Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C066105.704ON38638620550.0
SAKL0E14960g5.704ON3843738371e-109
ZYRO0G06556g5.704ON3793597851e-101
NCAS0A031905.704ON3983667505e-96
TDEL0B021605.704ON3753087416e-95
KLTH0E01012g5.704ON3863897219e-92
KAFR0H002005.704ON3893457167e-91
Kwal_55.196885.704ON3933946872e-86
TPHA0D046205.704ON4063646793e-85
NDAI0E050505.704ON4513686772e-84
AFR288C5.704ON4653296471e-79
KLLA0A00550g5.704ON3803176364e-79
CAGL0G02519g5.704ON3783686052e-74
Kpol_YGOB_Anc_5.7045.704ON2072033927e-45
CAGL0L04554g6.48ON560175870.034
NDAI0K028706.48ON662107770.58
Kwal_23.64586.371ON868130760.78
AGR256W6.48ON579112750.87
TPHA0J005306.48ON589123741.2
NDAI0K024502.506ON66774741.3
Smik_12.3356.48ON678113731.9
Ecym_31386.48ON588127722.2
KNAG0M011106.48ON598109722.3
Skud_12.3406.48ON680113712.7
NCAS0F002306.48ON605110713.0
KAFR0G026206.48ON601127713.2
SAKL0E02068g6.48ON558108703.5
TBLA0G004306.48ON954108704.0
TPHA0F024906.48ON677113694.8
ZYRO0B05082g3.154ON61190695.3
KNAG0E027306.48ON748111695.8
Kwal_27.106047.436ON95082686.9
YLR260W (LCB5)6.48ON687113679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06610
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   796   0.0  
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   327   e-109
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   306   e-101
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    293   5e-96
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    290   6e-95
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   282   9e-92
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      280   7e-91
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   269   2e-86
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   266   3e-85
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   265   2e-84
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   253   1e-79
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   249   4e-79
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   237   2e-74
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   155   7e-45
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    38   0.034
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    34   0.58 
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    34   0.78 
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    33   0.87 
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    33   1.2  
NDAI0K02450 Chr11 (548252..550255) [2004 bp, 667 aa] {ON} Anc_2....    33   1.3  
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    33   1.9  
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    32   2.2  
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    32   2.3  
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    32   2.7  
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    32   3.0  
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    32   3.2  
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    32   3.5  
TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48 ...    32   4.0  
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    31   4.8  
ZYRO0B05082g Chr2 (412137..413972) [1836 bp, 611 aa] {ON} simila...    31   5.3  
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    31   5.8  
Kwal_27.10604 s27 complement(416254..419106) [2853 bp, 950 aa] {...    31   6.9  
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    30   9.1  

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQLFTRENLIVLDSVH 60
           MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQLFTRENLIVLDSVH
Sbjct: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQLFTRENLIVLDSVH 60

Query: 61  SGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDT 120
           SGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDT
Sbjct: 61  SGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDT 120

Query: 121 SVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFP 180
           SVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFP
Sbjct: 121 SVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFP 180

Query: 181 LYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQ 240
           LYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQ
Sbjct: 181 LYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQ 240

Query: 241 ITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMA 300
           ITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMA
Sbjct: 241 ITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMA 300

Query: 301 GYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQH 360
           GYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQH
Sbjct: 301 GYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQH 360

Query: 361 QEELTIQVELIDSALGSFDILVMGKH 386
           QEELTIQVELIDSALGSFDILVMGKH
Sbjct: 361 QEELTIQVELIDSALGSFDILVMGKH 386

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  327 bits (837), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/373 (43%), Positives = 242/373 (64%), Gaps = 5/373 (1%)

Query: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQLFTREN--LIVLDS 58
           M   V K L+       SV+I+KDGS Y+ F L +E      +        N  LI+LDS
Sbjct: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSLISLPSANSELIILDS 60

Query: 59  VHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSG 118
           V SG GR +  D +  VI+P+L +L A ++++K+Q+S S+AEF  +++P++SYTI+F+SG
Sbjct: 61  VMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSG 120

Query: 119 DTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAE 178
           DTS+SEF N +     + + +L I PI MGTGNA A+SLNL CPVE+F  FL+ +L+ ++
Sbjct: 121 DTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180

Query: 179 FPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQ 238
           FPLYRA  P+G  S +FFI+LS+GFHANLLH   + KYK MGVERF+ AS  I +NY L+
Sbjct: 181 FPLYRASFPNG-YSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLK 239

Query: 239 EQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERI 298
            ++++  + V+G YAYFA++N PNLE +Y PSP SDP    LHLL + SSL   +L++RI
Sbjct: 240 YKVSIPNR-VSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRI 298

Query: 299 MAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSD 358
             G   ++GD++  D    Y+++ + F+I +++     +   FE+C DGQL NLL  +  
Sbjct: 299 TRGRTAQKGDDIM-DTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGT 357

Query: 359 QHQEELTIQVELI 371
           +   + TI+V  +
Sbjct: 358 EGSFDGTIKVSFL 370

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  306 bits (785), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/359 (45%), Positives = 221/359 (61%), Gaps = 5/359 (1%)

Query: 19  VEIDKDGSKYTKFALLSEPCPQECAPPQLFTRENLIVLDSVHSGTGRTSGNDITVNVIEP 78
           V   KDGSKYT F L      Q            LIVLDS+ SG GRT  ND    VI P
Sbjct: 17  VTFAKDGSKYTSFQLEKSHAKQSSRASTRSDDSTLIVLDSLKSGIGRTENNDFYSIVIAP 76

Query: 79  VLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGAGVPSPRS 138
           +L  L+  +  +K+ +  SV++F   LDP Q Y I  +SGDT++SEF N +       R+
Sbjct: 77  ILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL-PNKKITRN 135

Query: 139 SLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFPLYRAILPDGETSVVFFIV 198
            L ILP+ MGTGNA ANSL  + P+ AF ++L   L   + PLYRA LP+G  S++FF++
Sbjct: 136 PLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG-YSIIFFMI 194

Query: 199 LSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQITLDKQGVAGSYAYFALV 258
            SLGFHANLLHA E+ KY  MG ERFQ A+  IL++Y L   I+LD  G+  SYAYFAL+
Sbjct: 195 FSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLD--GLRRSYAYFALI 252

Query: 259 NVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYKNRRGDELTADPYTTY 318
           N PNLEA+Y PSP+S+P + EL LL YSSSL R++L+E+IM GY+N+   +L  +    Y
Sbjct: 253 NTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGDLPTNEDMIY 312

Query: 319 KRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKS-DQHQEELTIQVELIDSALG 376
           K I+  F + L +  E  +   FE+C DG L NLL Y+S D+H+    I+ + ++   G
Sbjct: 313 KSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQFLNDYSG 371

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  293 bits (750), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 225/366 (61%), Gaps = 16/366 (4%)

Query: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSE-----PCPQECAPPQLFTRENLIV 55
           M  +++++L+    +   VE   +GS Y  F LL E        ++     L     LIV
Sbjct: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60

Query: 56  LDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILF 115
           +DS+HSG GRTS ND   NV+EP+  +L+  + +VK+ +  SV  F ++LD T+ Y I F
Sbjct: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120

Query: 116 VSGDTSVSEFFNGV---GAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172
           +SGDT++SEF NG+      V   ++SL+ILP   GTGNALANSL L CP   F+++L  
Sbjct: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180

Query: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232
                 FPLY+AI P+G   +VFF++LSLGFHANLLH  E   YK +GVERF+ AS DIL
Sbjct: 181 NYSINNFPLYKAIFPNGN-EIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDIL 239

Query: 233 QNYKLQEQITLDK-QGVAG-----SYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYS 286
            NY L   I+++  +G++       Y+YF +VN P LEA YIPSPQS+P + +LH++AYS
Sbjct: 240 ANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYS 299

Query: 287 SSLNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLD 346
           SSL + +L+ RI+ GY+N  GD +  +   TY  I + F IKL   QE      F+LC D
Sbjct: 300 SSLPKDELMARILKGYENNIGD-VVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCD 358

Query: 347 GQLYNL 352
           G L+NL
Sbjct: 359 GLLFNL 364

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  290 bits (741), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 144/308 (46%), Positives = 214/308 (69%), Gaps = 7/308 (2%)

Query: 52  NLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSY 111
           NLIV+DSVHSG GRT+ ND+   V++P+   ++  ++++K+ +  ++A + + LD +QS+
Sbjct: 48  NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSH 107

Query: 112 TILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLR 171
           T+LF+SGDTS+SEF N +  G PS  ++L+IL   MG+GNA A+SL + CPV+ F  F+R
Sbjct: 108 TVLFLSGDTSISEFINNLPQGAPS--ANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIR 165

Query: 172 GELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDI 231
           GE+  + FPLY+A+ P+G  S+VFFI+LS+GFHANL+HA E  +Y+ MG+E+FQ A   I
Sbjct: 166 GEMSHSPFPLYKAVFPNG-YSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVI 224

Query: 232 LQNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNR 291
           L+ Y+L  +IT++   +A SY+YFAL+N PNLE +Y PSP+SDP K EL+LL YSS L++
Sbjct: 225 LKEYELDLKITVN--SLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSK 282

Query: 292 KQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNK-QEGPNDPAFELCLDGQLY 350
            Q L ++M GY+    D+L  D  T Y   ++GF++ L     E P   + E+C DG L 
Sbjct: 283 DQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKS-EICCDGVLL 341

Query: 351 NLLQYKSD 358
           NL   ++D
Sbjct: 342 NLQDLQAD 349

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  282 bits (721), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 155/389 (39%), Positives = 241/389 (61%), Gaps = 11/389 (2%)

Query: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAP--PQLFTR--ENLIVL 56
           M   V   LV     +    ++ D +KYT F+L+S P     A   PQL TR  ++++++
Sbjct: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQL-TRGQKDILIV 59

Query: 57  DSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTIL-F 115
           DS+ SGTGR S N+   NV+EP+   L   ++VV++Q+S +  + G+   P+   TIL F
Sbjct: 60  DSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIF 119

Query: 116 VSGDTSVSEFFNGVGAGV-PSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGEL 174
           +SGDT++SEF NG+   V    R +L+++P+ +GTGNA ANSL L CP  + + FL+G+L
Sbjct: 120 LSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQL 179

Query: 175 VTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQN 234
              +FPLY+A  P+G   ++FFI+LS+GFHANLLH  + ++++S+GVERF+ AS +ILQ 
Sbjct: 180 TPRKFPLYKATFPNG-FEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQK 238

Query: 235 YKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQL 294
           Y L+ ++ +        Y+YFAL+N PNLEASY PSPQS+    +LH+L YSS L +  L
Sbjct: 239 YPLEYRLQVSGLPTR-DYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASL 297

Query: 295 LERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQ 354
           + +IM GY NR GD+++ D    Y+  +   E+      E  ++  FE+C DG L N+L 
Sbjct: 298 VSKIMKGYSNRAGDDISGDG-VIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLS 356

Query: 355 YKSDQHQEELTIQVELIDSALGSFDILVM 383
            +    + +  I+++ + +   SF++ VM
Sbjct: 357 LQPQDQKFDGRIRIQFLKN-FSSFELNVM 384

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  280 bits (716), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 213/345 (61%), Gaps = 11/345 (3%)

Query: 14  GERISVEIDKDGSKYTKFALLSEPCPQE--CAPPQLFTRENLIVLDSVHSGTGRTSGNDI 71
            +   V+I KDGSKY  F L+++    +  C+PP     EN++V+DSV SGTGR   N  
Sbjct: 17  SQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY---ENVVVIDSVSSGTGRNKNNHF 73

Query: 72  TVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGA 131
              VI+P+      ++   K+   KS++ +   LD ++SYT++F+SGDTS+SEF N +  
Sbjct: 74  YNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPP 133

Query: 132 GVPSP---RSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFPLYRAILPD 188
            + +    + +++ILP+ MGTGNA ++S+   CP++  +SFL      + FPLY  I P+
Sbjct: 134 LLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPN 193

Query: 189 GETSVVFFIVLSLGFHANLLHAAENE-KYKSMGVERFQEASGDILQNYKLQEQITLDKQG 247
           G+T V+FFI+LSLG HAN+LH  EN+ +YK  G ERF+ A   ++  Y L  ++ + +  
Sbjct: 194 GKT-VIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD 252

Query: 248 VAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYKNRRG 307
           ++G+++YF L+N PNLE+SYIPSP SDPF  +LH+L YSSSLN + LL  +  GY N+ G
Sbjct: 253 LSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLG 312

Query: 308 DELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNL 352
           DEL       YK IS    I L   +E      +++C DG L+NL
Sbjct: 313 DELVESSNMVYKPISRNVSIVLTEDEES-EKYKYDICCDGLLFNL 356

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  269 bits (687), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 228/394 (57%), Gaps = 14/394 (3%)

Query: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAP--PQLFTRE--NLIVL 56
           M   V   LV     + SV ++ +GSK   F+LL  P  Q  A   P+L +R+  +++V+
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60

Query: 57  DSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT-QSYTILF 115
           DS+ SGTGR   ND   NVI+PV   L   Y+VVK++N  SVAE G    P  Q+ T++F
Sbjct: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120

Query: 116 VSGDTSVSEFFNGVGA---GVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172
           +SGDTS+SEF N +     G   P  +L  LP  +GTGNA ANSL       A A FL+G
Sbjct: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALP--LGTGNAWANSLGFRTAATALAEFLQG 178

Query: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232
            L    FPLY+AI P+G   +VFFI+LS+GFHANLLH  +  ++K +GVERF+ AS +I 
Sbjct: 179 FLKPKNFPLYKAIFPNG-YEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237

Query: 233 QNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRK 292
           ++Y L   + + ++ +   Y+YFAL+N PNLE +Y PSP+S+P   ELHLL YSS L + 
Sbjct: 238 EDYILDYPLQVTQRPLE-HYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQP 296

Query: 293 QLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNL 352
            L+ RIM GY N+   ++  +   TY+  S   ++      E     AF++C DG L N+
Sbjct: 297 MLINRIMKGYSNQPETDINEEG-VTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNM 355

Query: 353 LQYKSDQHQEELTIQVELIDSALGSFDILVMGKH 386
           L  +      +  I V+ +     SF + V+ K+
Sbjct: 356 LSQQPAHGSFDGRIHVKFLKEH-SSFHLKVLSKY 388

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  266 bits (679), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 220/364 (60%), Gaps = 18/364 (4%)

Query: 6   RKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQ---LFTRENLIVLDSVHSG 62
           R  LV        V  +K GSKY+ F L S  C +E A  +   L     L+V+DS+ SG
Sbjct: 10  RLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSG 69

Query: 63  TGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSV 122
            GRT  ND   NV++PV +  + +++ ++++   S+ +   + + ++ YTI+F+SGDTSV
Sbjct: 70  VGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSV 129

Query: 123 SEFFNGVGA-------GVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELV 175
           SEF N +              +  + I  I +GTGNALA+S++L+ P + F  FL  EL+
Sbjct: 130 SEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELI 189

Query: 176 TAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNY 235
             +FPLY   LP+ +T ++FFI+ S+GFHANLLHA ++++Y+ MG ERF +AS +I +NY
Sbjct: 190 IKDFPLYTVTLPNKKT-IIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNY 248

Query: 236 KLQEQITLDK--QGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQ 293
            L   +T     + ++ +YAYFA++N PNLE +Y+PSP SD FK+ELHLL Y +SL+ ++
Sbjct: 249 DLNIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEK 308

Query: 294 LLERIMAGYKNRRGDEL-TADPYTTYKRIS---EGFEIKLQNKQEGPNDP-AFELCLDGQ 348
           L+ +IMAGY  +  +++   D  T Y  ++    G +I L+   +   +   +++C DG 
Sbjct: 309 LVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGL 368

Query: 349 LYNL 352
           L NL
Sbjct: 369 LLNL 372

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  265 bits (677), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 219/368 (59%), Gaps = 36/368 (9%)

Query: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQL-----DP 107
           LI++DS HSG GR   ND    ++EP+L +L+ ++++ K+ +  S+  F N       D 
Sbjct: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143

Query: 108 TQ-SYTILFVSGDTSVSEFFNGVGAGVP-SPRSSLTILPIAMGTGNALANSLNLNCPVEA 165
           T+  Y ++F+SGDT++SEFFN +    P + + +L IL I MGT NA +NSLNLNCP++ 
Sbjct: 144 TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203

Query: 166 FASFLRGELVTAEFPLYRAILPD------------GETSVVFFIVLSLGFHANLLHAAEN 213
           F  FL  +L  + FPLY  ILP             G+ ++ FFIVLS+GFHANLLH   N
Sbjct: 204 FQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263

Query: 214 -EKYKSMGVERFQEASGDILQNYKLQEQITL----DKQGVA--GSYAYFALVNVPNLEAS 266
            EKY ++G+ERF+ AS +IL NY L   IT+    DK  +    S++YF L+N P LE +
Sbjct: 264 DEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYN 323

Query: 267 YIPSPQSDPFKHELHLLAYSSS-LNRKQLLERIMAGYKNRRGDE----LTADPYTTYKRI 321
           YIPSP SDP K+ LH+LAY S   N++QL++ IM GY N  G +    +  D    +   
Sbjct: 324 YIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPIN 383

Query: 322 SEGFEIKLQNKQEGPNDPA----FELCLDGQLYNLLQYKSDQ-HQEELTIQVELIDSALG 376
            + F+I L N     +  +    +ELC DG L+NLL Y+++Q  Q++++ ++E   + + 
Sbjct: 384 DKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGKQDKISFEIEANSNKIS 443

Query: 377 SFDILVMG 384
           SF I  + 
Sbjct: 444 SFRIFALS 451

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  253 bits (647), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 203/329 (61%), Gaps = 15/329 (4%)

Query: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112
           L+VLDSV SG GR    D    V+ PVL  L   ++ V++ ++ SV E       T   T
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 113 ILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172
           +L +SGDT++SEF N +G+G     + +T+  + +GT NA A+S+ L  P +A  +F++G
Sbjct: 197 VLVMSGDTTISEFVNALGSG-----AGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 251

Query: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232
            +    FPLYRA  P G  S+ FFIVLS GFHANLLH   +E+Y+ +GVERF+EAS +IL
Sbjct: 252 RVHAVPFPLYRARFPSG-YSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEIL 310

Query: 233 QNYKLQEQITL----DKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSS 288
             Y L E + +      + +AG YAYFAL+N P+LE +Y+PSP SDP   +LH+LA+ + 
Sbjct: 311 DRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAE 370

Query: 289 LNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDP-AFELCLDG 347
           L+R +L E +MAGY   RG  L+A P   Y+ + + F + ++N   G +D  A ELC+DG
Sbjct: 371 LSRDKLNELLMAGYSTIRGSALSA-PGLVYRNLGDSFTLSIEN---GASDRVANELCVDG 426

Query: 348 QLYNLLQYKSDQHQEELTIQVELIDSALG 376
            L NL+  ++     + +I+V ++ ++ G
Sbjct: 427 HLLNLVDLQAPGDVFDGSIEVGVVPASFG 455

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  249 bits (636), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 202/317 (63%), Gaps = 10/317 (3%)

Query: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112
           L+++DSV SG+GR    D   NVI     ++   Y+++K+ +  SV E  + +D T+ YT
Sbjct: 61  LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120

Query: 113 ILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172
           +LF+SGDTS+SEF N +    P     +++LP  MGTGNA A+SL L  P   F+ F+ G
Sbjct: 121 VLFLSGDTSISEFVNNL----PLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNG 176

Query: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232
           +L   +FPLYRA   +G   + FFI+LSLGFHANLLH  E ++Y+ MG+ERF+ AS  IL
Sbjct: 177 KLSCNDFPLYRATFDNGYV-LKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRIL 235

Query: 233 QNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRK 292
           + YKL+ ++++    + GS++YFAL+N  NLE +Y+PSP SDP + +LH+LAY SSL+R 
Sbjct: 236 REYKLESRVSI-PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRV 294

Query: 293 QLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNL 352
           +  +R+  GY N +   +  +  T Y+ +   F +++ +     ++  FE+C DGQL NL
Sbjct: 295 EFQKRVFMGYSNTKHSNILQNG-TFYRPLPFCFNVEVLDDPSQKSN--FEVCCDGQLLNL 351

Query: 353 LQYKSDQHQEELTIQVE 369
           L+ +  ++    TI++E
Sbjct: 352 LELEG-KNTPPSTIRIE 367

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  237 bits (605), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 219/368 (59%), Gaps = 16/368 (4%)

Query: 9   LVDFC---GERISVEIDKDGSKYTKFALL-SEPCPQECAPPQLFTREN-LIVLDSVHSGT 63
           +V+ C   G + SVEI +   K   + L+ +     +C     F R+  +IV+DSV SGT
Sbjct: 4   IVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLK--FDRDTQIIVIDSVKSGT 61

Query: 64  GRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQ--LDPTQSYTILFVSGDTS 121
            R   +D+   VIEP+ + L   Y+ +K+++  S+ +F  +        Y ILF+SGDTS
Sbjct: 62  SRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTS 121

Query: 122 VSEFFNGVGAGV-PSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFP 180
           +SEF N +   +  S +  ++ILP+ +G+GNALA SL    P++A  ++L      +  P
Sbjct: 122 ISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLP 181

Query: 181 LYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQ 240
           LY A LP+  TS++FFI+LSLGFHANLLH AE+ KYKSMGVERFQ AS  + ++Y L   
Sbjct: 182 LYDAQLPNS-TSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVG 240

Query: 241 ITLDKQGV-AGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIM 299
           I ++  G+ + SY+YFA++  PNLE +Y PSP+S   K ELH+L Y + +  + L ++IM
Sbjct: 241 IAVN--GLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIM 298

Query: 300 AGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQ 359
            GY N+ G+++  +  T Y+   +  E+ ++     P    +++C+DG L NL    S  
Sbjct: 299 RGYHNKDGEDI-QEIGTIYQCFQKNLELSIKTGHNAPK-YRYDMCIDGYLLNLEDCNSKD 356

Query: 360 HQEELTIQ 367
           ++ ++ I+
Sbjct: 357 NEYKILIR 364

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  155 bits (392), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 8/203 (3%)

Query: 184 AILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQEQITL 243
           A  PD ++ + FFI+LSLGFHA LLHA    +   MG ERFQ A+ +IL+ Y L   I +
Sbjct: 2   ATFPD-DSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV 60

Query: 244 DKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYK 303
           +K      YAYFA++N  NLE +Y PSP+S+  ++ L LL YSS L+R +L+++IM GY 
Sbjct: 61  NKS--TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYI 118

Query: 304 NRRGDELTADPYTTYKRIS---EGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSDQH 360
            R+GD +  D YT Y+ +     G +I +  K    N   FE+C DG L +L++ KS   
Sbjct: 119 IRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME-KSKGR 177

Query: 361 QEELTIQVELIDSALGSFDILVM 383
            + LTI +  +   L SFD+ V+
Sbjct: 178 TDNLTIHINSVKDYL-SFDLQVL 199

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 73/175 (41%), Gaps = 5/175 (2%)

Query: 52  NLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSY 111
           +++V+ + H G G+     I    IEP+L      +++++++ S+   +   ++D  +  
Sbjct: 169 SILVIINPHGGKGK--AMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFD 226

Query: 112 TILFVSGDTSVSEFFNG--VGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASF 169
           TI   SGD    E  NG  +        + +T+  +  G+GNA++ S +      +FA+ 
Sbjct: 227 TIACASGDGVPYEVINGLYMREDKVDAFNKITVTQLPCGSGNAMSISCHWT-DNPSFAAL 285

Query: 170 LRGELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERF 224
              + V +   L     PD E        LS  +          E  + MG  RF
Sbjct: 286 CLVKSVESRIDLMLCTQPDSEDPEPKLSFLSQTYGVIAESDINTEFIRWMGPLRF 340

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 50  RENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQ 109
           + +++++ + H G G+ S   +     +P+L   + +++++ +  S    +    LD ++
Sbjct: 260 QRSILIIINPHGGKGKASK--LFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISK 317

Query: 110 SYTILFVSGDTSVSEFFNGV--GAGVPSPRSSLTILPIAMGTGNALA 154
              I   SGD    E  NG+          + LTI  I  G+GNA++
Sbjct: 318 YDIIACASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSGNAMS 364

>Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR047W
           - Hypothetical ORF [contig 18] FULL
          Length = 868

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 51/130 (39%), Gaps = 14/130 (10%)

Query: 45  PQLFTRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQ 104
           P      NLI   +  +G   +     T N  EP  +   AR   V+S N      F  Q
Sbjct: 193 PSHVQHANLIAKSATRNGEAISD----TSNGSEPAAKNRTARADTVRSSN----PYFAFQ 244

Query: 105 LDPTQSYTILFVS-GDTSVS-EFFNGVGAGVPSPRSSLTILPIAMGTGNALA----NSLN 158
             P  +Y+   +S GD S S + +  VG   P P SS        G G  L+    N +N
Sbjct: 245 GLPVHAYSSQNLSAGDVSGSNQTYTSVGLMTPPPTSSTATTSYFYGDGQVLSNQSLNDIN 304

Query: 159 LNCPVEAFAS 168
            N  VE F S
Sbjct: 305 ENEEVEIFKS 314

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           T+ N  +L  ++   G+   + + V   +P+L     +  VV+++ S   AE    +D  
Sbjct: 190 TKRNKSILVIINPYGGKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATMDIN 249

Query: 109 QSYTILFVSGDTSVSEFFNGV--GAGVPSPRSSLTILPIAMGTGNALANSLN 158
           +   I   SGD    E  NG+       +  + L I  +  G+GNA++ S +
Sbjct: 250 KYDVIACASGDGIPHEVLNGLFTRPDRVAAFNKLAITQLPCGSGNAMSISCH 301

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 56/123 (45%), Gaps = 5/123 (4%)

Query: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112
           ++V+ + H G G  +   I ++  EP+L+   A   +  ++ +    +   ++D ++  T
Sbjct: 203 ILVIVNPHGGKG--NAKKIYLSKCEPILKASTATVDIAYTKYAGHAIDIAREVDLSKYDT 260

Query: 113 ILFVSGDTSVSEFFNGVG--AGVPSPRSSLTILPIAMGTGNALANSLNLNC-PVEAFASF 169
           I   SGD    E  NG+   +      + L +  I  G+GNA++ S +    P  A    
Sbjct: 261 IACASGDGIPYEVINGLNQRSDRVDAFNKLAVTQIPCGSGNAMSVSCHWTTDPSLATLCV 320

Query: 170 LRG 172
           L+G
Sbjct: 321 LKG 323

>NDAI0K02450 Chr11 (548252..550255) [2004 bp, 667 aa] {ON} Anc_2.506
           YKL005C
          Length = 667

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 82  RLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGAGVPSPRSSLT 141
           + H     +KSQN K +  FGN+ DP  +Y  LF  G  S S+ F+ +     S  SS  
Sbjct: 510 KYHGISHSIKSQNVKQLNIFGNEYDPKGNYK-LFAEGRLSSSKAFDYLDQIKSS--SSRV 566

Query: 142 ILPIAMGTGNALAN 155
           IL   +   N  AN
Sbjct: 567 ILIYQLFQTNDHAN 580

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 2/113 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           TR N  +   ++   G+     + +   +P+L       +VV ++      E   ++D  
Sbjct: 256 TRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASQCSIEVVYTKYPGHAIEIAREMDID 315

Query: 109 QSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALANSLNL 159
           Q  TI   SGD    E  NG+       ++   L I  I  G+GNA++ S + 
Sbjct: 316 QYDTIACASGDGIPHEVINGLYRRPDHVKAFNKLAITEIPCGSGNAMSVSCHW 368

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           T+ N  +L  ++   GR   N I V   +P+L       +V ++   +   E    +D  
Sbjct: 197 TKRNKSILVIINPHGGRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDID 256

Query: 109 QSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALANSLN-LNCPVEA 165
           +   I   SGD    E  NG+       ++   + +  +  G+GNA++ S +  N P  A
Sbjct: 257 KYDVIACASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVSCHGTNNPAYA 316

Query: 166 FASFLRG 172
             S ++ 
Sbjct: 317 ALSLVKA 323

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 48/109 (44%), Gaps = 2/109 (1%)

Query: 50  RENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQ 109
           R N  +L  ++   G+    ++      P+L    + Y +  ++ S+   E    LD  +
Sbjct: 187 RRNKKMLVIINPFGGKGQAKNLFFQRAAPILDASGSDYDIAYTERSRHAVEIAESLDIDK 246

Query: 110 SYTILFVSGDTSVSEFFNGVGAGVP--SPRSSLTILPIAMGTGNALANS 156
             TI+  SGD    E  NG+   +   +  + + +  +  G+GNA++ S
Sbjct: 247 YDTIVCASGDGIPYEVLNGLYRRIDRVAAFNKIVVTQLPCGSGNAMSIS 295

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 48/113 (42%), Gaps = 2/113 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           TR+N  +   ++   G+     + +   +P+L       +VV ++      E   ++D  
Sbjct: 256 TRKNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDID 315

Query: 109 QSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALANSLNL 159
           +  TI   SGD    E  NG+       ++   L I  I  G+GNA++ S + 
Sbjct: 316 KYDTIACASGDGIPHEVINGLYRRPDRVKAFNQLAITEIPCGSGNAMSVSCHW 368

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 50/110 (45%), Gaps = 4/110 (3%)

Query: 52  NLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSY 111
           +++V+ + H G G+     +     +P+L   +   +++ ++ S+   +    LD T+  
Sbjct: 221 SILVIINPHGGKGKAKL--LFEKKAKPILIASNCSLEIIHTKYSRHALDIAKDLDITKYD 278

Query: 112 TILFVSGDTSVSEFFNGV--GAGVPSPRSSLTILPIAMGTGNALANSLNL 159
            I   SGD    E  NG+          + LTI  +  G+GNA++ S + 
Sbjct: 279 VIACASGDGIPYEVINGLYQRPDRADAFNKLTITQVPCGSGNAMSISCHW 328

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 50  RENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQ 109
            ++L+++ + H G G+     +    +EP+L+    +++V  ++  +   +   +LD  +
Sbjct: 226 NKSLLIIINPHGGKGKALK--LFQEHVEPILKLTFFKFEVKLTEYHRHAMQIARKLDLDK 283

Query: 110 SYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALANSLN-LNCPVEAF 166
             TI+  SGD    E  NG+        +   L +  +  G+GNA++ S +    P  A 
Sbjct: 284 FDTIVCASGDGIPYEVINGLYQRTDRSNAFNKLCVTQLPCGSGNAMSISCHGTGNPSHAT 343

Query: 167 ASFLRGE 173
            S L+ +
Sbjct: 344 LSLLKSQ 350

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 51  ENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQS 110
           ++++V+ + H G GR   N + V+  +P+L       +++++   +   +    +D  + 
Sbjct: 180 KSILVIINPHGGKGR--ANKLYVSKAKPILIASQCTVEILETTYHRHAIDIAQNIDIDKY 237

Query: 111 YTILFVSGDTSVSEFFNGV--GAGVPSPRSSLTILPIAMGTGNALANS 156
             I   SGD    E  NG+   A      + + I  +  G+GNA++ S
Sbjct: 238 DVIACASGDGIPHEVLNGLYRRADRAKAFNKVAITQLPCGSGNAMSVS 285

>TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48
           YOR171C
          Length = 954

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 2/108 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           ++ N  +L  ++   G+     + +   +P+L     +  V  ++ ++   + G  LD  
Sbjct: 573 SKRNRSILVIINQFGGKGKAKKMFITKAKPILLASGCKIDVTYTRYARHAIDIGKHLDID 632

Query: 109 QSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALA 154
           +  TIL  SGD    E  NG+       ++   L I  +  G+GNA++
Sbjct: 633 KYDTILCASGDGIPYEIINGLYQRPDRAKAFEKLAITELPCGSGNAMS 680

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 49/113 (43%), Gaps = 2/113 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           TR N  +L  ++   G+ +   +  +  +P+L     +  +V ++ +        ++D  
Sbjct: 285 TRRNRKILAIINEFGGKGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEMDIN 344

Query: 109 QSYTILFVSGDTSVSEFFNGV--GAGVPSPRSSLTILPIAMGTGNALANSLNL 159
           +  TI+  SGD    E  NG+       +  S L I  +  G+ NA++ S + 
Sbjct: 345 KYDTIVCASGDGIPYEIINGLYQRKDRAAAFSKLAITQLPCGSANAMSVSCHW 397

>ZYRO0B05082g Chr2 (412137..413972) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q12362 Saccharomyces cerevisiae and weakly
           similar to YDL036C uniprot|Q12069 Saccharomyces
           cerevisiae YDL036C Hypothetical ORF
          Length = 611

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 269 PSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIK 328
           PSP S  F  E HLL    S+   QL +R     ++    + T    T   R   GF+++
Sbjct: 23  PSPSSHEF--EKHLLKEIESVKTDQLNKRKRKQIESSSKSQKTK-AQTNELRDENGFKLR 79

Query: 329 L---QNKQEGPNDPAFELCLDGQLYNLLQY 355
           +    NK+    DP +E+ +DG L  +  Y
Sbjct: 80  VVEVNNKRSRQVDPDYEVVVDGPLRRITPY 109

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 87  YQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILP 144
           + +V ++ S    E    +D  +  TI   SGD    E  NG+       R+   L I  
Sbjct: 388 FDLVYTKYSGHAIEIAKNMDIEKYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITE 447

Query: 145 IAMGTGNALANSLNL-NCPVEAFASFL-------RGELVTAEFPLYRAILP 187
           I  G+GNA++ S N  N P  ++A+         R +++    P Y A +P
Sbjct: 448 IPCGSGNAMSVSCNWTNNP--SYATLFIIKSVETRSDIMCLSQPSYEAGVP 496

>Kwal_27.10604 s27 complement(416254..419106) [2853 bp, 950 aa] {ON}
           YBL101C (ECM21) - involved in cell wall biogenesis
           [contig 34] FULL
          Length = 950

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 8/82 (9%)

Query: 86  RYQVVKSQNSKSVAEFG-------NQLDPTQSYTILFVSGDTSVSEFFNGVGAGVP-SPR 137
           +Y V+  ++SKSV  +G       +Q +P Q YT    S  + V  FF G  A  P   R
Sbjct: 647 KYSVLDKRSSKSVPPYGIDEFTSVHQPNPPQGYTPRRNSATSGVIGFFAGRRASTPFRSR 706

Query: 138 SSLTILPIAMGTGNALANSLNL 159
            +  + P A  +     +S NL
Sbjct: 707 HNSIVAPEAKRSKTFFKSSSNL 728

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 2/113 (1%)

Query: 49  TRENLIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT 108
           TR N  +   ++   G+     + +   +P+L       +VV ++      E   ++D  
Sbjct: 265 TRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDID 324

Query: 109 QSYTILFVSGDTSVSEFFNGVGAGVPSPRS--SLTILPIAMGTGNALANSLNL 159
           +  TI   SGD    E  NG+       ++  ++ I  I  G+GNA++ S + 
Sbjct: 325 KYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAITEIPCGSGNAMSVSCHW 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,441,753
Number of extensions: 1774527
Number of successful extensions: 4697
Number of sequences better than 10.0: 52
Number of HSP's gapped: 4765
Number of HSP's successfully gapped: 55
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)