Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C066205.705ON1011015224e-70
Kpol_YGOB_1043.725.705ON88862891e-34
NCAS0A031805.705ON88872811e-33
YKR095W-A (PCC1)5.705ON88892742e-32
TBLA0G010305.705ON89882699e-32
KAFR0H001905.705ON82792644e-31
Smik_11.3595.705ON88892603e-30
Skud_11.3355.705ON94952551e-29
Kwal_YGOB_Anc_5.7055.705ON88862524e-29
TDEL0B021505.705ON91892516e-29
ZYRO0B16368g5.705ON85802506e-29
SAKL0E14982g5.705ON89862516e-29
Suva_11.3325.705ON111812501e-28
KLTH0E00990g5.705ON89882472e-28
TPHA0E002005.705ON85732438e-28
KLLA0A00539g5.705ON87802291e-25
AFR289W5.705ON81802263e-25
NDAI0E050605.705ON86832247e-25
Ecym_40165.705ON125882103e-22
CAGL0G02535g5.705ON140531671e-15
TBLA0B025903.329ON63347651.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06620
         (101 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   205   4e-70
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   115   1e-34
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   112   1e-33
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   110   2e-32
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   108   9e-32
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   106   4e-31
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   104   3e-30
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   102   1e-29
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   101   4e-29
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   101   6e-29
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   100   6e-29
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   101   6e-29
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   100   1e-28
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   100   2e-28
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    98   8e-28
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    93   1e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    92   3e-25
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    91   7e-25
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    86   3e-22
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    69   1e-15
TBLA0B02590 Chr2 complement(592068..593969) [1902 bp, 633 aa] {O...    30   1.2  

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  205 bits (522), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60
           MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF
Sbjct: 1   MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60

Query: 61  CGRDARVLRVGVSSVIDSLKTIIESLDELDQTGPSSTEASM 101
           CGRDARVLRVGVSSVIDSLKTIIESLDELDQTGPSSTEASM
Sbjct: 61  CGRDARVLRVGVSSVIDSLKTIIESLDELDQTGPSSTEASM 101

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  115 bits (289), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (75%)

Query: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63
          KT R   +DHTL   +PFET RQA IA QVL+PDPILKPQDF VSY++    L  +F   
Sbjct: 2  KTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSI 61

Query: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89
          D RVLRVGVSSVIDS+KTIIE++DEL
Sbjct: 62 DDRVLRVGVSSVIDSVKTIIETMDEL 87

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  112 bits (281), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (73%)

Query: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63
          K  R  +LD+ L L +PF T RQA IA++VL PDPILKPQDF V Y +Q   L   F G 
Sbjct: 2  KNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGI 61

Query: 64 DARVLRVGVSSVIDSLKTIIESLDELD 90
          D RVLRVGVSSVIDS+KTIIE++DELD
Sbjct: 62 DDRVLRVGVSSVIDSIKTIIETIDELD 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  110 bits (274), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 68/89 (76%), Gaps = 2/89 (2%)

Query: 1  MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60
          MT+K  R  +LDHTL L +PFET RQA IA++VL PDPILKPQDF V Y+++   +  +F
Sbjct: 1  MTSK--REKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQF 58

Query: 61 CGRDARVLRVGVSSVIDSLKTIIESLDEL 89
             D RVLRVGVSS+IDS+KTI+E++D L
Sbjct: 59 RSIDDRVLRVGVSSIIDSIKTIVEAMDVL 87

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  108 bits (269), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (73%)

Query: 3  TKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCG 62
          +K      ++HTLTLN+PF T +QA IA QVL+PDPIL+PQDF V Y ++G  L   F  
Sbjct: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61

Query: 63 RDARVLRVGVSSVIDSLKTIIESLDELD 90
           D RVLRVGVSSVIDS+KTIIE+ DEL+
Sbjct: 62 IDDRVLRVGVSSVIDSVKTIIETFDELE 89

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  106 bits (264), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 60/79 (75%)

Query: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70
          LDHTL L +PFE  +QA IA  VL+PDPIL+PQDF VSY A+     A F   D RVLRV
Sbjct: 3  LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62

Query: 71 GVSSVIDSLKTIIESLDEL 89
          GVS+VIDSLKTIIE++DEL
Sbjct: 63 GVSNVIDSLKTIIETMDEL 81

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  104 bits (260), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 2/89 (2%)

Query: 1  MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60
          M++K   P  L HTL L VPF+T +QA+IA++VL PDPILKPQDF + Y+++   +  +F
Sbjct: 1  MSSKREMP--LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQF 58

Query: 61 CGRDARVLRVGVSSVIDSLKTIIESLDEL 89
             D RVLRVGVSSVIDS+KT++E++DEL
Sbjct: 59 RSIDDRVLRVGVSSVIDSIKTVVEAMDEL 87

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  102 bits (255), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 68/95 (71%), Gaps = 8/95 (8%)

Query: 1  MTTKTARPAALDHTLT------LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGP 54
          MT+K  R  +LD+TL       L +PFET  QA IA++VL PDPILKPQDF V Y+++  
Sbjct: 1  MTSK--REMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKN 58

Query: 55 CLEARFCGRDARVLRVGVSSVIDSLKTIIESLDEL 89
           +  RF   D RVLRVGVSSVIDS+KTI+E++DEL
Sbjct: 59 IMLVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  101 bits (252), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%)

Query: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63
          K++RP  L +TL L VPF+  +QA  A QVL+PDPILKPQDF V Y +    L   F G 
Sbjct: 2  KSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGV 61

Query: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89
          D RVLRVGVSSVI+S+KTI+E++DE 
Sbjct: 62 DDRVLRVGVSSVIESIKTIVETIDEF 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  101 bits (251), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (69%), Gaps = 3/89 (3%)

Query: 10 ALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69
          +L+H+L L +PF+T  QA IA QVL PDPILKPQDF V Y      L   F   D RVLR
Sbjct: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLR 61

Query: 70 VGVSSVIDSLKTIIESLDELDQTGPSSTE 98
          VGVSSVIDS+KTI+E++DEL   GP + E
Sbjct: 62 VGVSSVIDSIKTIVETIDEL---GPETKE 87

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  100 bits (250), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70
          LDH L L +PF   R + +A +VL+PDPIL+P+DF V Y ++G  LE  F   D RVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 71 GVSSVIDSLKTIIESLDELD 90
          GVSSVIDS+KTI+E++DELD
Sbjct: 64 GVSSVIDSVKTIVETIDELD 83

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  101 bits (251), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 61/86 (70%)

Query: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63
          K  R  +LDH L L +P ETP QA+IA + L+PDP+LKP+DF V Y+A    L   F   
Sbjct: 2  KNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSI 61

Query: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89
          D RVLRVGVSSVI+S+KTIIE++DE 
Sbjct: 62 DDRVLRVGVSSVIESVKTIIETMDEF 87

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  100 bits (250), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%)

Query: 9   AALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVL 68
               +T  L +PFET +QA IA++VL PDPILKPQDF   Y+++   + ARF   D RVL
Sbjct: 30  GMFQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVL 89

Query: 69  RVGVSSVIDSLKTIIESLDEL 89
           RVGVSSVIDS+KTIIE++DEL
Sbjct: 90  RVGVSSVIDSIKTIIETMDEL 110

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 63/88 (71%)

Query: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63
          K  R + L +TL L VPF+T +QA  A +VL+PDPILKPQDF V Y+++   L   F G 
Sbjct: 2  KGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGV 61

Query: 64 DARVLRVGVSSVIDSLKTIIESLDELDQ 91
          D RVLRVGVSSVI+S+KTIIE++DE   
Sbjct: 62 DDRVLRVGVSSVIESIKTIIETIDEFSH 89

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 98.2 bits (243), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 17 LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRVGVSSVI 76
          LN+PFET +QA IA+QVL+PDP L+P++F V Y++QG  L   F   D RVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 77 DSLKTIIESLDEL 89
          DS+KTIIE++DEL
Sbjct: 70 DSIKTIIETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 92.8 bits (229), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 61/80 (76%)

Query: 10 ALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69
          + +H+L L +PFE+ +QA +A +VL PDPI+KP+DF V+Y+ Q   L   F   D R+LR
Sbjct: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66

Query: 70 VGVSSVIDSLKTIIESLDEL 89
          VGV+SVI+S+KTI+E++DEL
Sbjct: 67 VGVNSVIESIKTIVETIDEL 86

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 91.7 bits (226), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%)

Query: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70
          +DHTL L+VPFE+ R A IA++ L PDP+L+P++ +VS+A+ G  L  +    DARVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 71 GVSSVIDSLKTIIESLDELD 90
            +S+ ++LKT++E+ DELD
Sbjct: 61 ATNSIFEALKTVVETADELD 80

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 90.9 bits (224), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 4/83 (4%)

Query: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSY----AAQGPCLEARFCGRDAR 66
          LD+TL + +PF   R A IA QVL PDPILKP+DF V Y          L  +F   D R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 67 VLRVGVSSVIDSLKTIIESLDEL 89
          VLRVGVSSV+DS+KTI+E++DEL
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 85.5 bits (210), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (65%), Gaps = 8/88 (9%)

Query: 10  ALDH-TLTL-------NVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFC 61
           +LDH +LTL        VPFE  +QA IA +VL  DP+L+P+DF V Y  Q   L   F 
Sbjct: 36  SLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFN 95

Query: 62  GRDARVLRVGVSSVIDSLKTIIESLDEL 89
             DAR LRVGVSSVI+S+KT++E++DE 
Sbjct: 96  SIDARSLRVGVSSVIESIKTVVETMDEF 123

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 68.9 bits (167), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 17 LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLR 69
          L+VPFET R ALIA +VLQPDPIL+P+DF V Y A+   L+  F   D RVLR
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>TBLA0B02590 Chr2 complement(592068..593969) [1902 bp, 633 aa] {ON}
           Anc_3.329 YPR048W
          Length = 633

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 9/47 (19%)

Query: 11  LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLE 57
           L+  L+L +P+E     L         PI+KP+ +++S A   PC+E
Sbjct: 400 LEDFLSLRLPWEYAADYL---------PIIKPRLYSISSAPNDPCIE 437

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,901,755
Number of extensions: 276315
Number of successful extensions: 797
Number of sequences better than 10.0: 24
Number of HSP's gapped: 796
Number of HSP's successfully gapped: 24
Length of query: 101
Length of database: 53,481,399
Length adjustment: 72
Effective length of query: 29
Effective length of database: 45,225,447
Effective search space: 1311537963
Effective search space used: 1311537963
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)