N +LI+NY  
Sbjct: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337

Query: 344  FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
            FITTALLP+QP  D+L              LWVYGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397

Query: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
            +VFIS+S +L DIPPK +I WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+T+ 
Sbjct: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457

Query: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN+ G++
Sbjct: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS-GHH 516

Query: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583
            RN  L++YLKH+EVMLLPSFL S +LQ VVL +F+ +FG+  S  + FD + +F Q    
Sbjct: 517  RNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT-SNVDFFDPRLVFVQDSER 575

Query: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVS 643
            L+ FFRHA  +AESH+LQLVGFG+P+NPFALLFELPK+L               S +  S
Sbjct: 576  LKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHL----KERKDRREKRKSKSSTS 631

Query: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDF 702
            +    ++DD                 A  +  E+ + I++ KY  + P DI  W +SL +
Sbjct: 632  TQYDTSIDDDC---------------AFAAPSEFFETIDSTKYIYKFPDDINIWKESLSY 676

Query: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762
             N+T++KCSMIVL+KFLHGPLL ALPH LPW  F+ A   +V  +  ++  +FW  L+++
Sbjct: 677  ANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQ 736

Query: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822
            +FP++TI +FLNVLL Y+ +        +E   Q+ DM L D++ +F ++E+LPEVW+CW
Sbjct: 737  LFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECW 796

Query: 823  GTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882
            GTLW+DA+  K+  +       G+ DHMF+D PIDGI FD  DE+G KFWKR  RVI LF
Sbjct: 797  GTLWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLF 856

Query: 883  KGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLES--------YDEPTSSKFNEF 934
            + ++ +   GL+           E +     R   FK E         Y EP +  F+ F
Sbjct: 857  RALALECPVGLR-----------EISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTF 905

Query: 935  IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWM 994
                E++S +N D  ATP   +    +I    GYR L  D   F++NG++++ S+YT   
Sbjct: 906  ----EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT--- 958

Query: 995  IDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNEND 1054
            I T E          N       G+L          +S   +   S +  ++ P ++E  
Sbjct: 959  IGTLESSGIHGGDDFNGKRLLENGEL----------VSTERRDYNSLIDREEQPIMDE-- 1006

Query: 1055 LFKKFMSLGDPRDRNVYHNMI-TGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAH 1113
                F+     ++   +  M+  G  +             D   T+F+ DAT+WLRHF H
Sbjct: 1007 ----FLRHTHCKNDVRWEQMLPRGDLHCFA----------DTHVTYFVLDATTWLRHFGH 1052

Query: 1114 IYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTG 1173
            +YK+A N +LKF +CLTTFQELRFLRKSKDE+V+EAA RA+IT+RQLY E +LLPLRFTG
Sbjct: 1053 VYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTG 1112

Query: 1174 NVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGG 1233
            NVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQDKF    +  +          +P G 
Sbjct: 1113 NVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDC----IPTGA 1168

Query: 1234 -KRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
             +RF+++ LVT+D NM+ KA  Q IK FST F+FS+C++LG + ++CTN
Sbjct: 1169 DQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1021 (48%), Positives = 659/1021 (64%), Gaps = 102/1021 (9%)

Query: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
            ++ SSQ LV+KLQ+IYK IVKQE ELQERCSQLTTSQTT+LKNLW IYK+N +LI+NY T
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 344  FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
            FITTALLP+QP  D+L              LW+YGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
            +VFIS+S IL +IPP  ++ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + 
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN+ G++
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS-GHH 554

Query: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583
            R   +++YLKH+EVMLLPSFL + + Q VVL +F  +FG   S  N FD   +F Q    
Sbjct: 555  RYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCER 613

Query: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVS 643
            L+ FFRHA  +AESHILQLVGFG+P+NPFALLFELPK +              T+    S
Sbjct: 614  LKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTA----S 669

Query: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGP-EYLDNIETLKYAIE-TPDICTWIKSLD 701
            + +  ++DD                   L  P ++ + + + K A   + D+  W +SL+
Sbjct: 670  NQSDMSIDD-----------------TFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLN 712

Query: 702  FINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMK 761
            ++N TS++CSM+VL+KFL+  LL ALPH LPW  F++A G++++ + NE + +FW + ++
Sbjct: 713  YVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIR 772

Query: 762  RIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKC 821
            +IFPW++IT+FLNVLL Y+ D       I+E    Y +M L ++L +F ++EDLPEVW C
Sbjct: 773  QIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNC 832

Query: 822  WGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFL 881
            WGTLW+D I +K+  +       G+ DHMFLD P+DGI FD  DE+G KFWKR +RVI L
Sbjct: 833  WGTLWFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILL 892

Query: 882  FKGISKKFDFGLKISH-----EAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIP 936
            F+GI+ +F FG    +     ++ V+  NE  A+          E Y    S ++ EF  
Sbjct: 893  FRGIAYQFPFGFTEFNGSDDWKSLVFKFNEPPAEWK--------EQYLGSFSKEYGEF-- 942

Query: 937  LCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMID 996
              E +S +N D  + P   +V G +I    GY+ L  D   F+KNG++++ S+YTS M  
Sbjct: 943  --ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGM-- 998

Query: 997  TGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPG----LNE 1052
                             SEG      +G P                 D +D G    L E
Sbjct: 999  -----------------SEG-----GSGVP----------------NDSEDFGSTKRLLE 1020

Query: 1053 NDLF-----KKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDE------LDRLKTFFI 1101
            N+L      + + +L D  +  +    +  +     + WE  +         D   T+F+
Sbjct: 1021 NELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFV 1080

Query: 1102 FDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLY 1161
             DAT+WLRHF H+YK+AT+ +LKF +CLTTFQELRFLRKSKDE+V+EAA RA+IT+RQLY
Sbjct: 1081 LDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1140

Query: 1162 RENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEE 1221
             E +LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF    +    + 
Sbjct: 1141 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNK----DA 1196

Query: 1222 EGTGPPRV-PLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCT 1280
            + +G   +  +   +F+++ LVT+D NM+ KA+ Q I+ FST F+F++C ++G+S  +CT
Sbjct: 1197 KASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCT 1256

Query: 1281 N 1281
            +
Sbjct: 1257 D 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1011 (47%), Positives = 639/1011 (63%), Gaps = 85/1011 (8%)

Query: 291  LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALL 350
            LV+KLQ+IYK IVKQE ELQERCS LTT QTT+LKNLW  YKIN +LI+NY  FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 351  PSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 410
            PSQ    +               LWVYGTITFLDVLKNFSNFMDPEVC QFI +VFI+LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 411  AILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 470
             +L D+PPK++IPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 471  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLID 530
            MSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQR F +R++ GN R   ++D
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-RTNHIVD 522

Query: 531  YLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRH 590
            YLKH+EVMLLPSFL S +LQ VV++YFQ +FG+  S  N FD   +F Q    L+ FFRH
Sbjct: 523  YLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVS-SSGNFFDPNLIFIQDAERLKHFFRH 581

Query: 591  APAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVSSTAPKTV 650
            +  F++SHILQL GFG+PKNPFA+LFEL K+L                     S   +  
Sbjct: 582  SSLFSQSHILQLCGFGDPKNPFAMLFELSKHL--------------------KSRKERKE 621

Query: 651  DDQATDNVNEGTNDDHELTA--TLSGPEYLDNIETLKYAIETP-DICTWIKSLDFINMTS 707
              ++T + +EG+ D  E ++    S  ++   I++ K   E P D+  W +SL +IN+TS
Sbjct: 622  RKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTS 681

Query: 708  LKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWD 767
            +KC MIVL++FL+GP++ ALPH LPW +FII+  I+++++ +    KFW + ++RIFPWD
Sbjct: 682  MKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWD 741

Query: 768  TITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWY 827
            ++ +F+N L+ Y +        I+     Y  M+ +++L    ++E+LPE W CWG+LW+
Sbjct: 742  SLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWF 801

Query: 828  DAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISK 887
            + I  K+ +D  T    G+ D +FLD P +GI FD +DE G K+W+R  R + LF  I++
Sbjct: 802  NTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861

Query: 888  KFDFGLKISHEAGVYCRNEKAADSPLRRFTFK----------LESYDEPTSS-KFNEFIP 936
                  +     G  C+      +  +   F+          +E Y E   S  F +F  
Sbjct: 862  -----WEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKF-- 914

Query: 937  LCEEVSAIN-NDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMI 995
              E +S +N +D L   S S++ G +I    G++ +  D   F+KNG+++++S+YT   +
Sbjct: 915  --EIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972

Query: 996  DTGEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDL 1055
            +T              A  +G  D  AN    +  L    +   S   D       E   
Sbjct: 973  ET--------------ANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKL-----EQPW 1013

Query: 1056 FKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIY 1115
             + FM+  D R R + +    G              + D   TFF+ DAT+WLRHFAHIY
Sbjct: 1014 LEAFMN-PDFRQRELLNRSFLGNLNC----------QADTNVTFFVLDATTWLRHFAHIY 1062

Query: 1116 KIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNV 1175
            K+AT+ VLKF +CLTTFQELRFLRKSKDE+V+EAA RA+I +RQLY E +LL LRFTGNV
Sbjct: 1063 KLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNV 1122

Query: 1176 ANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPL---- 1231
            A  +EEHLE EEQ+TW+SHVDEFVI+A+ KAQDKF         +    G   +PL    
Sbjct: 1123 AGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNN----DAIEKGKDCIPLSEDG 1178

Query: 1232 -GGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281
               +RF++V+LVT+D NM+ KAQ  GI+TFST FVF++C +LG    +CTN
Sbjct: 1179 QSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
           (REAL)
          Length = 1180

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/740 (57%), Positives = 534/740 (72%), Gaps = 30/740 (4%)

Query: 274 DQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 333
           D++DA   +  ++S  AL+QKLQ++Y+VIVKQEIELQERCSQLT SQTTELK+LWTIYKI
Sbjct: 239 DENDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKI 298

Query: 334 NTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFM 393
           NT+L+NNY TFITTALLPSQP  D++              LWVYGTITFLDVLKNFSNFM
Sbjct: 299 NTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 358

Query: 394 DPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 453
           DPEVC QFITHVFISLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHW
Sbjct: 359 DPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHW 418

Query: 454 YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRT 513
           Y EAMK+TY+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR 
Sbjct: 419 YTEAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRA 478

Query: 514 FVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDT 573
           FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ 
Sbjct: 479 FVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNC 537

Query: 574 QDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXX 633
           +DMF Q P   ++FFRH P+FA+SHILQ+VGFG PKNPFA+LFELPKYL           
Sbjct: 538 EDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL---------KE 588

Query: 634 XXXTSTADVSSTAPKTVDDQATDNVNEGTNDDHEL---TATLSGP----EYLDNIETLKY 686
                    +S    +V + +T N   G  DD E    T ++S P    E+ ++I+TL+ 
Sbjct: 589 RKDKKERKKTSNNDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRR 648

Query: 687 AIETPDICT---WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIK 743
            I  P + T   W+++L F+NMTSLKC MIVL+KFLHGPL +ALPH LPW  FII+  +K
Sbjct: 649 PI-LPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLK 707

Query: 744 VNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLD 803
            N+L +  + +FW +++KR+FPWDT+ +F+NVL+AY+LDN  + +II +LC +YS ++L 
Sbjct: 708 SNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLS 767

Query: 804 DMLAHFNKSEDLPEVWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGIE 860
           ++L  FN++EDLPE+W CWGTLW+DAIC KN+      D F   GI D+M LD P DGI 
Sbjct: 768 ELLNSFNENEDLPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGII 827

Query: 861 FDAEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKL 920
           FD +DE G KFWKRA R+IFLF+ +S+ F  G+ + H+  V C + + +++ LR   +KL
Sbjct: 828 FDDKDENGEKFWKRACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQ-SNNILRDLVYKL 886

Query: 921 ESYDE-----PTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDK 975
           E         P  S       + E  S IN D  A P LSV+ G+NIF Y+GY+ L  D 
Sbjct: 887 EPLTNIRSSVPVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDY 946

Query: 976 NSFDKNGEIVSSSIYTSWMI 995
             FDKNGE +S+S+YTSW +
Sbjct: 947 TCFDKNGEFLSASLYTSWYV 966

 Score =  243 bits (620), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/195 (60%), Positives = 149/195 (76%), Gaps = 13/195 (6%)

Query: 1087 ESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENV 1146
            E +  E+D   T+F+FDATSWLRH A I+K+A N +L+F +CLTTFQELRFLRKSKDENV
Sbjct: 999  EIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENV 1058

Query: 1147 VEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKA 1206
            +EAA R IIT+RQLY E+++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++MKA
Sbjct: 1059 MEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKA 1118

Query: 1207 QDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVF 1266
            Q+K   A   KQP           +   RF+YV L+++D  MK+KA+++ I+T ST FVF
Sbjct: 1119 QEKLENA---KQPN----------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVF 1165

Query: 1267 SLCSKLGMSLDLCTN 1281
            SLC+KLG    LCT+
Sbjct: 1166 SLCTKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/760 (55%), Positives = 537/760 (70%), Gaps = 26/760 (3%)

Query: 274  DQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 333
            ++S+    +  +KSS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+I
Sbjct: 251  EESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRI 310

Query: 334  NTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFM 393
            NT+L+NNY TFITTALLPSQP  D++              LWVYGTITFLDVLKNFSNFM
Sbjct: 311  NTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 370

Query: 394  DPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 453
            DPEVC QFITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHW
Sbjct: 371  DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHW 430

Query: 454  YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRT 513
            Y EAMK+ Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR 
Sbjct: 431  YTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRA 490

Query: 514  FVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDT 573
            FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ 
Sbjct: 491  FVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNP 549

Query: 574  QDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXX 633
            +DMF Q P   ++FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK+L           
Sbjct: 550  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHL--------KER 601

Query: 634  XXXTSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGP------EYLDNIETLKYA 687
                     S+      +   +++ NE  ++D  +++T S        E+ ++I+TL+  
Sbjct: 602  KDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRP 661

Query: 688  IETPDIC--TWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVN 745
            I +  +    W++SL F+NMTSLKC MIVL+KFLHGPL IALPHFLPW  FII+  +K +
Sbjct: 662  IVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSS 721

Query: 746  ELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDM 805
            +L +  + +FW +++KRIFPWDT+ +F+N+L+A VLDN   + II  LC +YSD++L ++
Sbjct: 722  QLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAEL 781

Query: 806  LAHFNKSEDLPEVWKCWGTLWYDAIC--NKNSVDA-DTFAGFGIGDHMFLDFPIDGIEFD 862
            L  F + E+LPE+W CWGTLW+D IC  N NS+ + D F   GI D+M LD PIDGI FD
Sbjct: 782  LDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFD 841

Query: 863  AEDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLES 922
              DE G KFWKRA R IFLF+ +S+ F  G+ I++E+ +  R+   +++ L   ++KLE 
Sbjct: 842  VNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSIN-RSSLQSNNILGNLSYKLEP 900

Query: 923  YDE-----PTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNS 977
                    PT +     I + E  S  N D  A P LSV++G +IF Y GY+ L  +   
Sbjct: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960

Query: 978  FDKNGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQ 1017
            FDKNGE +S+S+YTSW +  G         ++    +EGQ
Sbjct: 961  FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQ 1000

 Score =  233 bits (594), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 147/190 (77%), Gaps = 13/190 (6%)

Query: 1092 ELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAA 1151
            E+D   T+F+FDATSWLRH A I+K+A N +LKF +CLTTFQELRFLRKSKDENV+EAA 
Sbjct: 1011 EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070

Query: 1152 RAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFT 1211
            R IIT+RQLY EN++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++MKAQ+K  
Sbjct: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130

Query: 1212 TAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSK 1271
             A +             +P+   RF+YV L+++D  MK+KA+++ IKT ST FVFSLC+K
Sbjct: 1131 NANQ-------------LPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTK 1177

Query: 1272 LGMSLDLCTN 1281
            LG    LCT+
Sbjct: 1178 LGEQRHLCTD 1187

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
           Putative protein of unknown function, predicted to
           contain a PINc domain
          Length = 1118

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/724 (53%), Positives = 498/724 (68%), Gaps = 45/724 (6%)

Query: 286 KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345
           + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++NT+LI NY  FI
Sbjct: 202 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 346 TTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405
            TALL +QP  D++              LWVYG ITFLDVLKNFSNFMDPEVC QFI + 
Sbjct: 262 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 406 FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465
           FIS+S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  G
Sbjct: 322 FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 466 KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGG---- 521
           KLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR++G     
Sbjct: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441

Query: 522 --NYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQ 579
              +RN  LIDYLKH+EVMLLPSFL + DLQ VVL YF+D+FG D++ N++FDT+DMF Q
Sbjct: 442 EIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQ 501

Query: 580 PPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTST 639
            P  LR++FRHAPAFAES +LQL+GFGNPKNPFALLF+LPKYL              T T
Sbjct: 502 NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATET 561

Query: 640 ADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAI-ETP-DICTWI 697
           +  S T P  V                     +S   Y  NI+ L  +  + P ++  W+
Sbjct: 562 S--SYTDPFDVQ--------------------ISSESYFQNIDALNSSFNDIPTNLNIWL 599

Query: 698 KSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWR 757
            SL+ INMTS++CS+ VL KFLH PL++ALPHFL W  FI+A   K+  + +++   FW 
Sbjct: 600 DSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWI 659

Query: 758 ILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPE 817
             ++R  PW++I +  NVL+ Y+LDN  +  + +EL   YS ++LDD++ ++N++E+LPE
Sbjct: 660 HFLRRTMPWNSIVTLGNVLVCYMLDNL-HPFLKKELEKFYS-LELDDLIEYYNENENLPE 717

Query: 818 VWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALR 877
           +WKCWGTLW+DAI        D     G+ DH+F D P+DGI FD +DE G KFW R++R
Sbjct: 718 IWKCWGTLWFDAIKK-----CDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVR 772

Query: 878 VIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEPTSSKFNEF- 934
            + L KGI+KKF D GLK+S +A V+C RN+   D  L+  TFKL++YDE   +  NE  
Sbjct: 773 AVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELD 832

Query: 935 -----IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSI 989
                I + EE+ A+N D  ATP+LSVV GE+IFEY GY  L  D + FDKNG   S+ I
Sbjct: 833 DLYDTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFI 892

Query: 990 YTSW 993
           Y+ W
Sbjct: 893 YSQW 896

 Score =  215 bits (547), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 137/191 (71%), Gaps = 12/191 (6%)

Query: 1091 DELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAA 1150
            DE      +F+ DATSWLRHFAHI+K+A N  LKF +CLTTFQELR+LR SKD+ VVEAA
Sbjct: 940  DENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAA 999

Query: 1151 ARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKF 1210
             R++IT+RQLY E +++P+RFTGN+A  +EE+LEFEEQITW++HVDEFVI+A+ K   +F
Sbjct: 1000 TRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRF 1059

Query: 1211 TTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCS 1270
                 T + + +G              +  LVT+D NM +KA+D+ IKT +T ++FSL S
Sbjct: 1060 QAERLTDENKNKGK------------EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107

Query: 1271 KLGMSLDLCTN 1281
            KLG++  LCTN
Sbjct: 1108 KLGINSGLCTN 1118

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/729 (48%), Positives = 482/729 (66%), Gaps = 42/729 (5%)

Query: 286 KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345
           +S+QAL+ KLQDIYK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L+NNY  FI
Sbjct: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330

Query: 346 TTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405
           TTALLPSQ   D+L              LWVYGTITFLDVLK+FSNFMDPE+C QFI HV
Sbjct: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390

Query: 406 FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465
           FIS++ +   IP K +IPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  G
Sbjct: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450

Query: 466 KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRN 525
           KLYYHM+TVQQN+L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQR ++ R    +  N
Sbjct: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS-SN 509

Query: 526 PDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLR 585
             ++DYLKH+E+M+LP+F+ + +LQ++   YF ++FG D+  NN FDT+ MF Q    ++
Sbjct: 510 VQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVK 569

Query: 586 FFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTADVSST 645
           F+FRH+P FA++HILQ+VG+GN  N FALL+ELPK++                  ++S  
Sbjct: 570 FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDN---------------EISRQ 614

Query: 646 APKT---VDDQATDNVN--EGTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSL 700
             K+   VD+ + D ++     N+ H++    +  E +D   TL      P++  WI+SL
Sbjct: 615 RKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLP-----PNVDIWIQSL 669

Query: 701 DFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILM 760
            + N T + C M+VL+KFL GP + ALPH LPW  F+I+   K+  L +  +  FW++ +
Sbjct: 670 QYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFI 729

Query: 761 KRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWK 820
           +RIFPW+TI +FLNVL+A++ DN  + +++ +LC  YS + LD++L +F+++E+LPEVW 
Sbjct: 730 RRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWN 789

Query: 821 CWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIF 880
           CWG+LW+D I NK+          GI D  FLD P DGI FD ED+ G KFWKRA R++F
Sbjct: 790 CWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILF 849

Query: 881 LFKGISKKFDFGLKI-------SHEAGVYC-RNEKAADSPLRRF--TFKLESYDEPTS-- 928
           LFKG ++KFD GL++       S E  ++  + EK     L +F  T+ L   DE ++  
Sbjct: 850 LFKGYAEKFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKY 909

Query: 929 ----SKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEI 984
               S F E +P  E +S  N    A P LSV+ GE+IF+Y+GY+ L      +DKNG +
Sbjct: 910 FQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNV 969

Query: 985 VSSSIYTSW 993
              +IY++W
Sbjct: 970 NKGAIYSNW 978

 Score =  217 bits (553), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 139/205 (67%), Gaps = 28/205 (13%)

Query: 1098 TFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITM 1157
            T+FIFDAT+WLRHFAHIYKIA +G+L F +CLTTFQELRFLR+S+DENV+EAA RA+I +
Sbjct: 1085 TYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVI 1144

Query: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDK-------- 1209
            R LY+  +++PLRF G +A+ IEEHLEFEEQITWRSHV+EFVIEAV K+Q+         
Sbjct: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204

Query: 1210 -------------FTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQG 1256
                            + +TKQ            L         LVT+D+NM  KA+++G
Sbjct: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLS-------VLVTDDRNMDSKAKERG 1257

Query: 1257 IKTFSTDFVFSLCSKLGMSLDLCTN 1281
            I+T ST F+FS+CS+LGM   +CTN
Sbjct: 1258 IRTCSTRFIFSICSQLGMKYGICTN 1282

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  516 bits (1328), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 259/382 (67%), Positives = 289/382 (75%), Gaps = 44/382 (11%)

Query: 284 TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343
           T+ SSQAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DLINNY  
Sbjct: 391 TKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYIN 450

Query: 344 FITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403
           FIT ALLP+Q   D+               LWVYGTITFLDVLK+FSNFMDPEVC QFI+
Sbjct: 451 FITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFIS 510

Query: 404 HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463
           HVFI++S IL DIP K++I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYS
Sbjct: 511 HVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYS 570

Query: 464 HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523
           HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN  GN+
Sbjct: 571 HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNH 629

Query: 524 RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI-------------------- 563
           RN  LI+YLKH+EVMLLP+FL S DLQ VVL YFQ +FGI                    
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 564 -----------------------DYSENNIFDTQDMFFQPPSCLRFFFRHAPAFAESHIL 600
                                   ++  +IF  QDMF Q P  L++FFRH+  FA+SHIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 601 QLVGFGNPKNPFALLFELPKYL 622
           QLVGFG+PKNPFALLFELPK+L
Sbjct: 750 QLVGFGDPKNPFALLFELPKFL 771

 Score =  469 bits (1207), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 270/609 (44%), Positives = 356/609 (58%), Gaps = 98/609 (16%)

Query: 676  EYLDNIETLKYAIETPD-ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWT 734
            E+ +NI+ L++  + P  I  W++SL  IN+ SLKCS+IVLKKFL+GP+LIALPH L W 
Sbjct: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926

Query: 735  VFIIACGIKV-NELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYG--NTTIIE 791
             FII+  +K+ N + + ++  FW   +K I PW++I +FLNVL+ Y+LDN    N  +I 
Sbjct: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986

Query: 792  ELCMQYSDMD---LDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKN-------------- 834
             L  +Y+ M    L++ML  FN++E+LPE+WKCWGTLW+D ICNKN              
Sbjct: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046

Query: 835  ---------------SVDAD-TFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRV 878
                           + D D T    GI DH  LD P+DGI F A DE G  F+KR++R+
Sbjct: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106

Query: 879  IFLFKGISKKF-DFGLKISHEAGVYCRNEKAADS-PLRRFTFKLESYDEPTS-------- 928
            IFL K + + F + GLKISHE   YCRN K   +  L  F FKL +  +P+         
Sbjct: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQ 1166

Query: 929  --------------------SKFNEFIPLCEEVSAINNDALATPSLSVVQG-ENIFEYMG 967
                                S   EF  + E +  IN +    P LS++ G ENIF Y+G
Sbjct: 1167 NIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226

Query: 968  YRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEXXXXXXXXTDNNAVSEGQGDLAANGTPI 1027
            Y+ L  +  SF +NGEI+S SIY+SW ID              N   E Q         +
Sbjct: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDY-------------NKFKEQQQQQQQQEHLV 1273

Query: 1028 SASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKS--YLVKNL 1085
            + S       T   +T        E+  FK+FM L        +H  ++ +S     +N 
Sbjct: 1274 NDSTMKNENVTVGDITP-------EDASFKEFMKLS-------FHLKLSTRSNNSQTQNT 1319

Query: 1086 WESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDEN 1145
             +  V  +++ +TFF+FDATSWLRHFAHIYK++ NG LKF VCLTTFQELRFLRKSKD N
Sbjct: 1320 HKMGV-SINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGN 1378

Query: 1146 VVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMK 1205
            VVEA+ RAIITMRQLY+E +LLPLRFTGNVA DIEEHLEFEEQITWRSHVDEFVIEA+++
Sbjct: 1379 VVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIR 1438

Query: 1206 AQDKFTTAG 1214
            +Q++F T  
Sbjct: 1439 SQERFKTKS 1447

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  418 bits (1074), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/413 (52%), Positives = 271/413 (65%), Gaps = 75/413 (18%)

Query: 285 RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344
           +KS+Q L+QKLQ+IYK+IV QE+ELQ++C++L+TSQ+T+LK LW+IYK+N DLINNY  F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 345 ITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404
           I T+L PSQ   D L              LW+YGTITFLD+LKNF+NFMDPE+ SQFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 405 VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464
           VF S+S ++ D+P     PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SH
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 465 GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNT----- 519
           GKLYYH+STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQR F++RN+     
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 520 -----------------GGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFG 562
                              N++   LI+YLKHSEVMLLP+FL +  L+ VVLNYF + FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 563 IDYSENNIFDTQD----------------------------------------------- 575
               ++N+ D  +                                               
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 576 -----MFFQPPSCLRFFF-RHAPAFAESHILQLVGFGNPKNPFALLFELPKYL 622
                +F Q  S +  +F +++  FAESHILQL+GFG+PKNPFALLF+LPKYL
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  273 bits (698), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 221/365 (60%), Gaps = 36/365 (9%)

Query: 924  DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGE 983
            D  T    + +IP  E+ S  N D    P LS+++ E++FEY GY+    D ++FDKNGE
Sbjct: 1137 DSNTERNIDTWIPF-EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGE 1195

Query: 984  IVSSSIYTSWMIDT--GEXXXXXXXXTDNNAVSEGQGDLAANGTPISASLSAAGKTTTSH 1041
            ++S+S+YTS +IDT  G         T  NA  E   D +A      ++ +     +T++
Sbjct: 1196 LISTSLYTSTIIDTINGSSSNANIINTTTNANDESNNDSSATA---GSNQNKESSNSTTN 1252

Query: 1042 VTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFI 1101
            + D+++  L E ++F K +   DP  +N+   +  G+ +      ++S+   D   T+F+
Sbjct: 1253 I-DNKELFLMEKEIFNKIL---DPDYKNI-DEIWRGEMF-----HDTSIQFSD---TYFV 1299

Query: 1102 FDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLY 1161
             DATSWLRHFAH+YK+ATNG+LKF +CLTTFQELRFLRKSKDENV+EAA RAIIT+RQLY
Sbjct: 1300 LDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLY 1359

Query: 1162 RENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQ----------DKFT 1211
             E RLLPLRFTGN+A  IEEHLEFEEQITWRSHVDEFVIEA+ +AQ          D   
Sbjct: 1360 SEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNV 1419

Query: 1212 TAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQ----DQGIKTFSTDFVFS 1267
            T+               + +    F    LVT+D +M +K Q    D  I TFST FVFS
Sbjct: 1420 TSSNNNPIINNNENNGNLNVTDMIF---VLVTDDISMIKKRQEEKSDNDIITFSTKFVFS 1476

Query: 1268 LCSKL 1272
            LC+ L
Sbjct: 1477 LCNML 1481

 Score =  238 bits (608), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 122/293 (41%), Positives = 185/293 (63%), Gaps = 9/293 (3%)

Query: 637  TSTADVSSTAPKTVD---DQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD- 692
            TS A   ST   ++    D  T+  N G  D+ E+   LS  ++ +N+E+LK +   P+ 
Sbjct: 748  TSFATAISTTNNSISSNMDVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNS 807

Query: 693  ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKN 752
            +  W +SL +IN+ SL CS+IVLKKFL+GPL ++LPH LPW+ FII+  +++  LEN ++
Sbjct: 808  LEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIES 867

Query: 753  YKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKS 812
              FW   +++IFPW++I S+LNV+++ +LDN    ++I +L   YS+ +LD++L  FN++
Sbjct: 868  RIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNEN 927

Query: 813  E-DLPEVWKCWGTLWYDAIC-NKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAK 870
            E +LPEVWKC+G+LW+D I  N      D      + D   L++PIDG+ FD  +E G  
Sbjct: 928  EYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTN 987

Query: 871  FWKRALRVIFLFKGISKKFD--FGLKISHEAGVYC-RNEKAADSPLRRFTFKL 920
            FWKR+ R+IFLFK +  +F+   GL IS    VYC R++   +  LR F FKL
Sbjct: 988  FWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score = 85.1 bits (209), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 126/611 (20%), Positives = 227/611 (37%), Gaps = 137/611 (22%)

Query: 327 LWTIYKINTDLINNYTTFITTALLPSQPAQDILXXXXXXXXXXXXXXLWVYGTITFLDVL 386
           L  ++K++T +++ YT FI  AL  +   +D++              L  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 387 KNFSNFM----------DPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAI 436
           +N+ N M          + +   +FI    I ++ +L +IP K    W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 437 ALYPSGFIDWKLSAEHWY-----MEAMKFTYSHGK----------LYYHMSTVQQNTLEA 481
            L       ++L++ H Y     + A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 482 FVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTF-----VDRNTGGNYRNPDLIDYLKHSE 536
            V L K +  ++T    +   QL ID I  +       + ++ GG      L+ Y     
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGG---TTILMKYFT--- 377

Query: 537 VMLLPSFLGSKDLQQV------VLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL------ 584
             LL  F GS    Q+       L+YF + F  +Y  N          +P +C       
Sbjct: 378 --LLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLN-----YSSLRKPVNCKYRQKEI 430

Query: 585 ---RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLXXXXXXXXXXXXXXTSTAD 641
               F+F +AP F+   I++ +      NPF  +++                        
Sbjct: 431 NYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYK---------------SSDDFEIKS 475

Query: 642 VSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSLD 701
           VS +  K + +Q  D            T   S          L  AI  P I  W+  L 
Sbjct: 476 VSLSNWKILIEQMDD------------TLLHSNKLLFKKFLMLNVAISQPFILPWL--LF 521

Query: 702 FINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMK 761
           +I++ S   ++      L    L  L + LPW                            
Sbjct: 522 YISVASEVANVTDRHVLLLWKDL--LQNLLPW---------------------------- 551

Query: 762 RIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKC 821
                D I ++LN  +  V  +  N+  +  L        L D+L +     +  E+  C
Sbjct: 552 -----DDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMC 606

Query: 822 WGTLWYDAICNKNSVDADT-------FAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKR 874
            G +W+D++ +K    + T       F  +   +        D + +D +D+   K W R
Sbjct: 607 EGFIWFDSLASKIKQASITTNESLMKFKSYNASE--------DSLIYDDDDQVYTKMWTR 658

Query: 875 ALRVIFLFKGI 885
           AL +I L K +
Sbjct: 659 ALLIILLIKNV 669

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 1099 FFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK-SKDENVVEAAARAIITM 1157
            +F+ D  +WL+H   + +      +K  + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862

Query: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETK 1217
              LY  N++  L+             EFE  I+    +       ++    KF     TK
Sbjct: 863  NYLYAMNQINILK-------------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTK 907

Query: 1218 QPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCS 1270
               E G G  ++ +   R   V +V++D+      + +G    ST  +FS+ S
Sbjct: 908  ---ENGPG-QQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 641 DVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYL-DNIETLKYAIETPDICTWIKS 699
           +V+STA +  D ++TD++ E  + + ELT  L GP  + DN+ ++  +I    +C W +S
Sbjct: 860 NVNSTADQDEDMESTDDIEEDASTEPELTEKLEGPTKIKDNLNSI-LSINDVIVCEWDES 918

>TBLA0D00290 Chr4 (67816..69681) [1866 bp, 621 aa] {ON} Anc_2.116
          Length = 621

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 61/145 (42%), Gaps = 18/145 (12%)

Query: 668 LTATLSGPEYLDNIETLKYAIETPDICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLI-- 725
           L ATL   EY +N++ L Y  +T  I   +K L      S+   +++   F  G  LI  
Sbjct: 173 LEATLEVSEYTNNVDILSYESKTKRIVKQLKEL-----CSILSGLVIASNFKIGLKLIEN 227

Query: 726 -ALPHFLPWTVFIIACGIKVNELENEK---NY-KFWRILMKRIFP-WDTITSF-----LN 774
                F  W   I   G +   +  EK   NY K   ILM  + P  ++I  F     +N
Sbjct: 228 KEYKKFSNWFKKIFEIGRRYKIMNPEKMKSNYGKLVYILMDSMLPEIESIMEFNLYKPIN 287

Query: 775 VLLAYVLDNYGNTTIIEELCMQYSD 799
            + +++++N    T   E+   + D
Sbjct: 288 TIESFLIENNSKNTDNNEIYQMFRD 312

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 521 GNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI 563
           GN  N DLI YL+H    +L       DL  +++ Y +DR  +
Sbjct: 456 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 498

>Skud_4.594 Chr4 complement(1056682..1060995) [4314 bp, 1437 aa]
           {ON} YDR326C (REAL)
          Length = 1437

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 80  GQKRHGSASYSFANANFPSKRRIANA---EEDSKRISSYSDNLLLQQNTPRRSRDVARK 135
           G  +   +S+   +   P+ + + NA   E DSKR SSYS+++       R+SR  A+K
Sbjct: 504 GNSQSNVSSHRARSKTLPANKALENATNDEIDSKRNSSYSNDMTFDDADERKSRSTAKK 562

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 521 GNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI 563
           GN  N DLI YL+H    +L       DL  +++ Y +DR  +
Sbjct: 458 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 500

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 521 GNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI 563
           GN  N DLI YL+H    +L       DL  +++ Y +DR  +
Sbjct: 458 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 500

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 521 GNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI 563
           GN  N DLI YL+H    +L       DL  +++ Y +DR  +
Sbjct: 457 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 499

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 505 VIDNIYQRTFVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGID 564
           +I N   RT +   TG    + DLI YL+H    +L      KDL  +++ Y +DR  I 
Sbjct: 446 IIRNFDNRTPIIAMTGS-IEHQDLITYLQHGMNDILAKPFTRKDLYSILIRYLKDRVPIS 504

Query: 565 YSENNIFDTQ 574
             +N +   Q
Sbjct: 505 DQKNQLQQEQ 514

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 130,979,967
Number of extensions: 5815666
Number of successful extensions: 16100
Number of sequences better than 10.0: 43
Number of HSP's gapped: 16309
Number of HSP's successfully gapped: 74
Length of query: 1281
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1160
Effective length of database: 39,606,813
Effective search space: 45943903080
Effective search space used: 45943903080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)