Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C065905.702ON1651165182800.0
TDEL0B021905.702ON1810153111301e-127
NCAS0A032005.702ON1788146310881e-121
ZYRO0G06600g5.702ON1820144410521e-116
SAKL0E14916g5.702ON1779139010041e-110
Skud_11.3345.702ON188513959351e-102
Smik_11.3585.702ON187815339054e-98
YKR095W (MLP1)5.702ON187513718706e-94
CAGL0G02497g5.702ON178014178662e-93
Suva_11.3315.702ON189814158555e-92
KLTH0E01056g5.702ON177116388511e-91
Ecym_40185.702ON176914378143e-87
Kwal_55.196975.702ON176013028118e-87
AFR286W5.702ON175813477662e-81
KLLA0A00594g5.702ON174813767207e-76
NDAI0E050405.702ON197314127191e-75
TBLA0E017305.702ON182013785831e-59
KAFR0D022205.702ON167413555034e-50
KNAG0L021405.702ON160813944855e-48
Suva_9.395.702ON168215694641e-45
YIL149C (MLP2)5.702ON167915964434e-43
Skud_9.195.702ON168015663943e-37
Smik_9.205.702ON168215953908e-37
KAFR0H002105.702ON14547713371e-30
Kpol_1043.705.702ON13213483163e-28
NCAS0G002305.702ON17356332976e-26
TPHA0E002305.702ON12844672903e-25
NDAI0F002905.702ON15542172492e-20
TPHA0D046105.702ON11832071831e-12
Kpol_2001.755.702ON10065511373e-07
KAFR0E040105.414ON905384970.016
Skud_4.1964.238ON1792404930.057
YDL058W (USO1)4.238ON1790325910.088
YDR356W (SPC110)5.414ON944289870.25
KNAG0A078803.479ON764177860.28
KLLA0D06875g8.636ON462192840.43
Kpol_1059.308.636ON457176840.49
CAGL0L08338g2.215ON161115790.59
YJL071W (ARG2)1.301ON574132820.91
KAFR0K015903.438ON110353801.7
Ecym_53454.238ON1366166801.8
ZYRO0F10714g8.604ON70896791.9
NCAS0G004405.670ON69965782.6
TDEL0A038305.519ON805180782.8
CAGL0A02596g5.414ON872525782.9
YNL079C (TPM1)2.215ON199105753.0
TDEL0B044308.168ON110594773.2
Kpol_1032.308.191ON40743763.6
KLTH0B09482g5.20ON69473773.7
ZYRO0A11132gsingletonON698122764.0
KAFR0B046702.315ON344112754.8
CAGL0D05258g7.186ON1170284764.9
YHR045W5.287ON560117754.9
Kwal_YGOB_33.147272.144ON838129755.3
Smik_14.2472.215ON199105735.5
KLTH0E08206g4.124ON21936735.6
ABR149W7.488ON1226273756.6
Skud_14.2512.215ON19947726.9
AER045C4.238ON1292380748.1
Suva_2.707.488ON1380256748.2
Kpol_483.114.238ON254671748.3
YAL047C (SPC72)7.21ON622254738.4
Kwal_33.14730singletonOFF587129738.4
NDAI0D030504.327ON89761748.6
Suva_2.5285.414ON944728748.6
TDEL0B064802.559ON126571748.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06590
         (1651 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...  3194   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   439   e-127
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   423   e-121
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   409   e-116
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   391   e-110
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   364   e-102
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   353   4e-98
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   339   6e-94
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   338   2e-93
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   333   5e-92
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   332   1e-91
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   318   3e-87
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   317   8e-87
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   299   2e-81
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   281   7e-76
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   281   1e-75
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   229   1e-59
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   198   4e-50
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   191   5e-48
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   183   1e-45
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   175   4e-43
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   156   3e-37
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   154   8e-37
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   134   1e-30
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   126   3e-28
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   119   6e-26
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   116   3e-25
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   100   2e-20
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    75   1e-12
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    57   3e-07
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    42   0.016
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    40   0.057
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    40   0.088
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    38   0.25 
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...    38   0.28 
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    37   0.43 
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    37   0.49 
CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {...    35   0.59 
YJL071W Chr10 (306132..307856) [1725 bp, 574 aa] {ON}  ARG2Acety...    36   0.91 
KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON} Anc_3...    35   1.7  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    35   1.8  
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    35   1.9  
NCAS0G00440 Chr7 complement(75305..77404) [2100 bp, 699 aa] {ON}...    35   2.6  
TDEL0A03830 Chr1 (678643..681060) [2418 bp, 805 aa] {ON} Anc_5.5...    35   2.8  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    35   2.9  
YNL079C Chr14 complement(478566..479165) [600 bp, 199 aa] {ON}  ...    33   3.0  
TDEL0B04430 Chr2 complement(779080..782397) [3318 bp, 1105 aa] {...    34   3.2  
Kpol_1032.30 s1032 complement(69806..71029) [1224 bp, 407 aa] {O...    34   3.6  
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...    34   3.7  
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    34   4.0  
KAFR0B04670 Chr2 (972408..973442) [1035 bp, 344 aa] {ON} Anc_2.3...    33   4.8  
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    34   4.9  
YHR045W Chr8 (195551..197233) [1683 bp, 560 aa] {ON} Putative pr...    33   4.9  
Kwal_YGOB_33.14727 s33 (792991..793587,793589..795508) [2517 bp,...    33   5.3  
Smik_14.247 Chr14 complement(458876..459475) [600 bp, 199 aa] {O...    33   5.5  
KLTH0E08206g Chr5 (752883..753542) [660 bp, 219 aa] {ON} similar...    33   5.6  
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    33   6.6  
Skud_14.251 Chr14 complement(468833..469432) [600 bp, 199 aa] {O...    32   6.9  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    33   8.1  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   8.2  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    33   8.3  
YAL047C Chr1 complement(54989..56857) [1869 bp, 622 aa] {ON}  SP...    33   8.4  
Kwal_33.14730 s33 (793745..795508) [1764 bp, 587 aa] {OFF} YNL12...    33   8.4  
NDAI0D03050 Chr4 complement(718700..721393) [2694 bp, 897 aa] {O...    33   8.6  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    33   8.6  
TDEL0B06480 Chr2 (1144036..1147833) [3798 bp, 1265 aa] {ON} Anc_...    33   8.8  

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score = 3194 bits (8280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1606/1651 (97%), Positives = 1606/1651 (97%)

Query: 1    MSSGETAGELCSLLGLPMDTVNGLPLAVQNAIASKFTSERQTVRTVEGRMELIVEENRLL 60
            MSSGETAGELCSLLGLPMDTVNGLPLAVQNAIASKFTSERQTVRTVEGRMELIVEENRLL
Sbjct: 1    MSSGETAGELCSLLGLPMDTVNGLPLAVQNAIASKFTSERQTVRTVEGRMELIVEENRLL 60

Query: 61   KSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRXXXXXXXXXXXXXXXXXXXXXSER 120
            KSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALR                     SER
Sbjct: 61   KSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAELENLQNDLELLKDKDLALQSER 120

Query: 121  DSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRLAKSER 180
            DSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRLAKSER
Sbjct: 121  DSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRLAKSER 180

Query: 181  ASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEA 240
            ASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEA
Sbjct: 181  ASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEA 240

Query: 241  KLVGHXXXXXXXXXXXXXXVALQQRSHSISMDSLLTGNDETSHSMSEXXXXXXXXXXRLK 300
            KLVGH              VALQQRSHSISMDSLLTGNDETSHSMSE          RLK
Sbjct: 241  KLVGHETEPEYEIPPPGEEVALQQRSHSISMDSLLTGNDETSHSMSELNNNISILSNRLK 300

Query: 301  RETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQ 360
            RETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQ
Sbjct: 301  RETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQ 360

Query: 361  EVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSSEFSYIKEILNT 420
            EVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSSEFSYIKEILNT
Sbjct: 361  EVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSSEFSYIKEILNT 420

Query: 421  DPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI 480
            DPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI
Sbjct: 421  DPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI 480

Query: 481  EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALK 540
            EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALK
Sbjct: 481  EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALK 540

Query: 541  NKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSK 600
            NKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSK
Sbjct: 541  NKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSK 600

Query: 601  NENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQS 660
            NENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQS
Sbjct: 601  NENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQS 660

Query: 661  SIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKID 720
            SIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKID
Sbjct: 661  SIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKID 720

Query: 721  TKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQ 780
            TKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQ
Sbjct: 721  TKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQ 780

Query: 781  EANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVL 840
            EANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVL
Sbjct: 781  EANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVL 840

Query: 841  NERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDY 900
            NERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDY
Sbjct: 841  NERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDY 900

Query: 901  TAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEK 960
            TAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEK
Sbjct: 901  TAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEK 960

Query: 961  ELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRK 1020
            ELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRK
Sbjct: 961  ELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRK 1020

Query: 1021 LSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEE 1080
            LSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEE
Sbjct: 1021 LSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEE 1080

Query: 1081 HIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMK 1140
            HIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMK
Sbjct: 1081 HIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMK 1140

Query: 1141 LMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFG 1200
            LMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFG
Sbjct: 1141 LMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFG 1200

Query: 1201 RLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSA 1260
            RLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSA
Sbjct: 1201 RLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSA 1260

Query: 1261 VMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQ 1320
            VMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQ
Sbjct: 1261 VMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQ 1320

Query: 1321 GNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEK 1380
            GNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEK
Sbjct: 1321 GNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEK 1380

Query: 1381 TRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQN 1440
            TRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQN
Sbjct: 1381 TRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQN 1440

Query: 1441 RVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAE 1500
            RVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAE
Sbjct: 1441 RVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAE 1500

Query: 1501 SKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFTTPVSRGA 1560
            SKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFTTPVSRGA
Sbjct: 1501 SKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFTTPVSRGA 1560

Query: 1561 AHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPG 1620
            AHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPG
Sbjct: 1561 AHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPG 1620

Query: 1621 EGESNLKSPSKKTRSVSEESSGDSTGDISDE 1651
            EGESNLKSPSKKTRSVSEESSGDSTGDISDE
Sbjct: 1621 EGESNLKSPSKKTRSVSEESSGDSTGDISDE 1651

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  439 bits (1130), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 443/1531 (28%), Positives = 781/1531 (51%), Gaps = 172/1531 (11%)

Query: 172  ELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQE 231
            + +L KS R  L+ + + +SQ+L  +  +I++L D     + E++ E++L++    L  E
Sbjct: 247  DYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDE 306

Query: 232  QVASLEKEAKLVGHXXXXXXXXXXXXXXVA----------------------LQQRSHSI 269
            Q+ S ++E +L                  A                      LQ   + +
Sbjct: 307  QLQSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEV 366

Query: 270  SMDSLLTGNDETSH-SMSEXXXXXXXXXXRLKRETLSKQKLEKQVHKFVTELEQTAPIIK 328
              DS     D T++ S+ +          +L +E   K+ L++Q+  FV ELE   P+I 
Sbjct: 367  MGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVIN 426

Query: 329  SFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLAR 388
            S K++S   + ++  + L LEH + +KE   +E+E    +++Q+      L R+R DLAR
Sbjct: 427  SLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLAR 486

Query: 389  QLQYLLLNGFVK-DSDDPLTSSEFSYIKEIL-NTDPEEGNTSSTDSQLIISKRMLKFKSI 446
            Q+Q+LL NG ++ DS  PLT+ E ++IK+I+ N +P    ++ +DSQ II++R+++FK I
Sbjct: 487  QVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP----SNESDSQSIITERLVEFKDI 542

Query: 447  VELQQQNINLLSAVRTLSDRAETLERKLE-SGDSIE--AINEAKQTLLDLQQYNSSLEAK 503
              LQ++N  LL   RTL+DR E  E+      DS+E   I+EAK+ ++ LQ+ NS +E+K
Sbjct: 543  ATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESK 602

Query: 504  VESLTNKLKA--------NEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIG 555
            V ++  +  A        ++ F ++GD +       +   I++L++K  +L  E+S+   
Sbjct: 603  VSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNE 662

Query: 556  HLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQ 615
             L  +I NL QSK+ L    E   +S+ L EDRLK+ Q  L+++KNEN+ L  R      
Sbjct: 663  LLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQS 722

Query: 616  ALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNN 675
             L ++E    +T+ KY+ C +KL V++ +  N   EK +LQ++  S+  ++ +   ERN+
Sbjct: 723  ILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNS 782

Query: 676  FQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKA 735
               ++ QL+ LQ  ++  LK+ Q S +  I  LE++ +EL+ +I +K+    ++    +A
Sbjct: 783  LNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRA 842

Query: 736  ELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETV 795
            + +W+Q K D +S     + +++    +T+  L ++   L   ++E++S+   + + +T+
Sbjct: 843  QTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSR---IASYKTL 899

Query: 796  DDVNKLTGALETELATSRTRLTDTSREL-----------EISSN---TIRQYQSEI---- 837
            +D     G  ET     R  L  T  EL           +ISS    T++   +E     
Sbjct: 900  NDA----GNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERT 955

Query: 838  --------KVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIR 889
                    K L E+  +LE    +L+  I  L +E        E EK  ++KKL +LE  
Sbjct: 956  EALKSNAEKYLAEK-VQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESS 1014

Query: 890  QAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVR---EVQNRNTETYRNELE- 945
            +  L +++++Y  ++ +L+ DL++Q       +  ++EE++   EV ++     R+E++ 
Sbjct: 1015 EHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEV-SKIISQLRSEVQS 1073

Query: 946  -LVEIRQTKVFVEKEKE-LESRIK-ILNEQIELD------KERMKQFSDEESLLREQVKL 996
               EI+Q K   ++ KE LE+  K   N++ ELD      K ++   S +  LL  QV+L
Sbjct: 1074 GRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVEL 1133

Query: 997  LADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVL 1056
            L+  K+    +  + P  ++L+  L  E+  LE+KL  S+ E+  L ++    E E+A  
Sbjct: 1134 LS--KSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELA-- 1189

Query: 1057 NMNYEQAKKEVAAEVNNESGRAE---------EHIAQLESLKESNMSLTNEVKLAQMRNG 1107
                 +A+K++     N+S  ++         E + Q+  L+ESN++L N V  AQ +N 
Sbjct: 1190 -----EARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNS 1244

Query: 1108 EIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSS 1167
            ++ +ELN L++K   + S+L E R  +  KD +++ L  E  R K  SHD+ +   K   
Sbjct: 1245 DLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDP 1304

Query: 1168 SELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETL 1227
             E    L+  ++ L ++++     NT+L DRF RLK+QA E+L+ASK+   +L   V  L
Sbjct: 1305 EE-YRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNEL 1363

Query: 1228 TKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETS 1287
               KT ++++++ ++ ++  L   + E    SA  ++L+ EL   + + K+IE +L ET 
Sbjct: 1364 QGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETV 1423

Query: 1288 KSSNQLTTALNEEIESLKHEVQYLKEA-SSAEPQGNEEMSGVVESMRKAFEDEKIAFMKA 1346
             SS  LT+ LNEEI SLK +V+  KE  + +  +G++ +S VVESM+KAFE+EKI F++ 
Sbjct: 1424 GSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQE 1483

Query: 1347 TSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQ 1406
             +E+   +  EE+ K                     L  EN +  +  S  PD+ +L+KQ
Sbjct: 1484 KTEEYNKKFEEEKAK---------------------LSSENGSPAEPVS-APDVNSLKKQ 1521

Query: 1407 WEASN---------------KERLVLLYKEKSDQMMRAKMDELEEQFQNRVR-------- 1443
            WE                  K+R+ +  +E+  +++  +  ELEE+FQ R++        
Sbjct: 1522 WEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEG 1581

Query: 1444 NKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKA 1503
               KE   LK ++E + +  +++ L + KK+AFEEGKQQA MK ++LERKI+KLE++  +
Sbjct: 1582 GDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNS 1641

Query: 1504 TKSGSD---MSVSEDAPRFVTPNNNKVQQANQPFLA------TAGSGFSVQ-SSESNPFT 1553
            + + +     + S   P  +  +  +      P         +    FS Q SS+SNPFT
Sbjct: 1642 SNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFT 1701

Query: 1554 TPVSRG---------AAHTNASSQSKFAPTF 1575
            + +             + T  SSQ +  PTF
Sbjct: 1702 SALPGNNNVFGMKPTFSFTPGSSQPESRPTF 1732

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  423 bits (1088), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 404/1463 (27%), Positives = 745/1463 (50%), Gaps = 176/1463 (12%)

Query: 299  LKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETI 358
            L +E   K+KL+ QV  F+ ELE+  P I SFKQ+++  + ++    L LE++ ++K  +
Sbjct: 378  LIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQV 437

Query: 359  FQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEI 417
              E++  ++  + +  + K L ++R DLA QLQY+L++  V+ DS+ PL++ E  +I++I
Sbjct: 438  TNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDI 497

Query: 418  LNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESG 477
            L+    E N  S+DSQ +IS+R++ F++IVELQQ+NI+LL +VR L+ + E  E   +S 
Sbjct: 498  LDN---ESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQST 554

Query: 478  DSI---EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFG-------- 526
              +   +AI+EAK+ ++ LQ YN+ LE K+++L ++L     + S+   +          
Sbjct: 555  SQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDC---YKSLPKPDTKVETEHLRL 611

Query: 527  ---NSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKH 583
               N+DL     I+ L+ +  +   ES++T   L ++I++++++ S   KEC++   S+ 
Sbjct: 612  NEENTDL-----IKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRE 666

Query: 584  LIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQR 643
            L E RLK+ Q+ L LSK EN  L+ R++       +++  T +T+K+Y+ C   L   Q 
Sbjct: 667  LAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQN 726

Query: 644  QLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQN 703
            +L     + +I +  + S+++ +    KERN  + L+ QL++LQ  +++     ++  Q 
Sbjct: 727  ELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQT 786

Query: 704  KIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECAS 763
            ++D +E E  ++  K+  K+       +N  +E+EWYQ K D++    DA  ++++E  +
Sbjct: 787  RLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTN 846

Query: 764  TIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRE- 822
             I  L  + + L   LQ + S+    +     D+V      L+ EL  S+  L++   E 
Sbjct: 847  EIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAEL 906

Query: 823  -------------LEISSNTI----RQYQSEIKVLNERQSELENENKHLRDEIAILRDEL 865
                         LE   NT+    +++  +I+ L + + EL +    L ++I  L +EL
Sbjct: 907  DQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNEL 966

Query: 866  THNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAH 925
             H       EK  + KKL+ L  +   + ++   Y  ++  L+ DL++QA       +A 
Sbjct: 967  DHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYA---NIAQ 1023

Query: 926  DEEVREVQNR------------NTETYRNELELVEIRQT---KVFVEKEKELESRIKILN 970
            +   +E+Q              +  TYR +++ ++   T   ++  + EK  E + K   
Sbjct: 1024 NNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYE 1083

Query: 971  EQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLES 1030
            +QI   K+R++  S +  LL +QV LL+  + S    +  +P   DLV  L  ++  L++
Sbjct: 1084 DQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPN-EDLVLSLRSDRDILQT 1142

Query: 1031 KLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH------IAQ 1084
            +L  ++ E   LR +L+   +E+     N      E+  +  N     EEH      + Q
Sbjct: 1143 RLSVTEEEGKALRLKLSSVNTELT----NTRAKLTEIRQQYENTKISVEEHDNIMNQLNQ 1198

Query: 1085 LESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMEL 1144
            L  L+ESN++L NE   ++ +  ++  +L  L+ K   +E++ +  + V+   + +L   
Sbjct: 1199 LNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAY 1258

Query: 1145 QTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKR 1204
            + EC+R K  S D+     K    E    L++ +ATL + + + K  N EL DRF R+K+
Sbjct: 1259 KEECNRWKQRSQDILTKHKKIDPVE-HEKLEAEIATLKQNLADKKKENEELNDRFNRIKK 1317

Query: 1205 QARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKE 1264
            QA ERL++SK T  +L D ++ L  +   +Q ++E  +  +     K ++  + S  +  
Sbjct: 1318 QAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTA 1377

Query: 1265 LKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP--QGN 1322
            L+++L   +  +K+ E + N + KSS+++++ LN+ I+SL +E+ +LKE+ + E    G 
Sbjct: 1378 LRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQ 1437

Query: 1323 EEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREM---------------- 1366
             ++S VVE M+K+FE+EKI F++  + + + +LAEE  +++ +                 
Sbjct: 1438 PDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISA 1497

Query: 1367 --EALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSD 1424
              E  EKE + +V+++    EEN                        K R+ L  +EK +
Sbjct: 1498 QREQWEKEYEEIVLKRIEQAEENL-----------------------KRRIRLPTEEKIN 1534

Query: 1425 QMMRAKMDELEEQFQNRVRNKEKELNA----------LKDEIEEKCKTGHEDTLIAVKKR 1474
             +++ K +ELE+++  +V  + KEL +          LK++I+++ +   +  L   K +
Sbjct: 1535 SVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAK 1594

Query: 1475 AFEEGKQQATMKMSILERKIAKLEAE----SKATKSGSDMSVSEDAPR------------ 1518
            AFEEGKQQA MK + LE+KI+KLE++    + A ++ +D+ V    P             
Sbjct: 1595 AFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEET 1654

Query: 1519 FVTPNNNKVQQANQPFLATAGSGFSVQSSE-----------SNPFTTPV--SRGAAHTNA 1565
               P  +K+Q AN P L+T G+  ++  S            SNPFT+P   ++  A+  A
Sbjct: 1655 LSKPQLSKIQIAN-PLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPA 1713

Query: 1566 SSQSKFAPTFLLN--SQPPVLVSG---SSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPG 1620
             +Q    P FLL   S+P + VS     S  + +T     V  + G A PS    +KRP 
Sbjct: 1714 VTQ----PAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSE-GLATPS----SKRPA 1764

Query: 1621 EGES-----NLKSPSKKTRSVSE 1638
            + ++     + ++P KK+++  E
Sbjct: 1765 QEDTEEEKLDAETPKKKSKTEPE 1787

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  409 bits (1052), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 415/1444 (28%), Positives = 745/1444 (51%), Gaps = 161/1444 (11%)

Query: 299  LKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETI 358
            L +E   K++L++QV  F+ ELE   P+I SFK+++   + +++ + L L+H + +KE  
Sbjct: 407  LIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKR 466

Query: 359  FQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEI 417
             +E E   K+++        L R+R DLA Q+Q+LL+N  V+ DS   L++ E S+IK I
Sbjct: 467  EREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRI 526

Query: 418  LNTD-PEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER---- 472
            +N D P     S +DSQ +IS+R+++F +I  LQ++N+ LL  VR L+++ E+ E+    
Sbjct: 527  VNNDDP----NSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNK 582

Query: 473  KLESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTS----------IGD 522
            K+++ ++ + I EAK+ ++ LQ YN++LE+KVE LT +  A +   S            +
Sbjct: 583  KIQTFEN-DTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSAN 641

Query: 523  GEFGNSD-LSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINS 581
            G  GN +  SD   ++ L+ +  SL  ESS+    L ++I+ L +SK+ ++ E E   +S
Sbjct: 642  GTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSS 701

Query: 582  KHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVI 641
            K L E+RLK+ Q  L+L++NEN  L  R +N       ++  T++T+ + + C +KL V+
Sbjct: 702  KTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVL 761

Query: 642  QRQLENTLVEKDILQNAQ-SSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVS 700
            + ++ N   EK++LQ+++ +S EN L  + +ERN+ + ++ QL+ LQ  +++ LK+IQ +
Sbjct: 762  ETKVANLETEKELLQSSERTSRENYLKLS-EERNSLRIMVSQLQTLQSEREKFLKEIQTT 820

Query: 701  LQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIE 760
             +  +D LE E  + R ++D K         + + +++WYQ K DS+   +  L +++  
Sbjct: 821  YKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQT 880

Query: 761  CASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTG---------ALETELAT 811
                +  L  + + L+  ++E+       EAR  +     L+G         +L  EL  
Sbjct: 881  KTFLVTDLESEVRKLEKQVEES-------EAR--IQSYQVLSGSEVETSPESSLRKELEK 931

Query: 812  SRTRLTDTSRELEISSNTI-----------RQYQSEIKVLNERQSELENENKHLRDEIAI 860
            ++  L+DT  E++   N +           + Y S  + L  +   L+NE   L+D +A 
Sbjct: 932  TKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAK 991

Query: 861  LRDELTH-------NGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDK 913
            L + +T             E EK  L KK++ LE       +L+E+Y A+I KL+ DL++
Sbjct: 992  LNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQ 1051

Query: 914  QAMLGKEIKLAHDEEVREVQNRNT-------ETYRNELELVEIRQT-----KVFVEKEKE 961
            QA      +  ++EE+++  N +        ++ ++ + +  ++ +     +V  + EK 
Sbjct: 1052 QASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKS 1111

Query: 962  LESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKL 1021
              ++ +    Q+E  ++ ++  S + SLL +Q++L + +  SD V+ G + E  +++  L
Sbjct: 1112 WSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDN-SDGVN-GETAEVREILTNL 1169

Query: 1022 SDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVA--AEVNNESGRAE 1079
              E+  L +KL  SQ E+  LR  L   E+E+        Q +KE+   +E+  +  +  
Sbjct: 1170 RRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKII 1229

Query: 1080 EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDM 1139
            E + QL  L+ESN++L N  +    +N E+  ELN+L+ +   +ES+L+     +  KD 
Sbjct: 1230 EQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQ 1289

Query: 1140 KLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRF 1199
            +L   + E +R K  S ++    ++    E    L+  V+ L  ++D     N EL+DRF
Sbjct: 1290 QLNLYKEEANRWKERSQEILHKHDR-IDPEDHKELKEKVSILETKLDETNKENKELDDRF 1348

Query: 1200 GRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETS 1259
             RLK+QA E+L++SK+   +L + +  L + K+ L+   E  + +++EL+ ++  H   +
Sbjct: 1349 NRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDT 1408

Query: 1260 AVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP 1319
              ++ ++ EL+  +  ++++E  L+ T + + ++T  LN+EI+SLK E+  LKE S+A  
Sbjct: 1409 ETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATA 1468

Query: 1320 QG--NEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERG----------------K 1361
            +G  +E++S VVESMR++FE+EKI F+K  +E+ +    E+                  +
Sbjct: 1469 KGEISEDLSNVVESMRRSFEEEKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQPVNYEE 1528

Query: 1362 LKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKE 1421
            +KR+ E+   E++  ++++    EEN                        K+R+ L  +E
Sbjct: 1529 IKRQWES---EQEESILKRIAEAEENL-----------------------KKRIRLPTEE 1562

Query: 1422 KSDQMMRAKMDELEEQFQNRVRNKEKELNA-------LKDEIEEKCKTGHEDTLIAVKKR 1474
            +  Q++  K   LEE ++ ++   +  L +       LK ++E+  +   E  + AVKK+
Sbjct: 1563 RIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQEKFEAEVQAVKKK 1622

Query: 1475 AFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDA----PRFVTPNNNKVQQA 1530
            AFEEGKQQA MK ++LERKI+KLE++        D S SE +    P   +  + K    
Sbjct: 1623 AFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTT 1682

Query: 1531 NQPFLATAGSG------------FSVQS-SESNPFT-TPVSRGAAHTNASSQSKFAPTFL 1576
            NQ       SG            F+  S S  NPFT +P +     T+A     F PTF 
Sbjct: 1683 NQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFG---FKPTFT 1739

Query: 1577 L----NSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENN----KRPGEGESNLKS 1628
            L    N      +  SS E+      +S  E  G + P    +N      PGEG S   +
Sbjct: 1740 LSNNSNKSSGTKIDSSSTENKPANPFSSFTE-TGASSPERESSNTAMTPTPGEGAS---T 1795

Query: 1629 PSKK 1632
            PSK+
Sbjct: 1796 PSKR 1799

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  391 bits (1004), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 412/1390 (29%), Positives = 713/1390 (51%), Gaps = 143/1390 (10%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
            RL +E   K++L+ QV  FV ELE   P++ SFK+++E  + ++  + L LE  +KDKE 
Sbjct: 400  RLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEE 459

Query: 358  IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKE 416
               E+   K ++     Q   L R+R DLA Q+Q+LL+   V+ DS+ PLT  E ++IK+
Sbjct: 460  KEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKK 519

Query: 417  ILNTD--PEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDR---AETLE 471
            I+N+   P E      D+Q IIS+R+++F+S+VELQ++N+ LL+++R L+D+    E   
Sbjct: 520  IINSSESPVEQ-----DAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKES 574

Query: 472  RKLESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLS 531
            +        E + EAK+ +L LQ+YN SLE+++E +  +  A +   S      G S+++
Sbjct: 575  KSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVN 634

Query: 532  DGNN---------IQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSK 582
               N         I+ L+N   SL  ES++ I  L  +I++L ++++D +   E   +S+
Sbjct: 635  SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSR 694

Query: 583  HLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQ 642
             L EDR K+  + L+++K EN  LR R  +  + + +++ +T QTI+  + C ++L  +Q
Sbjct: 695  ILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQ 754

Query: 643  RQLENTLVEKDILQNAQSSIENKLNQAL-KERNNFQGLIPQLRALQKNQDEQLKDIQVSL 701
             QL N+  E+D+L++ Q +++ K N++L +ERNN + LI QL+ LQ  ++  L++ Q + 
Sbjct: 755  SQLNNSQSERDLLRSIQENLK-KENESLSEERNNMRILITQLQTLQTERESLLEETQKNF 813

Query: 702  QNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALN---EKM 758
            Q K + LE E ++   K+D K    S  ++   ++ +WYQ KFD L   N+ LN   EK+
Sbjct: 814  QGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRL---NEELNNSREKL 870

Query: 759  IECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTD 818
                + I+ L +K ++L+  L+E+ ++ +   A    + V   T  L  EL  +R +L D
Sbjct: 871  SSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLAD 930

Query: 819  TSRELEI----------SSNTIR--------QYQSEIKVLNERQSELENENKHLRDEIAI 860
               ++E           S+  I+        +Y  +I+ L + +   +++   L+D+I+ 
Sbjct: 931  AYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISN 990

Query: 861  LRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKE 920
            L +EL H   +FE +     + L +L+ +Q+EL  ++ +Y  +I K++ DL++Q      
Sbjct: 991  LNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANT 1050

Query: 921  IKLAHDEEVR--------------EVQNRN--TETYRNELELVEIRQTKVFVEKEKELES 964
             +  +++E++              E Q     TET RN  E       K   + E   E 
Sbjct: 1051 AQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAE----NAKKALEQSELSWEK 1106

Query: 965  RIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVD-AGVSPEYTDLVRKLSD 1023
            +     +++ L  +R++  + +  +L +Q+  L+  K +   D   +S E  +L+  L  
Sbjct: 1107 QSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRR 1166

Query: 1024 EKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHIA 1083
            EK  LE+KL  S  E+  LR++L   ES++       E +K + AA  N+ + + +E I 
Sbjct: 1167 EKDILETKLEVSTREEKVLRQKLKLIESDLE--GSRIELSKLQRAASGNSATLKDQEEIM 1224

Query: 1084 ----QLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDM 1139
                QL  L+ESN++L NE +    R+ E+ AEL+ L  K + +ES++   +N +  KD+
Sbjct: 1225 TQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDL 1284

Query: 1140 KLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRF 1199
            ++     E  R K  S D+     +    E    L   V+ L +++ +    N EL+ RF
Sbjct: 1285 QISLKNEEAERWKQRSQDILHKYERIDPEE-HQKLADKVSELQQEIKSKSDENEELDTRF 1343

Query: 1200 GRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIE-- 1257
             RLK+QA E+L+A+K   ++L   +  L   K  L++ +   K+E+  L +KI + IE  
Sbjct: 1344 KRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITD-IEKN 1402

Query: 1258 TSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKE---- 1313
             S+   +L+ +L    +K  + E +L + + SS  L   LNE IESL ++++ L+E    
Sbjct: 1403 KSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEK 1462

Query: 1314 ASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEK 1373
            A +  P    + S +VE+  K  E+ KI F     E+ +A++  ++    RE    E+EK
Sbjct: 1463 AKTESPNDGSQSSELVENTSKIVENLKIEF-----EEEKAKMISDKESELREQ--FEEEK 1515

Query: 1374 DSLVMEKTRLGEENTALMKARSDVP-DIETLQKQWE------------ASN---KERLVL 1417
             S++  K +   E  A  K   D P +I+ ++K+WE             SN   K+R+ L
Sbjct: 1516 ASILEAKEQELREQLATQKL--DPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRL 1573

Query: 1418 LYKEKSDQMMRAKMDELEEQFQNRVRNKEKE----------------------LNALKDE 1455
              +EK ++++  K  ELE +F+  V+ K +E                      L  LK E
Sbjct: 1574 PTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQE 1633

Query: 1456 IEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSED 1515
            +++K     ++ +  +KKRAFEEGKQQA+MK + LE+KIAKLE + KA  S   ++ +  
Sbjct: 1634 MQKKF----DEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSS 1689

Query: 1516 A-PRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNP--FTTPVSRGAAHTNASSQSKFA 1572
            A P    P    V+Q   P L    +    +    NP  F   +  G   +N+     F 
Sbjct: 1690 ATPAESGPTTQDVKQLT-PILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNS-----FQ 1743

Query: 1573 PTFLLNSQPP 1582
              F  NSQPP
Sbjct: 1744 NPF--NSQPP 1751

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 92/198 (46%), Gaps = 2/198 (1%)

Query: 43  VRTVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRXXXXXX 102
           V  ++ ++  + ++N + +SS  D+ +++ E+  ++   +DE   +   T  LR      
Sbjct: 117 VNLLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLEL 176

Query: 103 XXXXXXXXXXXXXXXSERDSTVALLDGLKLENSALRAEI-EQAKELASIRQHDYEADLDS 161
                          +E       ++ LK  N  L  E+  +++E  S RQ    ++L +
Sbjct: 177 ENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQR-VNSELQT 235

Query: 162 KTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINL 221
               L S   EL + +S   +L S+   LSQ+L  +  +++ L D+  + + E+T E+ L
Sbjct: 236 ALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTL 295

Query: 222 QKHRARLLQEQVASLEKE 239
           ++    LL++Q+ S + E
Sbjct: 296 KQRLIDLLEKQIESFKTE 313

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  364 bits (935), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 385/1395 (27%), Positives = 718/1395 (51%), Gaps = 145/1395 (10%)

Query: 301  RETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQ 360
            +E  +K++L+ Q+  F+ ELE   P+I SFK++++  + +++   L LEH + +K    +
Sbjct: 395  KEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIR 454

Query: 361  EVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFSYIKEILN 419
            E+    +++ +      IL R+R DL RQ+QYLL+ N    DS  PL   E  +I+ IL 
Sbjct: 455  ELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQ 514

Query: 420  TDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDS 479
             D     T+ +DSQ I++ R+++F++++ELQ++N  LL   R L+D+ E+ E  ++S  +
Sbjct: 515  NDN--SGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNE--IKSKQN 570

Query: 480  I-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSD-- 532
            +     + INEAK+ +L LQ    SLE+KVE L  + +  +   S     F NS +    
Sbjct: 571  LLKIENKTINEAKEAILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLT 630

Query: 533  ------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIE 586
                   + +Q L+ +   +  ES++ +  L  +I ++  SKSD++ E     +S+ L E
Sbjct: 631  KTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAE 690

Query: 587  DRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLE 646
            +R K+  + LDL+K EN  LR R  +   ++ +++ +T +T+ +Y+ C +KL V +  L 
Sbjct: 691  ERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALS 750

Query: 647  NTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKID 706
            N  +E+ +  +++ S++ +L++   E+ + + ++ QL+ LQK +++ L + + S QNKI+
Sbjct: 751  NLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKIN 810

Query: 707  DLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIE 766
            ++E    EL+ +   K+        +  +++EWYQ K ++L   ND++   + E  + IE
Sbjct: 811  EVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIE 870

Query: 767  TLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSREL--- 823
             L  K ++L+  ++E    NK+      V D      +L  EL  S+  LT+   ++   
Sbjct: 871  KLQYKVKSLEKEIEE----NKIRLHTYNVMDETINDDSLRKELEMSKINLTEAYSQIQEY 926

Query: 824  ----EISSNTIRQYQSEIKVLNERQSE----LENENKHLRDEIAILR-------DELTHN 868
                E ++ ++R+  S++   NE  S     L +E  +L D++++L+       +EL   
Sbjct: 927  KKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQ 986

Query: 869  GGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEE 928
              E E++K    K ++ L+    E+  ++ +Y +++ K++ DLD+Q +     +  +++E
Sbjct: 987  KNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQE 1046

Query: 929  VR---EVQNRNTE------TYRNELELVEIRQTK---VFVEKEKELESRIKILNEQIELD 976
            ++   +V    +E      TYR +++ + + +++   +  E EK   S+ + L EQ++L 
Sbjct: 1047 LQKHADVSKTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLS 1106

Query: 977  KERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEY-TDLVRKLSDEKKNLESKLFAS 1035
              R++  S +  LL  Q++L      + + DA   P    D++  L  E+  L++K+  +
Sbjct: 1107 NSRIEDLSSQNKLLYNQIELYT-AAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVA 1165

Query: 1036 QSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNM 1093
            + +   LR+++T  + E+  A   +N  + + +  + +  +     E + QL  L+ESN+
Sbjct: 1166 ERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNI 1225

Query: 1094 SLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKA 1153
            +L NE++    +N E+ +EL +LK     +ES+L   +  +  K+ ++   + E  R K 
Sbjct: 1226 TLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKK 1285

Query: 1154 TSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDAS 1213
             S D+ +   + SS++    L+S V +L  Q+++     TE E+RF RL+RQA+E+L  S
Sbjct: 1286 RSQDILEKHQQLSSND-YEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTS 1344

Query: 1214 KVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKE------LKT 1267
            K+T  +L + +  L   K AL    ERS   LN+   +IQE +E   V ++      +K 
Sbjct: 1345 KLTQETLTEQLNELKDAKVAL----ERS---LNDANTRIQE-LEGEKVAEDNNRSEMIKR 1396

Query: 1268 ELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEV----QYLKEASSAEPQGNE 1323
                    ++++E +L E + S +     LNEEI +LK E+    Q  K+  +A    +E
Sbjct: 1397 SQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRDE 1456

Query: 1324 EMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKR----EMEALEKE-KDSLVM 1378
            ++S +VESM+K+FE++KI F++  + +   ++ E + +L +     ++ ++K+ +     
Sbjct: 1457 DLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSSVNIDEMKKQWEAEHEE 1516

Query: 1379 EKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEK----------SDQM-- 1426
            E      E    +K R  +P  E + K  E   KE L   + EK          S+QM  
Sbjct: 1517 EVAERVREAEEALKKRIRLPTEEKISKIIERK-KEDLEKEFNEKLEEKVKSISGSEQMEA 1575

Query: 1427 ---------MRAKMDELEEQFQNRVRNKEKEL-----------NALKDEIEEKCKTGHED 1466
                     ++ K  ELE+++  +++ K KE+           + L+ EIE K +    D
Sbjct: 1576 MLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELND 1635

Query: 1467 TLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFV--TPN- 1523
             L  VKK++FEEGKQQATMK ++LERK+AK+E++    K       +E  P+     PN 
Sbjct: 1636 ELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQS-----AESPPKHANNVPNP 1690

Query: 1524 ----NNKVQQ-ANQPFLATAGSG-----FSVQSSES---NPFTTP----------VSRGA 1560
                  K+++ +N PF  T  SG     F+ +SS S   NPFT+P          V +  
Sbjct: 1691 LLGLPRKIEENSNSPF-NTLLSGEKLLKFNSKSSSSGAFNPFTSPSPKKLLQKDDVQKET 1749

Query: 1561 AHTNASSQSKFAPTF 1575
            ++      +  AP+F
Sbjct: 1750 SNNKTDPPTHLAPSF 1764

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  353 bits (905), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 406/1533 (26%), Positives = 762/1533 (49%), Gaps = 155/1533 (10%)

Query: 172  ELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQE 231
            + ++ K++   L  + + LS+ L ++  +I+ L D     + E++ EINL++    LL+ 
Sbjct: 249  DFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLES 308

Query: 232  QVASLEKE-------------AKLVGHXXXXXXXXXXXXXXVALQQRSHSISMDSLLTGN 278
            Q+ ++++E              K +                +A Q +S  I + S++   
Sbjct: 309  QLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELA-QCKSECIRLSSIIGET 367

Query: 279  DE-TSHSMSEXXXXXXXXXXRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQS 337
            DE +  S S           +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++  
Sbjct: 368  DEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTL 427

Query: 338  DAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-N 396
            + +++   L LEH + +K    +E+    ++L+Q     + L ++R DL RQ+QYLL+ N
Sbjct: 428  ENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITN 487

Query: 397  GFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINL 456
               KDS  PL   E  +I+ IL  D +    + TDSQ I+++R+++F+SI+ELQ++N  L
Sbjct: 488  SVSKDSKGPLRKEEIMFIQNILQNDSDTA--TETDSQKIVTERLVEFRSIIELQEKNTEL 545

Query: 457  LSAVRTLSDRAETLERKLESGDSI-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKL 511
            L  VR L+DR E+ E   ES  S+     E INEAK+ +L L+     LE+KVE L  + 
Sbjct: 546  LKIVRNLADRLESNEN--ESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKEC 603

Query: 512  KANEHFTSIGDGEFGNSDLSDGN--------NIQALKNKYDSLMAESSETIGHLYSQINN 563
            + ++   S  +    NS +   N         IQ L++    +  ES+E +  L  +I +
Sbjct: 604  ENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQD 663

Query: 564  LQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVE 623
            L  SKSD++ +     +S+ L E+R K+  + LDL+K EN  LR R       + +++ +
Sbjct: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723

Query: 624  TSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQL 683
            T +T+ +Y+ C +KL++ + +L N   E+ +  +++ +++ ++ +   E+   + ++ QL
Sbjct: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783

Query: 684  RALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTK 743
            + LQK ++  L + + S QNKID+LE  + EL+ +   K+        +  + +EWYQ K
Sbjct: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNK 843

Query: 744  FDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTG 803
             + L   N+++   M +  + IE L  K ++L+  + E    NK+      V D      
Sbjct: 844  IEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDE----NKIRLHTYNVIDGTINDD 899

Query: 804  ALETELATSRTRLTDTSREL-------EISSNTIRQYQSEI----KVLNERQSELENENK 852
            +L  EL  S+  LTD   ++       E ++ +++Q  S+     K  + R   L NE  
Sbjct: 900  SLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKS 959

Query: 853  HLRDEIAILRDELTHNGGEFE-------REKEALMKKLSNLEIRQAELTKLEEDYTAEIE 905
             L ++I++L++++ +   E +        EK    KK+S L+    E+  ++ +Y +++ 
Sbjct: 960  SLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLS 1019

Query: 906  KLKLDLDKQAMLGKEIKLAHDEEVR---EVQNRNTE------TYR---NELELVEIRQTK 953
            K++ DLD+Q +     +  +++E++   +V    +E      TYR   N L L   +   
Sbjct: 1020 KIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLES 1079

Query: 954  VFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVS 1011
               E E+   S+ K L EQ+E    R++  + +  LL +Q++L   AD+  +D  D    
Sbjct: 1080 TLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK--- 1136

Query: 1012 PEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAA 1069
            P    ++  L  E+  L++K+  ++ +   LR++++  + E+  A   ++  + ++E   
Sbjct: 1137 PALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRP 1196

Query: 1070 EVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDE 1129
             +  +     E + QL  L+ESN++L NE++        + +EL++LK     +ES+L  
Sbjct: 1197 TIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAA 1256

Query: 1130 ARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLK 1189
             +  +  K+ +L   + E  R K  S D+ +   + SSS+    L+  + +L  ++D   
Sbjct: 1257 LKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSD-YEKLEHEIDSLKVKLDEKT 1315

Query: 1190 HANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNEL- 1248
                E E+RF RL+RQA+ERL  SK+++++L + V  L   K  L+  ++ +  ++ EL 
Sbjct: 1316 RQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELE 1375

Query: 1249 RAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEV 1308
             AK ++       +K L+ +     + +K+ + +L E +   +     LNEEI +L+ E+
Sbjct: 1376 NAKAEQDNNQLDAIKRLQQD---AENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEI 1432

Query: 1309 Q---YLKEASSAEPQGNEE--MSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLK 1363
            +    +++   +EP  NE+  +S +VESM+K FE++KI F++  +++   ++ E + +L 
Sbjct: 1433 EKQRRIQQQLQSEP-ANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN 1491

Query: 1364 R-------EMEALEK-EKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERL 1415
            +       E++   K E +  V+ + R  EE    +K R  +P  E + K  E   +E L
Sbjct: 1492 QPSNINIDELKIKWKAEHEEEVVNRIREAEE---ALKKRIRLPTEEKISKIIERK-REDL 1547

Query: 1416 VLLYKEKSDQMMR-----AKMD-ELEEQFQNRVRNKEKEL-------------------- 1449
               + EK ++ ++      +MD   ++QF+ R++ K+KEL                    
Sbjct: 1548 EKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISID 1607

Query: 1450 --NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSG 1507
              + L+ EIE K +   ++ L  +KK++FEEGKQQA MK ++LERK+AK+E++   TK  
Sbjct: 1608 ERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK-- 1665

Query: 1508 SDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFS-VQSSES--------------NPF 1552
                ++E   + V    N++    +     + S F+ + S E               NPF
Sbjct: 1666 ---KITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPF 1722

Query: 1553 TTPVSRGAAH---------TN-ASSQSKFAPTF 1575
            T+P    ++          TN A   +   P+F
Sbjct: 1723 TSPSPNKSSQKVDDQRELTTNKADPPTHLTPSF 1755

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  339 bits (870), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 358/1371 (26%), Positives = 715/1371 (52%), Gaps = 143/1371 (10%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
            +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++  + +++   L LEH + +K  
Sbjct: 392  QLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNA 451

Query: 358  IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFSYIKE 416
              +E+    ++L +     + L ++R DL RQ+QYLL+ N    DS  PL   E  +I+ 
Sbjct: 452  KVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQN 511

Query: 417  ILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLE----- 471
            I+  D  +   + +DSQ ++++R+++FK+I++LQ++N  LL  VR L+D+ E+ E     
Sbjct: 512  IMQED--DSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQ 569

Query: 472  --RKLESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSD 529
              +K+ES    E +NEAK+ ++ L+     LE+++E L  +L+  +      D  + N  
Sbjct: 570  SLQKIES----ETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVT 625

Query: 530  LSD--------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINS 581
            +           + +Q L+ +   +  ES+E +  L  +I +L  SKSD++ +     +S
Sbjct: 626  IKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSS 685

Query: 582  KHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVI 641
            + L E+R K+  + LDL+K EN  LR R       + +++ +T +T+ +Y+ C +KL ++
Sbjct: 686  RILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIV 745

Query: 642  QRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSL 701
            + +L N   E+ +  + + +++ +LN+   E+++ + ++ QL+ LQK +++ L++ + S 
Sbjct: 746  ETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSC 805

Query: 702  QNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIEC 761
            Q KID+LE   +EL+ +   K+        +  + +EWYQ K ++L    +++   +   
Sbjct: 806  QKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865

Query: 762  ASTIETLTVKTQTLDILLQEANSKNKLLEAR-ETVDDVNKLTGALETELATSRTRLTDTS 820
             + IE L  K ++L+  ++E   +        ET++D      +L  EL  S+  LTD  
Sbjct: 866  QTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIND-----DSLRKELEKSKINLTDAY 920

Query: 821  REL-------EISSNTIRQ-----------YQSEIKVLNERQSELENENKHLRDEIAILR 862
             ++       E +S +++Q           + ++IK L + ++ LE++   L++++  L 
Sbjct: 921  SQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLN 980

Query: 863  DELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIK 922
            +EL       E+EK    K++S L+    E+  ++ +Y +++ K++ DLD+Q +     +
Sbjct: 981  NELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQ 1040

Query: 923  LAHDEEVR---EVQNRNTE------TYRNELELVEIRQTKV---FVEKEKELESRIKILN 970
              +++E++   +V    +E      TY+ +++ + + + ++     E EK   S+ + L 
Sbjct: 1041 NNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLL 1100

Query: 971  EQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVSPEYTDLVRKLSDEKKNL 1028
            EQ++L   R++  S +  LL +Q+++   AD++ ++  +    P   +++  L  E+  L
Sbjct: 1101 EQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG---PGLNNILITLRRERDIL 1157

Query: 1029 ESKLFASQSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLE 1086
            ++K+  ++ +   LR++++  + E+  A   ++  + +KE  + +  +     E + QL 
Sbjct: 1158 DTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLN 1217

Query: 1087 SLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQT 1146
             L+ESN++L NE++    +  E+ +EL++LK     +ES+L   +  +  K+ +L   + 
Sbjct: 1218 LLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKE 1277

Query: 1147 ECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQA 1206
            E  R K  S D+ +   + SSS+    L+S +  L E+++N +    E E++F RL+RQA
Sbjct: 1278 EVHRWKKRSQDILEKHEQLSSSD-YEKLESEIENLKEELENKERQGAEAEEKFNRLRRQA 1336

Query: 1207 RERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELR-AKIQEHIETSAVMKEL 1265
            +ERL  SK++ +SL + V +L   K  L++ +  +   + EL+ AK+ +       +++L
Sbjct: 1337 QERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKL 1396

Query: 1266 KTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQ------YLKEASSAEP 1319
            + +       +++++A+L E++ S       LNEEI +LK E++         +A+SA  
Sbjct: 1397 QEDAEKA---SRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANE 1453

Query: 1320 QGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKR----EMEALEK---- 1371
            Q   ++S +VESM+K+FE++KI F+K  +++   ++ E + +L +     ME ++K    
Sbjct: 1454 QN--DLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNINMEEIKKKWES 1511

Query: 1372 EKDSLVMEKTRLGEENTALMKARSDVPDIETLQ----------------------KQWEA 1409
            E +  V +K R  EE    +K R  +P  E +                       K  E 
Sbjct: 1512 EHEQEVSQKIREAEE---ALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQ 1568

Query: 1410 SNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL-----------NALKDEIEE 1458
            S +  +VL  +++ +  ++ K  ELE ++  +++ + K++           + L+ EIE 
Sbjct: 1569 SGEIDVVL--RKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIES 1626

Query: 1459 KCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPR 1518
            + +    + L A+KK++F+EGKQQA MK ++LERK+AK+E++   TK       +E  P+
Sbjct: 1627 RLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQS-----AESPPK 1681

Query: 1519 FVTPNNNKV--------QQANQPF--LATAGSGFSVQSSES----NPFTTP 1555
             V    N +        + +N PF  L +      + S  S    NPFT+P
Sbjct: 1682 SVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLNSKSSSGGFNPFTSP 1732

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  338 bits (866), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 390/1417 (27%), Positives = 701/1417 (49%), Gaps = 173/1417 (12%)

Query: 275  LTGNDETSHSMSEXXXXXXXXXXRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKS 334
            L   D++S S+S           +L +E   K+KL+ QV  FV ELE   P+I SF++++
Sbjct: 378  LGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERT 437

Query: 335  EQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLL 394
               + ++    L LEH TK+ E    E++  KK++   + Q +IL R+R DLA QLQYLL
Sbjct: 438  SVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLL 497

Query: 395  LN-GFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQN 453
            +N   + D+D  L   E  +IK +++ D      S+ DSQ +IS+ ++KFK I +LQ++N
Sbjct: 498  INISIINDNDHLLNEDEIKFIKNLVSND---NMASTNDSQKVISEHLIKFKDIQQLQEKN 554

Query: 454  INLLSAVRTLSDRAETLE--RKLESGDSI----EAINEAKQTLLDLQQYNSSLEAKVESL 507
            + L+  VRTL+ + E  E  +K  S +++    E   EAK+ +L L++ N +LE  ++ +
Sbjct: 555  MELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIV 614

Query: 508  TNKLKANEHFTSIGDGE--FGNSD-------LSDGNN--IQALKNKYDSLMAESSETIGH 556
            T +  A +   S  D E  F +S+       L   N   ++ L+N+   L  +S+     
Sbjct: 615  TKERDAFKLLVS-EDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKA 673

Query: 557  LYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQA 616
            L  ++N L +  S L  + E   ++K L E+RLKITQ+ ++L   EN  LR R      +
Sbjct: 674  LTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDS 733

Query: 617  LKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNF 676
            L +++ ET +T   Y++ ++K   ++  + N   E  +L++ + S++++L+   +E+   
Sbjct: 734  LLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKL 793

Query: 677  QGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAE 736
            + ++ QL++LQ  ++  L+ +Q   + +I ++   N +L  ++  +            A+
Sbjct: 794  RIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQ 853

Query: 737  LEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETV- 795
             EWYQ K D  S     +  ++      +E L ++ +TL+  L+ A  +   +   ET+ 
Sbjct: 854  YEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIR---IHTYETIN 910

Query: 796  ---------DDVNKLTGALETELATSRTRL----------TDTSRELEISSNTI-RQYQS 835
                     +DV K     + ELA + ++L           D  +EL  S N   R Y+ 
Sbjct: 911  QNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRD 970

Query: 836  EIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTK 895
             IK L E ++E+E   + L+ ++  +++ELT    E E E++ L + ++ L+     + +
Sbjct: 971  AIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEE 1030

Query: 896  LEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQ---- 951
            +++ +  +++KL+ DL++Q +     +  +++E++    R+ +  +   EL E  Q    
Sbjct: 1031 VKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ----RHADVSKTISELREQNQRLKN 1086

Query: 952  -TKVFV-----------EKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLL-- 997
             TK              + EK L+S       QI+L ++R+   + +  LL  Q+ LL  
Sbjct: 1087 DTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNR 1146

Query: 998  ---ADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEI- 1053
                +E +SD    G     T LV  L  E+  L++K+   ++EKN L+++L   ++E+ 
Sbjct: 1147 AESVNENSSDDEANG----STALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELE 1202

Query: 1054 ------AVLNMNYEQAKKEVAAEVNN-ESGRAEEHIAQLESLKESNMSLTNEVKLAQMRN 1106
                  A+L   Y     E +  +NN ++ R +  + QL  L+ESN++L NE+K A    
Sbjct: 1203 NTKRSAALLESEY----SEHSDLINNYQTIRGD--LEQLNLLRESNVTLRNELKQALDEK 1256

Query: 1107 GEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDM---PQNGN 1163
             +I  +L   + +   ++S L+ A N++  KD+K+     E  R K    +M    Q  N
Sbjct: 1257 DKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVN 1316

Query: 1164 KDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDN 1223
             D  ++L   L  +   L    DN      EL DRF RLK+QA E+L+ SK   +SL++ 
Sbjct: 1317 VDDYTKLEETLNETKQLL----DNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372

Query: 1224 VETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAEL 1283
            +  L  +K  ++  ++   +E +EL +++    E    ++ L+ EL   +SK++++E +L
Sbjct: 1373 ISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKL 1432

Query: 1284 NETSKSSNQLTTALNEEIESLKHEVQYLK-EASSAEPQGNEEMSGVVESMRKAFEDEKIA 1342
                +SS+  +   N+EIE L+  +  LK + ++     +E+ +  VE++++ FE++K  
Sbjct: 1433 QNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTK 1492

Query: 1343 FMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIET 1402
            F+   +E+   RL EE  K++ E +  EK    L +                    D+E 
Sbjct: 1493 FIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNV--------------------DVEA 1532

Query: 1403 LQKQWEASN---------------KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEK 1447
            L+KQWE  +               K+R+ L  +EK ++++  +  ELE +F  ++R+K +
Sbjct: 1533 LRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKAR 1592

Query: 1448 EL----------NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKL 1497
            +L          N LK+ +E++ K   ED L A +K+AFEEGKQQATMK ++LERKI KL
Sbjct: 1593 DLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKL 1652

Query: 1498 EAE----SKATKSGSDMSVSEDA-------PR--------FVTPNNNKVQQANQPFLATA 1538
            E++     K ++   D+   E++       P         F   NN KV + + PF AT+
Sbjct: 1653 ESQIQEKEKDSEETQDVKPEENSTPSVKKIPETLNSSDTSFGNSNNVKVLKPSSPFGATS 1712

Query: 1539 GSGFSVQSSESNPFTTPVSRGAAHTNASSQSKFAPTF 1575
                    + +     P +  +A         FAPTF
Sbjct: 1713 AFNNPFTFNNN---GNPPAFASA---------FAPTF 1737

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  333 bits (855), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 372/1415 (26%), Positives = 707/1415 (49%), Gaps = 173/1415 (12%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
            +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++  + +++   L LEH + +K  
Sbjct: 392  QLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNA 451

Query: 358  IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFSYIKE 416
              +E++   ++L +   +  IL ++R DL RQ+QYLL+ N    DS  PL   E  +I+ 
Sbjct: 452  KIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQN 511

Query: 417  ILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLES 476
            IL  D  +  T+ +DSQ I+++R+++F+ I++LQ++N  LL   R L+D+ E+ E K  S
Sbjct: 512  ILQND--DSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENK--S 567

Query: 477  GDSI-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLS 531
             + +     E INEAK+ +L LQ     LE+K+  L  + +  +++T   +    NS + 
Sbjct: 568  KNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQ 627

Query: 532  D--------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKH 583
                      +  Q L+ +   +  ES+E +  L  ++ +L  SKS L+ E     +S+ 
Sbjct: 628  QLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRI 687

Query: 584  LIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQR 643
            L E+R K+  + LDL+K EN  LR R  N   A+ +++ +T +T+  Y+ C +KL  I+ 
Sbjct: 688  LAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIET 747

Query: 644  QLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQN 703
            +L N  +E+ +    + +++ +L++   E+ +   ++ QL+ LQK ++  L + + S QN
Sbjct: 748  ELSNLKLERTLKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQN 807

Query: 704  KIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSND----ALNEKMI 759
            KID L+    EL+ +   K+        +  +++EWYQ K ++L   ++    +LNEK I
Sbjct: 808  KIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQI 867

Query: 760  ECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDT 819
            E    +E    + ++L+  ++E    NK+      V D +    +L  EL  S+  LTD 
Sbjct: 868  E----VERFQYEIKSLEKEIEE----NKIRLHTYNVLDESINDDSLRRELEKSKINLTDA 919

Query: 820  SRELEISSNTIRQYQSEIKVLNERQSELENENK--------------HLRDEIAILRDEL 865
              +++      + Y++  K L E  S+L+  NK               L D++++LR+++
Sbjct: 920  YSQIQ---EYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQM 976

Query: 866  THNGGEFEREKEAL-------MKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLG 918
            ++   E + + +A+        KK+S L+    E+  ++ +Y +++ K++ DLD+Q +  
Sbjct: 977  SNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYA 1036

Query: 919  KEIKLAHDEEVR---EVQNRNTE------TYRNELELVEIRQT---KVFVEKEKELESRI 966
               +  +++E++   +V    +E      TY+ ++E + + +    K   E E    S+ 
Sbjct: 1037 NTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQK 1096

Query: 967  KILNEQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVSPEYTDLVRKLSDE 1024
            + L EQ++L   R++  S +  LL +Q++L      K +D     V     D++  L  E
Sbjct: 1097 ESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLN--NDILITLRRE 1154

Query: 1025 KKNLESKLFASQSEKNRLREQLTKTESEI-----AVLNMNYEQAKKEVAAEVNNESGRAE 1079
            +  L++K+  ++ +   LR++++  + E+      + N   E  K+    + ++E     
Sbjct: 1155 RDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQHDE---VM 1211

Query: 1080 EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDM 1139
            E + QL  L+ESN +L NE+  +  +N E+ +EL  L+     +ES+L   +  +  K+ 
Sbjct: 1212 EKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQ 1271

Query: 1140 KLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRF 1199
            ++   + E  R K  S D+ +   + SS++    L++ + +L  Q+++      + E++F
Sbjct: 1272 EIRLTKEEVHRWKKRSQDIMEKHQQLSSTD-YEKLETEIESLKAQLEDKTQQGADSEEKF 1330

Query: 1200 GRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELR-AKIQEHIET 1258
             RL+RQA+E+L ASK++ +S  + +  L   K AL+  +  +   + EL  AK+ E+   
Sbjct: 1331 NRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAENRNQ 1390

Query: 1259 SAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQ--YLKEASS 1316
             +++K+L+ +       +K++E +L E + S +     LNEEI  LK E++     +   
Sbjct: 1391 LSMIKKLQED---TEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQIQQQF 1447

Query: 1317 AEPQGNEE--MSGVVESMRKAFEDEKIAFMKATSEDSEARLAEER--------------- 1359
                G E+  +S VVESM+++FE++KI F++  + +   ++ E +               
Sbjct: 1448 QAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETGLKPSNI 1507

Query: 1360 --GKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVL 1417
               ++K++ EA   E +  V +K R  EE    +K R  +P  E + K  E   KE L  
Sbjct: 1508 NIDEIKKQWEA---EHNEEVSKKIREAEE---ALKKRIRLPTEEKISKIIERK-KEDLEK 1560

Query: 1418 LYKEKSDQMMRA-----KMDEL-EEQFQNRVRNKEKEL---------------------- 1449
             + EK ++ +++     KM+++ ++Q ++R++ K+KEL                      
Sbjct: 1561 EFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIIS 1620

Query: 1450 ----NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATK 1505
                + L+ +IE + +      L  +KK++FEEGKQQA MK ++LERK+AK+E++   TK
Sbjct: 1621 SDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680

Query: 1506 SGSDMSVSEDAPRFVT--PN-----NNKVQQANQPFLATAGSGFSVQSSES--------N 1550
               D       P+ ++  PN       K+++ + P      SG  +    S        N
Sbjct: 1681 QSVD-----SPPKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFN 1735

Query: 1551 PFTTP----------VSRGAAHTNASSQSKFAPTF 1575
            PFT+P            R  +       +  AP+F
Sbjct: 1736 PFTSPSPNKPLQGDEAEREPSSNETEPPTHLAPSF 1770

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  332 bits (851), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 432/1638 (26%), Positives = 793/1638 (48%), Gaps = 220/1638 (13%)

Query: 36   FTSERQTV----RTVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQ 91
             TSE+Q       T+  R E + ++ + L+SS  D++R++ E+  E+   + E   +  +
Sbjct: 104  LTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQE 163

Query: 92   TSALRXXXXXXXXXXXXXXXXXXXXXSERDSTVALLDGLKLENSALRAEIEQAKELASIR 151
               LR                     +E       L   +  +  L +++ Q     +  
Sbjct: 164  NRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAY 223

Query: 152  QHDYEADLDSKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLR 211
            +H  ++ L + T  L + E+EL+ +     SL     R++ +L  +  ++++L D     
Sbjct: 224  RHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSE 283

Query: 212  QDEYTDEINLQKHRARLLQEQVASLEKEAKL---VGHXXXXXXXXXXXXXXVALQQRSHS 268
            + E+T E++L++    LL+ QV SL+ + +L    G                 L Q++  
Sbjct: 284  KQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQ 343

Query: 269  I------------SMDSLLTGNDET-----SHSMSEXXXXXXXXXXRLKRETL----SKQ 307
            +            ++  L++ + E+     +H               LKR+ +     K+
Sbjct: 344  LEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKE 403

Query: 308  KLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKK 367
             L+ QV  FV ELE   P++ SFK +++  + Q+ +    LE ++KDKE++  ++ + K 
Sbjct: 404  HLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKA 463

Query: 368  QLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTDPEEGN 426
            Q+     Q   L R+R DLARQ+QYLL+   V+ DS  PLT+ E ++++ IL    E+G+
Sbjct: 464  QIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRIL----EQGD 519

Query: 427  TS-STDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER--KLESGDSIE-- 481
             S   D+Q +IS+R+++F+ IVELQ +N +LL  +R L+D+ E+ E   K+ S  ++E  
Sbjct: 520  LSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSK-TVEND 578

Query: 482  AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNI--QAL 539
            AI EAK+ ++ LQ++   LE+++E LT   K  + + +I          ++GN I   AL
Sbjct: 579  AIREAKEAIITLQEHAQELESRIEVLT---KERDAYKAI------QPSTNNGNKITEHAL 629

Query: 540  KNKYDSLMA--------------ESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLI 585
             N    + A              E+ + +  L S+I  L + K+ LA E E    SK L 
Sbjct: 630  ANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLA 689

Query: 586  EDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQL 645
            E+RLK++Q  L L+K EN  L  R       L +++ +T +T+   ++C +KL  ++ +L
Sbjct: 690  EERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESEL 749

Query: 646  ENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKI 705
            ++++ + + L + Q      + Q   ERNN   L+ QL+ LQ  +D+ L + + S + K+
Sbjct: 750  KSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKV 809

Query: 706  DDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTI 765
            D LE+E ++LR ++  K+   +  +    +  +WYQ K DSL+ +   +  ++   A T 
Sbjct: 810  DALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTT 869

Query: 766  ETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELE- 824
              L  + + L+  L+E  +K +  +     DDV   T AL  EL  S+ +L D   ++E 
Sbjct: 870  RDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEE 929

Query: 825  -------------ISSNTIRQYQSE----IKVLNERQSELENENKHLRDEIAILRDELTH 867
                           +N   ++++E       + +++ EL  + + L+ +I+ L +EL H
Sbjct: 930  HRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGH 989

Query: 868  NGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDE 927
               +F+ EK  L  +L +L+  Q  +  ++E Y  ++ KL  DL++QA    + +  +++
Sbjct: 990  QKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQ 1049

Query: 928  EVREVQN---------RNTETYRNELELVE--IRQTK--------VFVEKEKELESRIKI 968
            E++   +           ++ Y+N+  +++  I Q +         ++ +++E E++++ 
Sbjct: 1050 ELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRS 1109

Query: 969  LNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNL 1028
            LN++IE         + +  LL +Q+ L A +  S+L  +    +  +L+  L  E+  L
Sbjct: 1110 LNQRIE-------DLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDIL 1162

Query: 1029 ESKLFASQ-SEKNRLREQLTKTESEIAVLNMNYEQAKKEVA---AEVNNESGRAEEH--- 1081
            ++KL  S+ SE   LR +L   E E++        AK+E++   A  +  S  A+EH   
Sbjct: 1163 QTKLEVSKRSETVSLR-KLEAIEQELSF-------AKEELSSLQALSSQNSIMADEHNKL 1214

Query: 1082 ---IAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKD 1138
               + QL  L+ESN++L +EV+    R  E+  +++ L+   + +ES+L   +  + +KD
Sbjct: 1215 LEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKD 1274

Query: 1139 MKLMELQTECSRLKATSHDMPQNGNKDSSSE---LVGALQSSVATLTEQVDNLKHANTEL 1195
             ++  +  E +R K  S D+     +    E   L   L  + A L  + D     N+EL
Sbjct: 1275 SQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQ----NSEL 1330

Query: 1196 EDRFGRLKRQARERLDASKVTINSL----------RDNVE-TLTKDK---TALQDVIERS 1241
            EDRF RLK+QARERLDA+K   N+L          + N+E  L K++    ALQ+ ++R 
Sbjct: 1331 EDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRV 1390

Query: 1242 KDELN-------ELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLT 1294
            + E         EL + +Q+  +     ++++++ A +    K +++EL +    + +L 
Sbjct: 1391 ESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQI---EKALQSELEKVKSHAEELE 1447

Query: 1295 TALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEAR 1354
              L+E     + EV+ L+E      QG    S  +E M++  E           E S   
Sbjct: 1448 RRLDE----ARREVESLEEVK----QGAFTDSSELEKMKRDLE-----------EHSNTL 1488

Query: 1355 LAEERGKLKREMEALE-KEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQW------ 1407
            +AE+  +++   E L  KEK +   E     EEN      +    DIETL+KQW      
Sbjct: 1489 IAEKEAEIRSHYEELRLKEKATYEKE----LEEN-----GKHTPVDIETLKKQWEEDYEQ 1539

Query: 1408 ------EASN---KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKELNALKD---- 1454
                  E SN   ++R+ L  +EK ++++  +  ELE++F+ +++ +  EL   K     
Sbjct: 1540 KTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPAS 1599

Query: 1455 --EIEEKCKTGHE-----------DTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAES 1501
              E+ ++ K   E           + +  V+K+AF+EGKQQA+MK   LE+KIAKLEA+ 
Sbjct: 1600 FTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQV 1659

Query: 1502 KA--TKSGSDMSVSEDAP 1517
            KA  T++      S+++P
Sbjct: 1660 KASGTEAVPSAPTSKNSP 1677

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  318 bits (814), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 405/1437 (28%), Positives = 706/1437 (49%), Gaps = 169/1437 (11%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTK--DK 355
            +L +E   K++L+ QV  FV ELE   PI+ SFK++++  + +++ + L LE   K  D+
Sbjct: 400  QLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQ 459

Query: 356  ETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKD-SDDPLTSSEFSYI 414
            +TI  E+ QYK ++     Q   L  +R DLA Q+QYLL+   V+D +  PLT  E  ++
Sbjct: 460  KTI--ELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFV 517

Query: 415  KEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK- 473
            K I++++ E      +D+Q IIS+R+++FKS++ELQ +N  LL+ +R L+D+ E  E+K 
Sbjct: 518  KRIISSEDE---APKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKS 574

Query: 474  ---LESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTN-----KL--KANEHFTSIGDG 523
               L+S ++ + + EAK+ +L LQ++   LE +++ ++      KL   AN+   S    
Sbjct: 575  RFRLKSVET-QTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSS 633

Query: 524  EFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKH 583
             + +  L +  +I  L+ +  +L  +S + I  L  +I  L ++KS++    E   +SK 
Sbjct: 634  TYQSKKLDE--HIMELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKV 691

Query: 584  LIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQR 643
            L E+RLK+ Q  L L+K EN  L  R  +  + L +++ +T  TI + +   ++L  +  
Sbjct: 692  LAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTS 751

Query: 644  QLENTLVEKDILQNAQSSIENKLNQAL-KERNNFQGLIPQLRALQKNQDEQLKDIQVSLQ 702
            +L     E+D L+  ++ ++N+ N+AL KE    + L+ QL+ LQ+ +D  L++ Q + +
Sbjct: 752  KLAILTSERDFLRKIEAELKNE-NEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYR 810

Query: 703  NKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECA 762
              I+ LE +  E R  +  +         +  ++ +W+Q K DSL+   D   + + E  
Sbjct: 811  KNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKT 870

Query: 763  STIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRE 822
            ++IETL +  ++L   L+EA  + +        DD+      L   L  +   L D   +
Sbjct: 871  NSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQ 930

Query: 823  LEISSNTIRQYQSEIKV-----------LNERQSE-------LENENKHLRDEIAILRD- 863
            +E       QY+S  KV           L E Q+        LE E K L D+IA+L D 
Sbjct: 931  IE-------QYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLNDQ 983

Query: 864  ------ELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAML 917
                  EL H   + + EK  L+KKLS L+  Q  L +L+ +Y  +I KL+ DL +QA  
Sbjct: 984  IKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASY 1043

Query: 918  GKEIKLAHDEEVRE---------VQNRNTETYRNELELVE--IRQTKVFVEK-EKELESR 965
              + +  +++E+++         +    ++ Y++E+E  +    + K  +E+ E+    +
Sbjct: 1044 ANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQ 1103

Query: 966  IKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDL-VDAGVSPEYTDLVRKLSDE 1024
            +  L  Q+ L ++R ++ + +  LL +QV+LL+   +SD    A +S E  +L+  L  E
Sbjct: 1104 VADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAAASMSAESRELIMTLRRE 1163

Query: 1025 KKNLESKLFASQSEKNRLREQ--LTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHI 1082
            +  LE+KL  S  E+  LR++  L KTE E   L  +  QA    +        +  E +
Sbjct: 1164 RDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKL 1223

Query: 1083 AQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLM 1142
             QL  L+ESN++L NE K    ++     E+ +L+ + + +ESQL      +S +D ++ 
Sbjct: 1224 NQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQIS 1283

Query: 1143 ELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRL 1202
             L+ E SR K  S D+     +    E    L   V  L  +++     N E ++RF +L
Sbjct: 1284 LLKEESSRWKQRSQDILHKYERIDPVE-HQKLADEVTELKNELEKKSLENLESQERFRKL 1342

Query: 1203 KRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERS--------------------- 1241
            ++QA ERLD  K     +    E ++  K  L+  + ++                     
Sbjct: 1343 RKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVSELESKLSSSANEKNGE 1402

Query: 1242 ----KDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTAL 1297
                K+EL ELRA     IE +  + ++K E A   S  KD++ ++ E           L
Sbjct: 1403 ADSLKEELEELRANF---IEANEAVADIKAEAA---SSEKDLKNQIQE-----------L 1445

Query: 1298 NEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAE 1357
             E+I++L+ E+++  E  +     + + + +VE+M+K FE+EK   ++   E+   +L E
Sbjct: 1446 TEKIKTLESEIEH-SELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKLEE 1504

Query: 1358 ERGKLKREMEALEKEKDSLVMEKT---RLGEENTALMKARSDVPDIETLQKQWEASN--K 1412
             + + + E E    E  + ++E T    L +E T   K  ++  + +TL++  EA    K
Sbjct: 1505 IQKQYEEERERELSELKASLVESTPNAPLIDEETLKSKLEAEY-EKKTLERIREAEEALK 1563

Query: 1413 ERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL-------------NALKDEIEE- 1458
            +R+ L  +E+ +Q++  +   L+++F+ RVR +  EL               +K+  EE 
Sbjct: 1564 KRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQEEM 1623

Query: 1459 -KCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAP 1517
             K +   ++ L  V+K+AFEEGKQQ  MK+ +LE KIAKLE +    K   + SV    P
Sbjct: 1624 DKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ--PNKINLNNSVPSKIP 1681

Query: 1518 RFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFTTPVSRGAAHTNASSQSKFAPTFLL 1577
              +  NNN   Q  QP +A   S F             V+ G A  N S  S F  + L 
Sbjct: 1682 --IDNNNNSSPQGAQP-IAIKPSPFQ------------VAFGKAMENTSFGS-FKGSLLD 1725

Query: 1578 NSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPGEGESNLKSPSKKTR 1634
            + Q    ++ ++D    T+ G     + GT        NKR  E E   +SP K+ +
Sbjct: 1726 SKQ---FIANTADTSTSTLTG-----NVGTNT------NKRQSEDEL-AQSPEKRPK 1767

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  317 bits (811), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 357/1302 (27%), Positives = 638/1302 (49%), Gaps = 163/1302 (12%)

Query: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365
            K+ L+ QV  FV ELE   P++ SFK +++  + ++ +    L+ ++KDK+    ++++ 
Sbjct: 398  KEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRT 457

Query: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTDPEE 424
            K Q+  +  Q   L ++R DLARQ+QYLL+   V+ DS  PL++ E +++K+++N    E
Sbjct: 458  KSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNM---E 514

Query: 425  GNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLES-GDSIE-- 481
                  D+Q IIS+R+++FK+IVELQ +N +LL  VR L+++ ET ERK++S  ++IE  
Sbjct: 515  NTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIEND 574

Query: 482  AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGN------- 534
             I EAK+ ++ LQ +   LE +++ +T +  A +   S    E  N  L D N       
Sbjct: 575  TITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENS 634

Query: 535  --NIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKIT 592
               I+ L+    +   E+   +  L ++   L +SKS+L    E   +S+ L E+RLKI+
Sbjct: 635  DLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKIS 694

Query: 593  QDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEK 652
            +  L L+K EN  L  R       L +++  T +TI + +DC ++L  +  +L+N++ ++
Sbjct: 695  KSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKE 754

Query: 653  DILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELEN 712
            ++L  +   ++    Q  KERN    L+ QL+ LQK +D  LKD   + + KID LE E 
Sbjct: 755  NLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEI 814

Query: 713  TELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIEC-ASTIETLTVK 771
            ++LR  +  K T  S  ++   +   WYQ K D+L+           EC  ST   L  K
Sbjct: 815  SQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALN-----------ECLKSTTSDLNSK 863

Query: 772  TQTLDIL----------LQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTD--- 818
            TQ +  L          L++A +K++        DDV   T AL +EL  +R  L D   
Sbjct: 864  TQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFS 923

Query: 819  ----------TSRELEISSNTIRQYQS-----EIKVLNERQSELENENKHLRDEIAILRD 863
                      +++E   +  T  ++       E++ L + +  L N+   L+D++A L  
Sbjct: 924  QVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNS 983

Query: 864  ELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKL 923
            EL +     E  K    K    ++  +  L  +++ Y  E+ KL  DL++QAM   + + 
Sbjct: 984  ELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQE 1043

Query: 924  AHDEEVR--------------EVQNRNTETYRNELELVEIRQT-----KVFVEKEKELES 964
             +++E++              E Q    + +  E  + E++++       +  +++E E+
Sbjct: 1044 NYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYET 1103

Query: 965  RIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDE 1024
                   Q  L  +R++  S +  LL +Q+ L   +  S  ++  +  E  +L+  L  E
Sbjct: 1104 -------QASLSSQRIEDLSTQNRLLFDQISL--KDTDSIPINDELKSEARELISTLKRE 1154

Query: 1025 KKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNN----ESGRAEE 1080
               L++KL  ++ +++ L+++L  TE E++V     E  K +V ++  +    E+ +  E
Sbjct: 1155 CDILQTKLELAKRDESNLKQKLEFTEQELSV--AKSEIRKSQVTSDTRSIMIEENSKILE 1212

Query: 1081 HIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMK 1140
             + Q+  L+ESN++L NE++    RN ++   + EL+   K +E+ +   +  + +KD +
Sbjct: 1213 QLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQ 1272

Query: 1141 LMELQTECSRLKATSHDM--------PQNGNKDSSSELVGALQSSVATLTEQVDNLKHAN 1192
            +  +  E +R K  S D+        P+   K         L   ++    +        
Sbjct: 1273 ISLITEEVNRWKQRSQDILLKYERVDPEEHKK---------LAEELSQARAEAAANAQQR 1323

Query: 1193 TELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKI 1252
            +ELEDRF RLK+QARERLD ++ T N+L   +    + + AL+D +++ +++   L+  I
Sbjct: 1324 SELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESI 1383

Query: 1253 ----QEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEV 1308
                +  IE S+  ++   +L   + K +D +A +NE S + +Q    L EE+E  +  V
Sbjct: 1384 KATEENEIENSSATRD---QLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHV 1440

Query: 1309 QYLKEASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEA 1368
            + L+E   A+ Q       V+E  +      +    +  +E     L +   KL  E EA
Sbjct: 1441 KQLEE-HLAKTQNE---VRVLEEAKNQVSGTEAEIARVKTE-----LIDHSNKLLAEKEA 1491

Query: 1369 LEKEKDSLVMEKTRL---GEENTALMKARS-DVPDIETLQKQWEASNKERLV-------- 1416
              KEK     EK RL    E   +L  + S    DIE L+K+WE   ++R +        
Sbjct: 1492 EIKEK----YEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANE 1547

Query: 1417 -------LLYKEKSDQMMRAKMDELEEQFQNRVRNK------EKELNAL--------KDE 1455
                   L  +EK ++++  +  EL+E+F+ +++ +      EK L A         K E
Sbjct: 1548 ILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQE 1607

Query: 1456 IEE---KCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKI 1494
            +E+     K   ++ +   KK+AF+EGKQQA+MK   LE+KI
Sbjct: 1608 VEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  299 bits (766), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 361/1347 (26%), Positives = 673/1347 (49%), Gaps = 139/1347 (10%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
            +L +E   K++L+ QV  FV ELE   P++ SFK++ E+ + Q++ + L LE   ++++ 
Sbjct: 397  QLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDE 456

Query: 358  IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKD-SDDPLTSSEFSYIKE 416
               +++QYK ++     Q   L ++R DLARQ+Q LL++  V+D S  PLT+ E  ++K+
Sbjct: 457  KVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKK 516

Query: 417  ILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLES 476
            + +      + + +D+Q IIS R+++FKS+VELQQ+N  LL+A+R L+ + E  E K +S
Sbjct: 517  LQSC---RDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQS 573

Query: 477  G-DSIE--AINEAKQTLLDLQQYNSSLEAKVESLTN-----KL-----KANEHFTSIGDG 523
               S+E   +NEAK+ +L LQ++   LE ++E++T      KL     K N     +G  
Sbjct: 574  KVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAA 633

Query: 524  EFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKH 583
                 +++DG  I  L+ +  ++  ES +    L  +I  L +S S LA E E   +S+ 
Sbjct: 634  ALQPQEVADG--IAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRE 691

Query: 584  LIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQR 643
            L +++L + Q  L+L K EN+ L+NR  +    L E++     TI++++   ++L  I  
Sbjct: 692  LADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISS 751

Query: 644  QLENTLVEKDILQNAQSSIENKLNQAL-KERNNFQGLIPQLRALQKNQDEQLKDIQVSLQ 702
            QL     E+D L+  ++ ++ K N++L K+ N+ Q LI QL+  QK +D  +++ +   +
Sbjct: 752  QLTILQSERDFLRKVEADLK-KENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYE 810

Query: 703  NKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLS---GSN-------- 751
             +I++L+ E +  + +++ K+       ++   + +W+Q+K DSL    GS+        
Sbjct: 811  TRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKT 870

Query: 752  ---DALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETE 808
               DAL  ++    S +E  ++  Q   ++L E++  +++    + +D+ N+   +  +E
Sbjct: 871  SELDALKARLNSSTSKLEPASMDHQQSSLVL-ESDHASRVQSLSKDLDEANRKLSSAYSE 929

Query: 809  L--------ATSRTRLT--------DTSRELEISSNTIRQYQSEIKVLNERQSELENENK 852
            +        AT R  L+        D S++  IS       ++E+  LN   S++   N 
Sbjct: 930  IERYKAASNATERPSLSYNAVQDNKDGSKQAAIS------LEAELTKLN---SDIAMAN- 979

Query: 853  HLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLD 912
               D I +L DEL      +  E+  L +K++ L   +  + + + DY  +I +L+ DL+
Sbjct: 980  ---DRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLE 1036

Query: 913  KQAMLGKEI---------KLAHDEEVREVQNRNTETYRNELELV-----EIRQTKVFVEK 958
            KQ     E          K A   E  E   +++E+Y++E+        E R  KV    
Sbjct: 1037 KQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEAR--KVLERN 1094

Query: 959  EKELESRIKILNEQIELDKERMKQFSDEESLLREQV-KLLADEKASDLVDAGVSPEYTDL 1017
            E+  + +   +   ++L  +R+++ S +  LL +Q+  L     +S   D  +S +  +L
Sbjct: 1095 EQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPDTKISSDAREL 1154

Query: 1018 VRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGR 1077
            +  L  E+  LE+K+  S+ E+  LR++L  T+SE+  L     ++K  V    ++   +
Sbjct: 1155 IVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQ 1214

Query: 1078 AE--EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLS 1135
             E  E + QL  L+E NMSL NE +     N  +  E+  L+ K + +E Q+      L+
Sbjct: 1215 EELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLT 1274

Query: 1136 SKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTEL 1195
             K+ KL  L+ E  R K  S D+     +    E    L S +  L  +++     + + 
Sbjct: 1275 EKEQKLALLKEESDRWKQRSQDILHKYERIDPEE-YRKLASEIEVLKAELERKSAESIDS 1333

Query: 1196 EDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEH 1255
            ++RF +L++QA ERLD  K     +   +E     K+ L+  +  +++++  L  ++ E 
Sbjct: 1334 QERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLTER 1393

Query: 1256 IET------SAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQ 1309
              +      S  ++E KT+L    +    +++E + + +S  +    LN+++E+++    
Sbjct: 1394 PASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQK--N 1451

Query: 1310 YLKEASSAEPQG-NEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREME- 1367
                +  ++P   +E+ + V+E  +K  E+E+   +++  ++  ARL   R     E E 
Sbjct: 1452 SAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFLAEKEK 1511

Query: 1368 ALEKEKDSLVMEKTRLGEENT-ALMKARSDVPDIETLQKQWEASN--KERLVLLYKEKSD 1424
            ALE+ +DSL         +N  AL K   +  + +TLQ+  EA    K+R+ L  +E+ +
Sbjct: 1512 ALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERIN 1571

Query: 1425 QMMRAKMDELEEQFQNRV-----------------------RNKEKELNALKDEIEEKCK 1461
            Q++  K   LE++F  +V                       ++ +KE+  LK ++ +K  
Sbjct: 1572 QVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKF- 1630

Query: 1462 TGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDM----------S 1511
               E  L+ VKK+AFEEG+QQ  MK+ +LE KI+KLE+++KA   G+++           
Sbjct: 1631 ---EGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAP-LGTNVPTKIPLENTQP 1686

Query: 1512 VSEDAPRFVTPNNNKVQQA---NQPFL 1535
            +++  P   +P      QA   N PFL
Sbjct: 1687 LAQQVPVKPSPFQLAYAQATFGNVPFL 1713

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  281 bits (720), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 347/1376 (25%), Positives = 666/1376 (48%), Gaps = 166/1376 (12%)

Query: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365
            K +L+ QV  FV ELE   P++ SFK++SE  + +++++ + LE   KD++    +++  
Sbjct: 397  KDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYL 456

Query: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDD-PLTSSEFSYIKEILNTDPEE 424
            K  ++    Q   L ++R DLA Q+QYLL+N  +K  D  PL++ E  ++K + N+   +
Sbjct: 457  KATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNS---Q 513

Query: 425  GNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI---E 481
              T ++D+Q II+ R+++F+S+VELQQ+N  LLS +R L+D  E  E + +S   +   E
Sbjct: 514  EITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDE 573

Query: 482  AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLS-------DGN 534
             + EAK+T+L L  +  +LE ++  L+ +  A +   S+      N+  +       + +
Sbjct: 574  TVREAKETILTLHDHAQNLENQLVILSKERDAYKAL-SVNASSGTNTPKAITYPSPDNDD 632

Query: 535  NIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQD 594
             ++ L+ +  +++ E+        S+ +NL++   +++   ES   S+ L EDRL + Q 
Sbjct: 633  KVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQS 692

Query: 595  MLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDI 654
             L+LSK +   L+ R  +    L +++  T +T+   +   + L  IQ +L     EK  
Sbjct: 693  TLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQF 752

Query: 655  LQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTE 714
            +   Q  ++ +  +  KE   ++ LI QL+ LQ+ ++  LK+ Q S + K+  LE+E + 
Sbjct: 753  MAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSG 812

Query: 715  LRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQT 774
               +++  E + +   +N + +  W+Q K D L+   +A  +K     +T+E    + Q 
Sbjct: 813  SLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTS--EAAQQK-----TTLEEKEAQLQK 865

Query: 775  LDILLQEANSKNKLLEAR-------ETVDDVNKLTGALETELATSRTRLTDTSRELE--- 824
            +   + E ++K K  EAR         VDD   L   L  EL     +L+D+  ++E   
Sbjct: 866  MQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHK 925

Query: 825  -ISSNTIRQYQSEIKVLNERQSE-------LENENKHLRDEIAILRD-------ELTHNG 869
             ++  +++      +   E Q E       LENE   L+  + IL D       E+ H  
Sbjct: 926  TLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQK 985

Query: 870  GEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEV 929
             E++ E+ A M+++S L++ +  + + + DY  +I  ++ DL+ Q     E + +++ E+
Sbjct: 986  SEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELEL 1045

Query: 930  RE-------VQNRNTE--TYRNELELVEIRQT----------KVFVEKEKELESRIKILN 970
            ++       + +  TE  +Y+++LE ++ +            K++ E++ E E ++ +L 
Sbjct: 1046 QKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVL- 1104

Query: 971  EQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLES 1030
                  ++R+++ S +  LL +Q++LL     +   D   S + +DL+  L  E+  LE+
Sbjct: 1105 ------EQRVQELSTQNKLLYDQIELL-----NKTEDRDNSHDSSDLLISLRRERDMLET 1153

Query: 1031 KLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEV--AAEVNNESGRAEEHIAQLESL 1088
            KL  + SE+  L+++L   +SEI  LN    Q K     +A +  +     + + QL  L
Sbjct: 1154 KLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLL 1213

Query: 1089 KESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTEC 1148
            +ESN++L +E    +     + ++L E   +   ++S +   +N +  K+ +L++ + E 
Sbjct: 1214 RESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEA 1273

Query: 1149 SRLKATSHDM--------PQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFG 1200
             R K+ S D+        P+   K    E +  +++ + T  + + ++     + E +F 
Sbjct: 1274 ERWKSRSQDILHKYERIDPEEHGK--LKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQ 1331

Query: 1201 RLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSA 1260
            R++ QAR+RL+ASK    SL   +  + + K+ ++  + + K    EL  ++Q  +   A
Sbjct: 1332 RIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQ-VVTQEA 1390

Query: 1261 VMKE--LKTELAAVMSKNKDIEAELNETSKS------SNQLTTALNEEIESLKHEVQYLK 1312
              KE    ++L+ +      I+ ++   SK+      S++   +L E +E L  ++Q L+
Sbjct: 1391 ETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELE 1450

Query: 1313 -EASSAE--------PQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARL-AEERGKL 1362
             EAS+A+        P  NE+   +V++++  FE EK   +K   ++  ++  AE+    
Sbjct: 1451 AEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAW 1510

Query: 1363 KREMEALEKEKDSLVMEKTRLGEENTALMKARSDVP-DIETLQKQWEASN---------- 1411
                E L K+ +          E+ T    ++  +  DI+ L+ +WE             
Sbjct: 1511 NSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWEKEYEKQTLEKIKL 1570

Query: 1412 -----KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEK------------------E 1448
                 K+R+ L  ++K D+++ A+   LEE F+ +V  K +                  E
Sbjct: 1571 AEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAE 1630

Query: 1449 LNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKS-- 1506
            LNALKD +    +   E  L  +K+++FEEGKQQ ++K+  LE KI  LE +    K   
Sbjct: 1631 LNALKDSM----RKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPVE 1686

Query: 1507 --GSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFTTPVSRGA 1560
               S+MS +  AP F +              +T  S FS  +SE +P   P+   A
Sbjct: 1687 NDTSNMSAAFQAPVFGSH-------------STFTSPFS--TSEISPNKRPIDDTA 1727

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  281 bits (719), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 377/1412 (26%), Positives = 680/1412 (48%), Gaps = 157/1412 (11%)

Query: 276  TGNDETSHSMSEXXXXXXXXXXRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSE 335
            T +D+  +S+++          +L  E   ++  EK + +F+ +LE   P +++++ ++ 
Sbjct: 376  TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAA 435

Query: 336  QSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL 395
              + ++ +  L LE   K+K  +  E+ Q + +++ I  + K++ ++R DLA QLQ+ L+
Sbjct: 436  AREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLV 495

Query: 396  -NGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNI 454
             N    DS  PLT  E  +I+ I+  D +E +   TD+Q +IS+R+ KFK I+ELQQ+N+
Sbjct: 496  HNSVANDSAGPLTDEEVKFIRNIIQED-DEMHDKETDTQKVISERLTKFKDIIELQQKNM 554

Query: 455  NLLSAVRTLSDRAETLERKLESGDSI----------EAINEAKQTLLDLQQYNSSLEAKV 504
             LL   R L+        KLE  D I          E I EAK+ +L LQ YNSSL AK+
Sbjct: 555  ELLKTTRELA-------TKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKI 607

Query: 505  ESLTNKLKANEHFTSIGD----GEFGNS----DLSDGNNIQALKNKYDSLMAESSETIGH 556
             +LT +L+  +  ++  D     +F       ++     ++ L+ +  S++ ES E    
Sbjct: 608  AALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANI 667

Query: 557  LYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQA 616
            L  +I  L +  + ++ E     ++K L E+RLK+ Q  +D++  EN  L+ R+ +    
Sbjct: 668  LNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNV 727

Query: 617  LKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNF 676
            + E++  T +TI   +   ++L  ++ +   +  E  +L +++  ++N+L +  +E+N+ 
Sbjct: 728  VVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSM 787

Query: 677  QGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAE 736
            + L+ +L+ LQ  ++  L   Q     +++DLE    +LR K+   E +  S L     E
Sbjct: 788  KLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGS-LMEETTE 846

Query: 737  LEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDI----LLQEANSKNKLLEAR 792
            L+      D       +L E+M         +  K +        L ++   K +L+E  
Sbjct: 847  LK------DDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY 900

Query: 793  ETV-DDVNKL--TGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLN-------- 841
            +   DD  KL    +L+ EL   +  LT++  + E        Y+ +I++LN        
Sbjct: 901  KAASDDEGKLEEISSLQKELQVLKNELTESYSQTE-------SYRKDIELLNQSIADINK 953

Query: 842  ----------ERQSELE-------NENKHLRDEIAILRDELTHNGGEFEREKEALMKKLS 884
                      ER +E+E       + N  L+ +I  L +EL      +E EK    +  +
Sbjct: 954  QVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNAN 1013

Query: 885  NLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQN---------R 935
             LE     L + + DY  +++ L  DL++Q     + +  +++E++   N          
Sbjct: 1014 ELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLRE 1073

Query: 936  NTETYRNELELVEIRQT---KVFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLRE 992
             T+ YR E+  + I  T   ++  E +   + +     +QIE  K+R+++ S++  +L E
Sbjct: 1074 QTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFE 1133

Query: 993  QVKLLADEKASDLVD-AGVSPEYTD--LVRKLSDEKKNLESKLFASQSEKNRLREQLTKT 1049
            Q KL       D  + +GV+    D  LV  L  E+  L+ +L  +++E+  LRE+LT  
Sbjct: 1134 QSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSI 1193

Query: 1050 ESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH------IAQLESLKESNMSLTNEVKLAQ 1103
            E +    ++  ++ K+    E +N     E+H      + QL+ L+ESN++L NE    Q
Sbjct: 1194 EKDFRATDLELQKIKE----ETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQ 1249

Query: 1104 MRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGN 1163
             +N  +  E+  L  K   +E++L    N++  KD +L     E  R K  S D+     
Sbjct: 1250 SKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQ 1309

Query: 1164 KDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDN 1223
            +    E    L      L  Q++     N EL +RF +LK+QA E+L+ASK++ NSL   
Sbjct: 1310 RIDPVEHEN-LAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQ 1368

Query: 1224 VETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAEL 1283
            +  L   K  L   +E  K+    L  +++  ++ S  +  ++++L   + K+KD E + 
Sbjct: 1369 INDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKF 1428

Query: 1284 NETSKSSNQLTTALNEEIESLKHEVQYLKE-------ASSAEPQGN---EEMSG-----V 1328
              + +SS Q+   LN EI+ L+ E   L+E        +S    GN   + + G     +
Sbjct: 1429 INSVESSKQIEENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDI 1488

Query: 1329 VESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENT 1388
            VESM+++FE+EKI F++  + + + +L  E  KLK E E  + E  S+        +EN 
Sbjct: 1489 VESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSI--------DEN- 1539

Query: 1389 ALMKARSDVPDIETLQ--KQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKE 1446
            A+ K   +  +  T Q  K+ E + K R+ L  +EK ++++  +  +LE +FQN+V  + 
Sbjct: 1540 AIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARA 1599

Query: 1447 KEL----------NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAK 1496
            KEL          + +K EI+E+    +E+ L  VKK+AF+EG+QQ  MK S LE+KI K
Sbjct: 1600 KELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITK 1659

Query: 1497 LEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQAN-QPFLATAGSGFSVQSSESNPFTTP 1555
            LE++ +  KS +  +   D     T N  K + ++ +P   T  +       E+N   TP
Sbjct: 1660 LESDLQNAKSNTGAT---DNTIVSTDNETKYEGSDKKP--VTINTNVVSDVGENNAERTP 1714

Query: 1556 VSRGAAHTNASSQSKFAPTFLLNSQPPVLVSG 1587
            +            +KF P  ++N   P+L +G
Sbjct: 1715 M------------NKF-PRAIMN---PLLSNG 1730

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  229 bits (583), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 357/1378 (25%), Positives = 666/1378 (48%), Gaps = 136/1378 (9%)

Query: 298  RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
            ++ +E L K+ L+ Q+  F+ ELE   PII SF++K++  + ++  L L L   + +K T
Sbjct: 371  QVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNT 430

Query: 358  IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKE 416
            I  ++  Y  +L       K L R+R DLA Q+++LLL   VK DS  PLT  E  +I +
Sbjct: 431  IQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINK 490

Query: 417  ILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLES 476
            I N + E+ N S   SQ +IS+R++ F +I ELQ +N+ LL+++R+LS+  E +E    S
Sbjct: 491  ISN-NSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENA-NS 548

Query: 477  GDSIE--AINEAKQTLLDLQQYNSSLEAKVESL-----TNKLKANEHFTSIGDGEFGNSD 529
                +   I +AK+ +L LQ +N  LE+KV+ L     + KL  N + +   D    N D
Sbjct: 549  HKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVS--IDSSIKNDD 606

Query: 530  LSDGNN-------IQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSK 582
            LS   +       I+ L+   + L AE  +    L SQI +    KS+L    E   +S 
Sbjct: 607  LSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSN 666

Query: 583  HLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQ 642
             L+ +++ +T+   D+ K EN  L  R +N    + ++E +    I KY+    ++  ++
Sbjct: 667  TLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLK 726

Query: 643  RQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQ 702
             QL     EKD L  +Q S+ ++L +  +E+N  + ++ QL++LQ  +   L D Q    
Sbjct: 727  TQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFM 786

Query: 703  NKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDAL-------N 755
            +KI +LE  N +L   + +K T       + +++  WYQ   D L   N A+       N
Sbjct: 787  SKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKN 846

Query: 756  EKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTR 815
              + +  + IE L  ++ T+D   + ++S N   +  + +D          T++   +  
Sbjct: 847  SLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQL 906

Query: 816  LTDTSRELE-ISSNTIRQYQSEIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFER 874
             T T   L+ + SN    ++S   +++++ S+L +EN+ L+         ++    + + 
Sbjct: 907  YTSTEESLKTLESN----FESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKN 962

Query: 875  EKEALMKKLSNLEIRQAELTKLEED-------YTAEIEKLKLDLDKQAMLGKEIKLAHDE 927
            EK    ++++ L ++   L K ++D       Y  +I KL+  L+ +A      +  + E
Sbjct: 963  EKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKY-E 1021

Query: 928  EVREVQNRNTETYRNELELVE-IRQTKVFVEKEKELESRIKILNEQ-------------- 972
             +    N N ++     E +E + Q  V +  E +LE +  +L+E               
Sbjct: 1022 SLLTKDNANLQSIEEFKEQIEKLNQRIVII--ESDLEKKTSLLSENESLWKKKQDAFISD 1079

Query: 973  IELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKL 1032
            +E  K+++   +++  L  +Q++LL ++  S +  + +S E   +  +L  ++  LE+KL
Sbjct: 1080 LEESKKKIDNLTNQNKLYVDQLELL-NKDFSSMDSSQLSSETKHMFNRLRADRDVLETKL 1138

Query: 1033 FASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH------IAQLE 1086
              ++ +      +L     E+A + M    ++ ++       S   E H      + Q+ 
Sbjct: 1139 SIAERDSKNNASKLESLRDELANVQMKLISSENKLLR----HSDLIENHEKIVSELNQIT 1194

Query: 1087 SLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQT 1146
              KESN +L N+V     +N  +  +LNE  +K  ++  +L   +  L  K+  +M ++ 
Sbjct: 1195 LFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKE 1254

Query: 1147 ECSRLKATSHDMPQNGNK---DSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLK 1203
            E ++ +  + ++    +K   DS    V  L + +  L +  +  +  N ELE+RF  LK
Sbjct: 1255 ESNKWRLRAEELSVQIDKVDLDS----VSKLSTELDALKDDAETKRKQNAELEERFNLLK 1310

Query: 1204 RQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEH-IETSAVM 1262
            +QA ERL+ASK   +SL   +  L    T ++  +   + +  +L+  + ++ ++ +  +
Sbjct: 1311 KQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKL 1370

Query: 1263 KELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASS-----A 1317
              +++EL A+ ++N       N    SS +    L +E++SLK   + L EA S      
Sbjct: 1371 SNIESELKALKTEN-------NSFKLSSEKEKMELTDEVDSLK---KSLVEAQSKLSAIG 1420

Query: 1318 EPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLV 1377
                +  M+ ++ESM+K FE+EK+  ++  + + EA+   E+ KL +E E   ++  S  
Sbjct: 1421 SDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKIEDLQSAR 1480

Query: 1378 MEKTRLGEENTALMKARSDVPDIETLQKQWEASN--KERLVLLYKEKSDQMMRAKMDELE 1435
             +++   EE  +L K   +  +  TL++  EA    K+R+ L  + K ++++  +  ELE
Sbjct: 1481 TDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELE 1540

Query: 1436 EQFQNRVRNKEKELNA------------LKDEIEEKCK----TGHEDTLIAVKKRAFEEG 1479
             +++ +++ K  E+ A            L++EI+E+ K       E+ L   KK++FEEG
Sbjct: 1541 NEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEG 1600

Query: 1480 KQQATMKMSILERKIAKLEAE-SKATKSG---------SDMSVSEDAPRFVTPNNNKVQQ 1529
            KQQ++MK ++LERKI+KLE++ S+A ++          SD++ +        P+  K   
Sbjct: 1601 KQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPPSAKKPAF 1660

Query: 1530 ANQPFLAT----AGSGFSVQSSES-----------NPFTTPVSRGAA---HTNASSQS 1569
            +   F  T    A  GFS  S+ +           NPF+  VS+ ++   H N  S S
Sbjct: 1661 SFGGFNTTNSLNANKGFSSSSNNTSQSSKDTEIVQNPFSLGVSQTSSSPMHFNPFSSS 1718

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  198 bits (503), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 333/1355 (24%), Positives = 626/1355 (46%), Gaps = 167/1355 (12%)

Query: 306  KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQY 365
            K  LE QV  F+TELE   P+I S ++K++  + ++  +   ++ ++ ++E++ +E + +
Sbjct: 313  KDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSF 372

Query: 366  KKQLEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEE 424
            K++ E   G  + L  +R DLA Q+Q+LLL  G    ++  L+  E  +I+ +   D   
Sbjct: 373  KRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYA 432

Query: 425  GNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGD--SIE- 481
             N    DSQ IIS+R+LKF  I ELQ+QN+++L+ VR L+ + E  E KL   D  +IE 
Sbjct: 433  RN---NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQE-KLRQADHHTIER 488

Query: 482  -AINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSD-LSDGNNIQAL 539
              + EAK+ LLDLQ+Y +SLE K+E+     K  + +  +  G+  +S+  S+ N+I   
Sbjct: 489  KTLEEAKKALLDLQEYTNSLERKLETFR---KERDVYKLLSKGKSPSSNKPSECNDI--- 542

Query: 540  KNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESL-------INSKHLIEDRLK-- 590
                         T G L    N LQQ++  L KE E L       +N K  +E  +K  
Sbjct: 543  ----------DKHTTGKLQ---NELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKM 589

Query: 591  -------------ITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAK 637
                         I  ++L L +N  S L     +  Q L ++E + ++  +   +  ++
Sbjct: 590  ESAKEYAEGKAELIENNLLMLQENRKSVLEQN-DHLQQLLSQKEAKLAELTQDLHELTSQ 648

Query: 638  LDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLK-D 696
             +++Q +  +T  + + L+    + + +L + ++E+N  +  I +L  + +N+ + ++  
Sbjct: 649  YNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELE-ISRNECKGIQAT 707

Query: 697  IQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNE 756
            +++ L  ++ + +L   +L   I+ +E            EL WYQ  F + + +   L  
Sbjct: 708  VELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTETEIGLPV 767

Query: 757  KMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLT-------GALETEL 809
             M +   T       T      L+   S +       T   V K T       G  E E 
Sbjct: 768  DMKKEGETGRQSNRDT------LESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEES 821

Query: 810  ATSRT--RLTDTSRELEISSNTIRQYQ---SEIKVLNERQSELENENKHLRDEIAILRDE 864
              ++    LTD+S+ + +  N  ++ +   ++I+ L   + EL+   + +R E   L D+
Sbjct: 822  KEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQ 881

Query: 865  LTHNGGEFEREKEALMKKLSNLEIRQAELTKLE----EDYTAEIEKLKLDLDKQAMLGKE 920
            L      F+ EK +L  +L  + +    LT++     ED   ++E +KL+ ++Q      
Sbjct: 882  LQLEKNSFDTEKASLNNELDKI-MENNSLTEVAKKSLEDDLHDVE-MKLEEERQKHEETN 939

Query: 921  IKLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERM 980
              L+  E + E        YR EL   +  + +V ++  +ELE  + + N++I+      
Sbjct: 940  ATLSEKELLCEKMIEEISGYREELS--KSAEMQVDIQHTRELEDLLDLANKRID------ 991

Query: 981  KQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKN 1040
                 + +LL EQ+         DL D     +  D++  +  E+  L+ KL   + E  
Sbjct: 992  -DLCTQNNLLHEQLN-----ATLDLEDTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGE 1045

Query: 1041 RLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVK 1100
             LRE+    +SE+  ++   +     ++  +       +E + ++  L+E+N+SL  EV 
Sbjct: 1046 VLRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDE-LKEVHLLRENNVSLLTEVN 1104

Query: 1101 LAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQ 1160
              +  N  +  EL++++     ++ Q +        KD ++   + E  R K     M  
Sbjct: 1105 QLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVH 1164

Query: 1161 NGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSL 1220
               +D +  L    ++ + +L   ++       +L ++F  LK+QA E+LDA+K+ I +L
Sbjct: 1165 --RQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTL 1222

Query: 1221 RDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIE 1280
             +++  +      L++V++    ++ E+   ++E++E     ++L +E        K+ E
Sbjct: 1223 NNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEKTF-----KENE 1277

Query: 1281 AELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDEK 1340
            A+LN+T     +L   LN+E+ SL+ E+  L+       + ++E + ++ +M+  FE EK
Sbjct: 1278 AKLNKTITMLQKLNETLNQEVVSLREEINVLR-------KKDDETNQLISTMKLDFEREK 1330

Query: 1341 IAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDI 1400
                         RL EE  K++   E  E  ++ ++ +++    EN       S+V  +
Sbjct: 1331 ------------DRLIEE--KVRELNEKFESGRNEVLSKQS----ENVTNDNTGSNVDKL 1372

Query: 1401 -ETLQKQWEASNKER-----------LVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKE 1448
             + L+K WE    +R           + L  +EK  +++  +  ELE  F  RV  K   
Sbjct: 1373 KQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEK-AN 1431

Query: 1449 LNALKD---------------EIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERK 1493
            L AL D               E+E   +   +  L  ++ +AFEEGK+QA MK ++LERK
Sbjct: 1432 LIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERK 1491

Query: 1494 IAKLEAE--------SKATKSGSDMS-VSEDAPRFVTPNNNKVQQANQPFLATA--GSGF 1542
            ++KLE++        SK  KS S ++ +  ++P+    N     +A      TA   SG 
Sbjct: 1492 LSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGK 1551

Query: 1543 SVQSSESNPFTTPVSRGAAHTNASSQS--KFAPTF 1575
             V S++SNPFT+P    +   + ++      APTF
Sbjct: 1552 DV-SNDSNPFTSPTQELSKSNSPAALPIVHMAPTF 1585

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  191 bits (485), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 353/1394 (25%), Positives = 634/1394 (45%), Gaps = 221/1394 (15%)

Query: 309  LEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQ 368
            L+KQ+  FV ELE   P ++  ++++++   ++H     +   +K K    +E+   +++
Sbjct: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360

Query: 369  LEQISGQDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTS 428
            ++ ++     LR +R DLA Q+Q+LL    V  SD  L  SE S+IK I+     E   +
Sbjct: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLT---VNSSDTVLPPSELSFIKTIIEN---ENWDA 414

Query: 429  STDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSIEAINEAKQ 488
              DSQ I+S R+L+F +I ELQ+QN+ L+S VR+L D+ E+ E   +SG ++EA   AK 
Sbjct: 415  YKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEA---AKL 471

Query: 489  TLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMA 548
             +  L+Q N+ LE++V++    ++                 L DG+   +L +K +  M 
Sbjct: 472  QISKLEQSNAQLESEVKNWEALMET----------------LKDGD---SLDSKINVTMV 512

Query: 549  ESSETIGHLYSQINNLQQSKSD----LAKECESLINSKHLIEDRLK--ITQDM-----LD 597
            E  + I  L S++ ++ +S       L K  +   ++ +++ +++K  +  DM     L 
Sbjct: 513  EQQKKIEELESKLTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELI 572

Query: 598  LSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQ---RQLENTLV---- 650
              K EN +L  +I      L E   +++Q  + Y   +A+L V     +  EN+      
Sbjct: 573  ACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTE 632

Query: 651  EKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLEL 710
            EK  ++  Q S+ +K+ Q  K+    +    +L      ++   K  + +L +KI  L  
Sbjct: 633  EKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSE 692

Query: 711  ENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTV 770
            EN  L N +  KE      +   + +++WYQ   D LS  N   + K+IE    +     
Sbjct: 693  ENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLR---- 748

Query: 771  KTQTLDILLQEANSKNKLL----EARETVDDVNKLTGALETELATSRTRLTDT-SRELEI 825
                   LL E +  NK      E +E  +++N +  ALE    +  T   DT  R    
Sbjct: 749  -------LLSEKSLSNKPYPVGTELKELQNELNGMKAALEVS-ESQATLYKDTLERNQNF 800

Query: 826  SSNTIRQYQSEIKVLNERQSELENENKHLRDEIAILRDELTHN-----GGEFER------ 874
             +N+   +Q+ I       SEL+++N+ L  +   L++++T       G + E       
Sbjct: 801  YNNSTLSFQNTI-------SELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDR 853

Query: 875  ---EKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQ---------AMLGKEIK 922
               EK AL +KL++L   + ++ +++ +Y A+I+K++ +L  Q         A+  KE +
Sbjct: 854  LTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKE 913

Query: 923  LAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERMKQ 982
            L       +++  NTE  +   ++  + +     E  K L      L ++++L  +R++ 
Sbjct: 914  LTS--YAVQIEQLNTEIAKLNSDIAALTEP---AEARKTLIKERDSLGQELKLANQRIES 968

Query: 983  FSDEESLLREQVKLLADEKASDLVDAGVSP--EYTDLVRKLSDEKKNLESKLFASQSEKN 1040
             + + S+L +    +        VDA   P  +  +LV  L  E+   +S+   +Q +  
Sbjct: 969  LAAQNSILYDTFSGMRH------VDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVK 1022

Query: 1041 RLREQLTKTESEIAVLNMNYEQA----KKEVAAEVNNESGRAEEHIAQLESLKESNMSLT 1096
             L++ L +   ++A+     ++     K + +  V +E    E  +  L + KE N+ L 
Sbjct: 1023 LLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRE--LEGLTNTKEENLYL- 1079

Query: 1097 NEVKLAQMRNGEIIAELNELKTKFKSVESQLDEAR-------NVLSSKDM--KLMELQTE 1147
                       E I  LNE K   +   S+L E+        + +S ++   K+   Q E
Sbjct: 1080 ----------DESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAISEQEWQQKIETYQQE 1129

Query: 1148 CSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQAR 1207
              + K     M +N    +++E +  LQ  + T    +      N +L DRF RLK+QA 
Sbjct: 1130 SEKWKLMCQQMSEN----TATE-IQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAH 1184

Query: 1208 ERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKT 1267
            E+L+ASK T +SL   +  L     ALQ+ +  +  E N + ++       +A++ +LK 
Sbjct: 1185 EKLNASKATSDSLAIELSELKTVNDALQEKL--NNQETNSVDSE-----SNAALILQLKE 1237

Query: 1268 ELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP-QGN---E 1323
            E      + K +E EL  +  SS +L   + +E+ +LK             P QG+   E
Sbjct: 1238 E----NKQAKSLELELRHSVDSSEKLIADMTKELTTLKEN-----------PIQGSVNVE 1282

Query: 1324 EMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRL 1383
            + +  +E ++  FEDEK   ++ T+ +   R   E+ +L      LE+ +  L  E  R 
Sbjct: 1283 DYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNNNANLEELRKPLEEEWER- 1341

Query: 1384 GEENTALMKARSDVPDIETLQKQWEASN--KERLVLLYKEKSDQMMRAKMDELEEQFQNR 1441
                             +TLQ+  EA    K+ + L  +EK ++++  +  +LEEQFQ +
Sbjct: 1342 -----------------KTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTK 1384

Query: 1442 VRNK----------EKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILE 1491
            V  +           K  + L+ E+ E+ KT  E+    +KK+AFEEG+QQA+MK ++LE
Sbjct: 1385 VAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLE 1444

Query: 1492 RKIAKLEAE----SKATKSGSDMS-VSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQS 1546
            RKIAKLEA     +   KS + ++ ++ D+P  V          N+P L    + F+  +
Sbjct: 1445 RKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAG-----PLTNEPVLDEKPNAFAGAT 1499

Query: 1547 SESNPFTTPVSRGAAHTNASSQSKFA---------PTFLLNSQPPVLVSGSSDED--NDT 1595
                  TT +S+  + T   S + F+         P F   +Q P    GS ++   +D 
Sbjct: 1500 ------TTTISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQ-PAFSFGSFNKTSFSDL 1552

Query: 1596 MRGTSVDEDAGTAV 1609
                SV   +GT  
Sbjct: 1553 SHKNSVGAASGTPF 1566

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  183 bits (464), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 373/1569 (23%), Positives = 682/1569 (43%), Gaps = 228/1569 (14%)

Query: 183  LISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKL 242
            L++Q ++LS  + Q+  +I+ L D   + + +++ E+ LQK+   LL+ Q+ S EK   L
Sbjct: 237  LLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSL 296

Query: 243  VGHXXXXXXXXXXXXXX--------VALQ--------QRSHSISMDSLLTGNDET----S 282
                                       LQ        QR  +I  D +    DE     +
Sbjct: 297  SAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCI--EEDEAAFDNT 354

Query: 283  HSMSEXXXXXXXXXXRLKRETLS----KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSD 338
            H++             LKR+ +     K +L+ Q+  F+ ELE+  P + SFK+++E  +
Sbjct: 355  HNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLE 414

Query: 339  AQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLN-G 397
             ++      LE ++  K    +E+   ++++         L ++R DLARQ++ LLLN  
Sbjct: 415  QELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNIS 474

Query: 398  FVKDSDDPLTSSEFSYIKEILNTDPEEGNTSS-TDSQLIISKRMLKFKSIVELQQQNINL 456
             V+    PL++ E   +K++L    E G+  +  DSQ+II++R+++F +  ELQ++N+ L
Sbjct: 475  AVQKKASPLSNDELISLKKLL----ESGDVPNEKDSQIIITERLVEFNNTNELQEKNMEL 530

Query: 457  LSAVRTLSDRAETLERKLESGDSI---EAINEAKQTLLDLQQYNSSLEAKVESLTN---- 509
            L+ VR L+D+ E  E K +   +    + I EAK  +++L+  NS+LE++++ L+     
Sbjct: 531  LNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDS 590

Query: 510  -KLKANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSK 568
             KL A+ +   I       ++ ++   I+ L+++      E+S  +  L  ++   ++S+
Sbjct: 591  YKLLASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQ 650

Query: 569  SDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQ-ALKEREVETSQT 627
            S+     +   N K L  ++  + Q  +D  K +    R+   ++   ++   E E SQ 
Sbjct: 651  SNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQY 710

Query: 628  IKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQ 687
              K    + ++  + ++  NT      L+  + S+   L +  KE+   Q  + +     
Sbjct: 711  KNKTKSLMCEISNLSKK--NT-----DLRCMKESLTRDLERCCKEKMQLQMKLTESETSH 763

Query: 688  KNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSL 747
              Q  +    QV    KI +LE    EL N++ +K     +  T+  ++L+W Q   D  
Sbjct: 764  NEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDT 823

Query: 748  SGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALET 807
              +  +L+  + E  +TI  L+++ + L+I LQ+   + KLL       D N L  AL+ 
Sbjct: 824  EKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLN---NSSDANTLETALKK 880

Query: 808  ELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNE-----------RQSELENENKHLRD 856
            EL  S+  L D   ++E     I   ++ +K LN+           +   L+ EN    +
Sbjct: 881  ELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEE 940

Query: 857  EIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAM 916
            EI+ LR EL    G        L  KL    +R  + ++   + T  I+ +   +DK   
Sbjct: 941  EISFLRRELDEIRG--------LQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTT 992

Query: 917  LGKEIKLAHDEEVREVQNR-------NTETYRNELELV----EIRQTKVFVEKEKEL--E 963
            +   ++L  + E  + Q +       +    R E E++    E+++TK  +   +EL  +
Sbjct: 993  I---VELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDK 1049

Query: 964  SRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVS-----PEYTDLV 1018
               K + E+ + ++E +      ESL  E   L+      + +D G        EY  LV
Sbjct: 1050 HERKWMEEKADYERELISNIEQTESLRVENSALV------EKIDDGTGENNGDKEYLKLV 1103

Query: 1019 RKLSD---EKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEV--AAEVNN 1073
               S    E+  LE+KL   + +    +++    E  +  +   +  ++K+V  + ++ +
Sbjct: 1104 SLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIID 1163

Query: 1074 ESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNV 1133
            E     + IAQ+  LKE+N  L   +K    +N  I  E   L+ +   ++  L + +  
Sbjct: 1164 EFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQ 1223

Query: 1134 LSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANT 1193
            +S    K++  ++E  + K    ++ Q   K++  +    L + ++ L  ++ N ++AN 
Sbjct: 1224 VSVNANKVLVYESEIEQWKQRYDNLSQQ-QKETHKDETEKLFNEISDLKAKLLNAQNANA 1282

Query: 1194 ELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQ 1253
            +L D+F RLK+QA E+LDASK    +L + V+ L   K  L++ +   + ++ EL AK++
Sbjct: 1283 DLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELEAKLK 1342

Query: 1254 EHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKE 1313
            +H             L      +KD E    +TSK        L EEIE LK E+Q  KE
Sbjct: 1343 KH-------------LVQAEGVSKDQEE---DTSK-------PLMEEIELLKRELQVFKE 1379

Query: 1314 ASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEK 1373
             S +        S  +E M++  E EK   ++  + + E +L E  GK            
Sbjct: 1380 TSDS--------SDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEATGK------------ 1419

Query: 1374 DSLVMEKTRLGEENTALMKARSDVPDIETLQKQW---------------EASNKERLVLL 1418
                         NT       +  ++E L+KQW               E + K+R+ L 
Sbjct: 1420 -------------NTGATIENGE--NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLP 1464

Query: 1419 YKEKSDQMMRAKMDELEEQFQNRVR-----------NKEKELNALKDEIEEKCKTGHEDT 1467
             +E+  +++  + +ELE++FQ +++            KE E+NA  D      K   E  
Sbjct: 1465 SEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSDKKENEVNAEDDLWNSPSKGNSEKP 1524

Query: 1468 LIA---VKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFVTPNN 1524
             +    ++++     +Q    K  I+         +S+ T S  +     D P   T  N
Sbjct: 1525 SVVTNLIRQKNLILQEQLKNPKKGIISN-------DSRPTSSNKE----NDIPGSTTAEN 1573

Query: 1525 NKVQQAN--QPFLATAGSGFSVQSSESNPFTTPVSRGAAHTNASSQSKFAPTFLLNSQPP 1582
                  N  +P   +  S F    S  NPFT   +        S  +  +P F  N +P 
Sbjct: 1574 KAPLAFNFGKPLFPSNTSSF---QSFQNPFTPAAT--------SFNTGVSPVF--NIKPA 1620

Query: 1583 VLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNE--NN--KRPGEGESNLKSPSKKTRSVSE 1638
            + V  +     DT +   ++ DAGT    + E  NN  KRP E E +  + SKK   V E
Sbjct: 1621 LAVDATV----DTFKTPGLN-DAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKK---VKE 1672

Query: 1639 ESSGDSTGD 1647
             S  D   +
Sbjct: 1673 NSDNDQVSE 1681

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  175 bits (443), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 379/1596 (23%), Positives = 706/1596 (44%), Gaps = 285/1596 (17%)

Query: 183  LISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKL 242
            L++Q ++LSQ + ++  +++ L D   + + E++ E+ LQK+   LL+ Q+ SLEK+  L
Sbjct: 237  LLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSL 296

Query: 243  VGHXXXXXXXXXXXXXXVALQ----------------QRSHSISMDSLLTGNDE---TSH 283
                               +                 QR  +I MD   T  +E   T+ 
Sbjct: 297  RAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDC--TKEEEATMTTS 354

Query: 284  SMSEXXXXXXXXXXRLKRETLS----KQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDA 339
            ++S            LKR+ +     K +L+ Q+  F+ ELE   P + SFK++++  + 
Sbjct: 355  AVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEH 414

Query: 340  QIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLN-GF 398
            ++ +    LE V+  K    +E+   ++++         L ++R DLARQ++ LLLN   
Sbjct: 415  ELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSA 474

Query: 399  VKDSDDPLTSSEFSYIKEILNTDPEEGN-TSSTDSQLIISKRMLKFKSIVELQQQNINLL 457
            ++++  PL+  E   +++IL    E  N  +  DSQ II++R+++F ++ ELQ++N+ LL
Sbjct: 475  IQETASPLSQDELISLRKIL----ESSNIVNENDSQAIITERLVEFSNVNELQEKNVELL 530

Query: 458  SAVRTLSDRAETLERK----LESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKA 513
            + +R L+D+ E  E K    L+  ++ + I EAK  +++L+  N+ +E ++  L   L+ 
Sbjct: 531  NCIRILADKLENYEGKQDKTLQKVEN-QTIKEAKDAIIELENINAKMETRINIL---LRE 586

Query: 514  NEHFTSIGDGEFGNSDLSDGNNIQALKNK--------YDSLMAESSETIGHLYSQINNLQ 565
             + +  +   E   ++ +   +++A + K          S   E+S  I +L  ++   +
Sbjct: 587  RDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYK 646

Query: 566  QSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKER----- 620
            +S+       E   N K L +++ ++ ++ +D  K E    ++ + +     KER     
Sbjct: 647  KSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTEL 706

Query: 621  ----------EVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQ-----NAQSSIENK 665
                      E E S+  K+    +   + + R  E    EK  LQ     +  S  ENK
Sbjct: 707  SQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENK 766

Query: 666  LNQALKE-----------------RNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDL 708
            ++ + KE                 R++ Q  I ++ +++  +D QLK      QN IDD 
Sbjct: 767  MDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLK----WAQNTIDDT 822

Query: 709  ELENTELRNKIDTKETSP---SSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTI 765
            E++   L  ++  KET+    SS + N   EL   + ++  L  ++DA         ST+
Sbjct: 823  EMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDA---------STL 873

Query: 766  E-TLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELE 824
            E TL  + + + + L++ANS+   ++A E +             ++++   L +   EL 
Sbjct: 874  EPTLRKELEQIQVQLKDANSQ---IQAYEEI-------------ISSNENALIELKNEL- 916

Query: 825  ISSNTIRQYQSEIKVLNERQSELENENKHLRDE-IAILRDELTHNGGEFEREKEALMKKL 883
              + T   Y ++I        ELE + K  R+E ++ LR EL    GE      AL  KL
Sbjct: 917  --AKTKENYDAKI--------ELEKKEKWAREEDLSRLRGEL----GEIR----ALQPKL 958

Query: 884  SNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNRNTETYRNE 943
                +      +  E    E+E+++  ++K   +   ++L   +E+ + Q+   E  ++ 
Sbjct: 959  KEGALH---FVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKEN-KDL 1014

Query: 944  LELV------------EIRQTKVFVEKEKEL--ESRIKILNEQIELDKERMKQFSDEESL 989
             ELV            E+ +TK  +   ++L  +   K + E+ + ++E +      ESL
Sbjct: 1015 SELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESL 1074

Query: 990  LREQVKLLADEKASDLVDAGVSPEYTDLVRKLSD---EKKNLESKLFASQSEKNRLREQL 1046
              E   L+  EK  D        ++  LV   S+   E+ +LE+KL   + E   ++++ 
Sbjct: 1075 RVENSVLI--EKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKN 1132

Query: 1047 TKTESEIAVLNMNYEQAKKE--VAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQM 1104
               E  I  L      ++KE   +A + +E     + + Q+  LKE+N  L   +K    
Sbjct: 1133 DSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTE 1192

Query: 1105 RNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNK 1164
            +N EI  +LN+ + +   ++  L + +  +S    K++  ++E  + K    D+ Q   K
Sbjct: 1193 KNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQ-QK 1251

Query: 1165 DSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNV 1224
            D+  + +  L + ++ L  ++ + ++AN +LE++F RLK+QA E+LDASK          
Sbjct: 1252 DAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASK---------- 1301

Query: 1225 ETLTKDKTALQDVIERSKDELNELRA---KIQE--HIETSAVMKELKTELAAVMSKNKDI 1279
                K + AL        +ELNEL+A   K+++  H E + V+ +L T+L A   +++D+
Sbjct: 1302 ----KQQAALT-------NELNELKAIKDKLEQDLHFENAKVI-DLDTKLKAHELQSEDV 1349

Query: 1280 EAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDE 1339
              +  + +  +      L EEIESLK E+Q  K A+S+                 AFE  
Sbjct: 1350 SRDHEKDTYRT------LMEEIESLKKELQIFKTANSSSD---------------AFE-- 1386

Query: 1340 KIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENT--ALMKARSD- 1396
                                 KLK  M   EKEKD ++ E+T+  E+     L K+ S  
Sbjct: 1387 ---------------------KLKVNM---EKEKDRIIDERTKEFEKKLQETLNKSTSSE 1422

Query: 1397 ---VPDIETLQKQW---------------EASNKERLVLLYKEKSDQMMRAKMDELEEQF 1438
                 DIETL+K+W               E + K+R+ L  +E+  +++  + +ELEE+F
Sbjct: 1423 AEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEF 1482

Query: 1439 QNRVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLE 1498
            + +++     L  L +      K   ED    +     +   ++ +     + +K  K +
Sbjct: 1483 RKKLKENAGSLTFLDN------KGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQ 1536

Query: 1499 AESKATKSGSDMSVSEDAPRFVTPNNNKVQQANQ------PFLATAGSGFSVQSSESNPF 1552
             + K  K  +D+S + D+   VT   N +  ++       P  +     FS  +S    F
Sbjct: 1537 EQLKNVK--NDVSFN-DSQSMVTNKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSF 1593

Query: 1553 TTPVSRGAAHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDT-MRGTSVDEDAGTAVPS 1611
              P +   ++ N +     AP   LN QP V V  + +  N T +   S D   G  +  
Sbjct: 1594 QNPFTASQSNINTN-----APLRTLNIQPEVAVKAAINFSNVTDLTNNSTD---GAKITE 1645

Query: 1612 LNENNKRPGEGESNLKSPSKKTRSVSEESSGDSTGD 1647
            +   +KRP E  +   S    T+ V E  + D   +
Sbjct: 1646 IGSTSKRPIESGT---SSDPDTKKVKESPANDQASN 1678

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  156 bits (394), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 357/1566 (22%), Positives = 691/1566 (44%), Gaps = 188/1566 (12%)

Query: 161  SKTGALVSKEEELRLAKSERAS-------LISQTERLSQELLQRDADIRQLVDADKLRQD 213
            +KT  L + EE+L   ++E  S       L+ Q ++LS  + ++  +I+ L D     + 
Sbjct: 208  TKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKS 267

Query: 214  EYTDEINLQKHRARLLQEQVASLEK----------EAKLVGHXXXXXXXXXXXXXXVALQ 263
            E++ E+ LQK    LL+ Q+ S E+          + KL  +              + L+
Sbjct: 268  EFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLE 327

Query: 264  QR-----------SHSISMDSLLTGNDETSHSMSEXXXXXXXXXXRLKRETLSKQKLEKQ 312
            +            S  I  +      +  + ++ +          +L +E   K +++ Q
Sbjct: 328  KSKEECQLLKNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQ 387

Query: 313  VHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQI 372
            +  FV ELE   P + SFK+++E  + ++      LE ++  K    +++   ++++   
Sbjct: 388  LKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSY 447

Query: 373  SGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTD 431
                  L R+R DLARQ++ LL N   ++ +  PL++ E   ++++L +   E   +  D
Sbjct: 448  EANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLES---ENTVNERD 504

Query: 432  SQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI-----EAINEA 486
            SQ+II++++++FK+I ELQ++N+ LL  +R L+D+ ET E   E+  ++     + I EA
Sbjct: 505  SQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEG--EADKTVAKIENQTIKEA 562

Query: 487  KQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEF-----GNSDLSDGNNIQALKN 541
            K+ +++++  NS L  +V  LT +  + +   S  D +      G ++ +    I+ L++
Sbjct: 563  KEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQS 622

Query: 542  KYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKN 601
            K  S   ESS  I +L  Q+   ++S++D     +   N K L+ ++             
Sbjct: 623  KLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEK------------- 669

Query: 602  ENSTLRNRIKNTSQALKEREVETSQTIKKY----LDCVA----KLDVIQRQLENTLVEKD 653
              + L+ RI +    L+++ +  +  ++ Y    L  ++    K+  ++ ++ N   E  
Sbjct: 670  -EAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENT 728

Query: 654  ILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENT 713
             L   + S+   L +  KE+      + +       Q+      ++    +I  LE    
Sbjct: 729  GLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLK 788

Query: 714  ELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQ 773
            EL  ++++KE    +  ++  ++L+W Q   D    +  +++ ++    +TI  L+++ +
Sbjct: 789  ELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIE 848

Query: 774  TLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQY 833
             L   L+    + K L       D N L   L  EL  ++  L D   +++     I   
Sbjct: 849  NLGNELRMTKLQYKFLS---NTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTN 905

Query: 834  QSEIKVLN----------ERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKL 883
            ++ +K LN          E + +LEN+ K  ++E      EL+H   E + E   L  KL
Sbjct: 906  ENVLKELNGELKKAKEDCETKIQLENKEKGAKEE------ELSHLRKELD-EIRCLQPKL 958

Query: 884  ---SNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQ-----NR 935
               ++  + Q+E      D    I+++K  +DK A +   I+    EE  + Q     N+
Sbjct: 959  REGASYLVLQSEKVG---DQAQRIQEMKNKIDKMAAI---IEAYQKEESSQYQSELKTNK 1012

Query: 936  NTETYRNELE------LVEIRQTKVFVEKEKELESRI--KILNEQIELDKERMKQFSDEE 987
            +   +   LE        E+++TK  +   +EL  R   K + E+ + ++E +      E
Sbjct: 1013 DLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTE 1072

Query: 988  SLLREQVKLLADEKASDLVDAGVSPE-YTDLVRKLSD---EKKNLESKLFASQSEKNRLR 1043
            SL  E   L+  EK     +   S E Y +LV   S+   E+ +LE+KL   + +   LR
Sbjct: 1073 SLRVENSVLI--EKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLR 1130

Query: 1044 EQLTKTESEIAVLNM--NYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKL 1101
            ++    E  I  L       + K +  A + +E  +  + IAQ+  L+E+N  L   +K 
Sbjct: 1131 QKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKN 1190

Query: 1102 AQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQN 1161
               +N  I  EL  ++ +   ++  L + +  +S    K++  ++E  + K    D+ Q 
Sbjct: 1191 VTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQ 1250

Query: 1162 GNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLR 1221
                  +E    L + +  L  ++ N+++AN +LE++F RLK+QA E+LDASK       
Sbjct: 1251 QKLTHKNE-TEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASK------- 1302

Query: 1222 DNVETLTKDKTALQDVIERSKDELNELRAKIQEHI---ETSAVMKELKTELAAVMSKNKD 1278
                   K +TAL + +    +EL E + K++E++   E+  V  ELK          K+
Sbjct: 1303 -------KQQTALTNEL----NELKETKDKLEENLHNEESKVVDLELKL---------KE 1342

Query: 1279 IEAELNETSKSSNQLT-TALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFE 1337
               ++ E SK  + +      EEIESLK E+Q  + A+ A        S   E ++   E
Sbjct: 1343 HGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNANDA--------SDAFEKIKNNME 1394

Query: 1338 DEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDV 1397
            +EK   +   ++D E +L +   K K     +E  +    ++K  L E     +K     
Sbjct: 1395 EEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRI--- 1451

Query: 1398 PDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKELNALKDEIE 1457
                   K+ E + K+R+ L  +E+  +++  +  ELE++F+ +++   K L       E
Sbjct: 1452 -------KEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSL-VFSGSNE 1503

Query: 1458 EKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAP 1517
            E+     ED L     +   E   + ++   ++++K  KL+ + K  K+   ++ ++  P
Sbjct: 1504 EEA----EDELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNVKNA--VTFNDKRP 1554

Query: 1518 RFVTPNNNKVQQANQ----PFLATAGSG-FSVQSSESNPFTTPVSRGAAHTNASSQSKFA 1572
            +     NN    A      P   + G   FS  +S    F  P +  AA  N S+     
Sbjct: 1555 KSENKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAA--NFSTDGSL- 1611

Query: 1573 PTFLLNSQPPVLVSGSSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPGEGESNLKSPSKK 1632
            PTF + S      +G++ + +D      ++E     V  +   +KRP + +++    SKK
Sbjct: 1612 PTFNIKSAFAAGTAGNTLKTSDPA-NVGINE---AKVMEIGNTSKRPIQSDTSSDPDSKK 1667

Query: 1633 TRSVSE 1638
             +   E
Sbjct: 1668 FKESPE 1673

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  154 bits (390), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 366/1595 (22%), Positives = 700/1595 (43%), Gaps = 234/1595 (14%)

Query: 157  ADLDSKTGALVSKEEELRLAKSERAS-------LISQTERLSQELLQRDADIRQLVDADK 209
            AD  +K   + + EE+L  A+++R S       L+ Q ++LS  + ++  +I+ L D   
Sbjct: 204  ADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTAC 263

Query: 210  LRQDEYTDEINLQKHRARLLQEQVASLEKEA----------KLVGHXXXXXXXXXXXXXX 259
            + + E++ E+ LQK    LL  Q+AS E++            L                 
Sbjct: 264  IEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTK 323

Query: 260  VALQ------QR-----SHSISMDSLLTGNDETSHSMSEXXXXXXXXXXRLKRETLSKQK 308
            V  Q      QR     S  +  D      +  SH++ +          +L +E   K +
Sbjct: 324  VQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQ 383

Query: 309  LEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQ 368
            L+ Q+  F+ ELE   P + SFK++++  + ++ +    LE ++  K    +E+   +++
Sbjct: 384  LQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQK 443

Query: 369  LEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEEGNT 427
            +        +L ++R DLARQ++ LLLN   ++ +  PL+  +   +++IL +     + 
Sbjct: 444  INSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESG---SDV 500

Query: 428  SSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDS---IEAIN 484
            +  D+Q IIS+R+++F +I ELQ++N+ LL  +RTL+D+ E  E K ++  +    + I 
Sbjct: 501  NENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIK 560

Query: 485  EAKQTLLDLQQYNSSLEAKVESL-----TNKLKANEHFTSIGDGEFGNSDLSDGNNIQAL 539
            EAK  +++L+  N  +E+++  L     + KL A+    ++       +++S    I+ L
Sbjct: 561  EAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKEL 620

Query: 540  KNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDML--- 596
            + +  S   ESS  I +L  ++   ++   D     +   N K L +++  I +  +   
Sbjct: 621  EAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNL 680

Query: 597  --DLSKNENSTLR----NRIKNTSQALKER---EV---ETSQTIKKYLDCVAKLDVIQRQ 644
              DL K + S       N+++++++ L+ R   E+   E S   K+  + +   + + R 
Sbjct: 681  KTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEISSLKKETANSMVLKESLTRD 740

Query: 645  LENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNK 704
            LE    EK  LQ      E  LN+   ++ NF     +  A  K  +E L+ +++ L++K
Sbjct: 741  LERCCKEKIQLQMKLKESEISLNE---QKVNFDSKGIKYDARIKQLEESLERLRIELKSK 797

Query: 705  IDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECAST 764
              +++                  S  ++  ++L+W Q   D       ++  ++     T
Sbjct: 798  AQEIK------------------SLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKT 839

Query: 765  IETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELE 824
            + TL+ K + LD  L+E   K + L       D + L  AL  EL  ++  L D   ++ 
Sbjct: 840  VVTLSSKIENLDNELRENKLKYEFL---NNTSDASTLQPALRKELEQTQLELKDAHSQVR 896

Query: 825  ISSNTIRQYQSEIKVLNERQS----------ELENENKHLR-DEIAILRDELTHNGGEFE 873
                 I   +  +K LN + +          ELE + K    +E+++LR EL        
Sbjct: 897  TYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEI----- 951

Query: 874  REKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQ 933
            R  +  +K+ +   ++Q+E  +   +   +I+++K  +DK     +  K     + + + 
Sbjct: 952  RSLQPKLKEGTVCLVKQSEKLR---NQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIM 1008

Query: 934  NRNTE----TYRNELEL----VEIRQTKVFVEKEKEL--ESRIKILNEQIELDKERMKQF 983
              N E      R E E     +E+++ K  + K ++L      K + E+ + ++E +   
Sbjct: 1009 KANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNI 1068

Query: 984  SDEESLLREQVKLLADEKASDLVDAGVSPE-YTDLVRKLSD---EKKNLESKLFASQSEK 1039
               ESL  E   L+  EK   + +     E Y  LV   S+   E+ +LE+KL   + + 
Sbjct: 1069 EQTESLRVENSVLI--EKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDL 1126

Query: 1040 NRLREQLTKTESEIAVLNMNYEQAKKEV--AAEVNNESGRAEEHIAQLESLKESNMSLTN 1097
              ++++    E  I  L ++   ++ E+  +A + +E     + IAQ+  LKE+N  L  
Sbjct: 1127 ALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQK 1186

Query: 1098 EVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHD 1157
             +K    +N EI  EL   + +   ++S L + +  +S    K++  ++E  + K   HD
Sbjct: 1187 SLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHD 1246

Query: 1158 MPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTI 1217
            +     ++   + +  L S ++    ++ + ++  TELE++F RLK+QA E+LDASK   
Sbjct: 1247 LS-TQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASK--- 1302

Query: 1218 NSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNK 1277
                       K +TAL        +EL EL+          AV  +L+ +L +   K  
Sbjct: 1303 -----------KQQTALT-------NELKELK----------AVRDKLEQDLNSKNFKTV 1334

Query: 1278 DIEAELNETSKSSNQL--------TTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVV 1329
            D++ E  E +  S  L        +  L EEIESLK E+Q  K A+++        S   
Sbjct: 1335 DLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNANNS--------SDAF 1386

Query: 1330 ESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTA 1389
            E +R   E+EK             ++  ER K        EK+ + +V +    G     
Sbjct: 1387 EKLRDNMEEEK------------NKIINERTK------EFEKKLEEIVSKSKSTG----- 1423

Query: 1390 LMKARSDVPDIETLQKQW---------------EASNKERLVLLYKEKSDQMMRAKMDEL 1434
              K   +  +IETL+K+W               E + K+R+ L  +E+  +++  + +EL
Sbjct: 1424 --KVADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEEL 1481

Query: 1435 EEQFQNRVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKI 1494
            EE+FQ +++     L    D      K  ++D    +     +   ++ ++    +++K 
Sbjct: 1482 EEEFQRKLKENASSLTFSCDR-----KETNDDPDEDLWNSPSKGNSERPSVITDFMKQKN 1536

Query: 1495 AKLEAESKATKSGSDM------SVSEDAPRFVTPNNNKVQQA---NQPFLATAGSGFSVQ 1545
             K++ + K  K+G         S++++    V  N++K        +P   +  + F   
Sbjct: 1537 IKVQEQLKKAKNGVFFGDSRSSSMNKENSALVKVNDDKAASTFSFGKPLFPSTTTSF--- 1593

Query: 1546 SSESNPFTTPVSRGAAHTNASSQSKFAPTFLLNSQPPVLVSGSSD-EDNDTMRGTSVDED 1604
             S  NPFT   S   ++T  S      PTF  N +  +L   ++D    D +   S DE+
Sbjct: 1594 QSFQNPFTQ--STIDSNTGVS-----LPTF--NIRTDLLAGVATDTSKTDGLANNSPDEE 1644

Query: 1605 AGTAVPSLNENNKRPGEGESNLKSPSKKTRSVSEE 1639
              T + S     KRP E +++    +KK +   E+
Sbjct: 1645 EITEIGS---TLKRPNEEDASSDPNTKKVKESPED 1676

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  134 bits (337), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 186/771 (24%), Positives = 366/771 (47%), Gaps = 76/771 (9%)

Query: 166 LVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDE------- 218
           L + + ELR+   + A L  + E LS++L  + ++I+ L ++ K    ++  E       
Sbjct: 176 LTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQL 235

Query: 219 INLQKHRARLLQEQVASLEKEA-------KLVGHXXXXXXXXXXXXXXVALQQRSHSI-S 270
           IN  +++ + LQEQ+ SL  E        KL  H              ++ ++R   + S
Sbjct: 236 INALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHS 295

Query: 271 MDSL--------------LTGNDETSHSMSEXXXXXXXXXXRLKRETLSKQKLEKQVHKF 316
           M+                 +G + ++ S+S              +E   K++LE+Q+ + 
Sbjct: 296 MEEFQNIPEEESSSVSSHASGRNNSALSLS---GDVNILRKHFLKERQQKRQLEEQMRQI 352

Query: 317 VTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQD 376
           + ELE+  P + S+K++S   + +++   + LEH+ K+      E+E+ + +   +    
Sbjct: 353 LQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSI 412

Query: 377 KILRRERFDLARQLQYLLLNGFVKDSDDPLTSS----EFSYIKEILNTDPEEGNTSSTDS 432
             L  +R  LARQ++YLLL   +  +++ L SS    +   + + L  +  E     +DS
Sbjct: 413 NSLAFQRTVLARQVKYLLL---IIQNNETLGSSLGRKDLELLGQYLAANTAEA---MSDS 466

Query: 433 QLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER---KLESGDSIEAINEAKQT 489
           + I+ +R+ +FK++ ELQ +N+ LL   R L+ +AE LE+   K  S +  E IN+AK+ 
Sbjct: 467 EKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEA 526

Query: 490 LLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSD--GNNIQALKNKYDSLM 547
           +L LQ+Y+  LE++++ L+++L   +   +  +     S + D   ++   L  +  + +
Sbjct: 527 ILVLQEYSQKLESQIKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANL 586

Query: 548 AESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLR 607
             S + I  L S+I NL Q+ +D+    +   +++ L EDR  + +  + L K+E   L+
Sbjct: 587 KHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQ 646

Query: 608 NRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLN 667
             +    Q + ++E + S + + Y+ C +KL   + ++ +   E ++    Q+++  K  
Sbjct: 647 EEVNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKE 706

Query: 668 QALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPS 727
             L ERNN +  + Q+ +L       LK+ +    +K+    L+ T+  N++   +   S
Sbjct: 707 ALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMS 766

Query: 728 SALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNK 787
              +   +E++WY+   D L  +   LNE++ +    IE  +   + +   L  ANSK  
Sbjct: 767 ELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELTLANSK-- 824

Query: 788 LLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSEL 847
                    DV++   ALE EL+  +++L  ++ E       +++Y++   V++  +   
Sbjct: 825 ---------DVSEEKRALEKELSEVKSQLEKSNLE-------VKEYEN---VISTSKRSF 865

Query: 848 ENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIR----QAELT 894
           EN++    D I  L  +L     E  RE+  L + LS L+ R    Q ELT
Sbjct: 866 ENKSIQYEDRIKALASKL---DSEL-RERTTLQENLSTLQARMVVQQDELT 912

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 25/173 (14%)

Query: 1406 QWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL---------NALKDEI 1456
            Q E + K+R+ L  +EK + ++  +  ELE  F+ +++ + K L           +  EI
Sbjct: 1234 QAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEI 1293

Query: 1457 EEKCKTG----HEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSV 1512
            EE  +       ++ L  V+K+AFEEGKQ   MK + LERKI+ LE + K     ++ S 
Sbjct: 1294 EESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQLKEKNKLNNNSK 1353

Query: 1513 SEDAPRFVTPNNNKVQQANQPFLATAGSGFSV-----------QSSESNPFTT 1554
            +       T  +N   Q N PF        +V            +S  NPFT+
Sbjct: 1354 NLKENVSSTDEHNSSIQGN-PFFNLGKEQMNVPRFTSESSTMSTTSSLNPFTS 1405

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  126 bits (316), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 190/348 (54%), Gaps = 23/348 (6%)

Query: 304 LSKQK--LEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQE 361
           LSKQ   L+  +  ++ ELEQ  P+I++FK + E     ++K  L +E +  DK+   + 
Sbjct: 207 LSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKL 266

Query: 362 VEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNT 420
           ++  KK + + S   + L  +R DLA QLQYLL++  ++ D++ PL+ SE  +++ ++N 
Sbjct: 267 MDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINK 326

Query: 421 DPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKL----ES 476
           D +     S+D Q +IS R++KFK IV LQ++N+ L  ++R L+   E+ E ++    E+
Sbjct: 327 DKQRL---SSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSREN 383

Query: 477 GDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGE------FGNSDL 530
            D+ + INEAK+T+L LQ+YN+ L+ ++ +L +K+  +E  +SI + +      F     
Sbjct: 384 YDN-DTINEAKETILSLQEYNNVLKLEIGTLQSKI--SELQSSIPNSKESEKQHFN---- 436

Query: 531 SDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLK 590
              N ++ L++K   L A S  TI +L   I NL   ++D+    E   +S  L  ++L 
Sbjct: 437 YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496

Query: 591 ITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKL 638
           + Q+  DL   EN  L ++     Q L E E   +  +  Y+ C   L
Sbjct: 497 LLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNL 544

 Score =  120 bits (302), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 241/881 (27%), Positives = 392/881 (44%), Gaps = 150/881 (17%)

Query: 760  ECASTI---ETLTVKTQTLDILL---QEANSKNKLLEARETVDDVNKLTGAL------ET 807
            E +STI   E LT+   + D+L    +E +SKN +LE +   ++ N L   L      +T
Sbjct: 484  EKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKN-LNSVLNDYIKCKT 542

Query: 808  ELATSRTRLT---DTSRELEISSNTIRQYQSEIKVLNERQSELENENKHLR----DEIAI 860
             L     RLT   +    LE  +N+++Q   EIK   E+  +L++++KHL     +EI+ 
Sbjct: 543  NLLDFTNRLTLLNNNKLGLEEENNSLKQ---EIKSNYEQIKDLDSKSKHLEQSLENEISK 599

Query: 861  LRD---ELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAML 917
              D   EL  N  +   +K  L +KL N  I   +L     D  +  +K KLD  ++ + 
Sbjct: 600  YTDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQK-KLDQYEKTIK 658

Query: 918  GKEIKLAHD-------------EEVREVQNRNTETYRNELELVEI----RQTKVF-VEKE 959
              E +L  D             E+ R+    ++    NE+ +       +  K++ +E+E
Sbjct: 659  TLESRLPADTQNSKALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEE 718

Query: 960  KELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVR 1019
            K LE    ++ +++E  K R++  + +  LL E+++  A+ +  D+    VS  Y     
Sbjct: 719  KNLE----LITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIF---VSLRYER--D 769

Query: 1020 KLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEV----AAEVNNES 1075
             LSD+  N E  +    ++   ++ +L    S+I    +N+E  +  V       VN E+
Sbjct: 770  TLSDQVVNYEKDMQVILADLESVQSELNAANSQI----LNFENQRAMVQDHKKGNVNEET 825

Query: 1076 GRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLS 1135
                E + +L+ LKE NM LT E+      N  +  +L E   + K +E+++ E   ++ 
Sbjct: 826  --LIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIE 883

Query: 1136 SKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTEL 1195
             KD  +     +    K   +++  +   + + +L+         L +QV+     N EL
Sbjct: 884  DKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLIN--------LQKQVEEKSKENEEL 935

Query: 1196 EDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEH 1255
             DRF RLK+QA ERL ASKV  N+L +    L    T L+  +    +   EL   I   
Sbjct: 936  SDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLK 995

Query: 1256 IETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEAS 1315
             +    + +LK +LA  + K+K  E EL +T   S  L + L  EIESL  +++  KE+S
Sbjct: 996  DQELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKS-KESS 1054

Query: 1316 SAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDS 1375
                       G+ ES     E+ K   +        A L E+  K K E++   K K+ 
Sbjct: 1055 ----------VGLQES---EIENAKKILI--------AELEEKLNKTKSELDL--KHKEE 1091

Query: 1376 LVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELE 1435
            L + KT                 DI+    + E + K ++ L  +EK + ++ +K+ +LE
Sbjct: 1092 LKVLKTEYE-------------GDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLE 1138

Query: 1436 EQFQNRVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIA 1495
            E ++ ++     E   +     EK K   ED L+  KK+AFEEGKQQA+MK   LE KIA
Sbjct: 1139 EDYKKKLETVSAESTDI-----EKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIA 1193

Query: 1496 KL--------------EAESKAT---KSGSDMSVSEDAPRFV---TPNNNKVQQANQPFL 1535
            KL              EAE K T   KS  ++   E  P F     PN+N       PF 
Sbjct: 1194 KLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTFSPPPNSN-------PFT 1246

Query: 1536 ATAG-----SGFSVQSSES---NPF-TTPVSRGAAHTNASS 1567
             T       S F ++ + S   NPF  +PV+       A S
Sbjct: 1247 TTQDTDSPVSVFGIKPTFSLGANPFKISPVAPSFQTARADS 1287

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  119 bits (297), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 162/633 (25%), Positives = 284/633 (44%), Gaps = 104/633 (16%)

Query: 1016 DLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNN-- 1073
            +L+  L  E+  L+ KL  SQ E   LREQ+   ++ +     +++  + EV+ E+    
Sbjct: 1098 ELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTE 1157

Query: 1074 ESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNV 1133
            +   A + + +L +LKE+N  L  +++     N  I  +L  LK +   ++ +++  +N 
Sbjct: 1158 QHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNS 1217

Query: 1134 LSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANT 1193
            +  KD +L  L  E  R K  S ++     +    E    L   ++TL  Q+D     N 
Sbjct: 1218 IMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEE-HNKLMEELSTLKTQLDTKTKDNE 1276

Query: 1194 ELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQ 1253
            +L DRF RLK+QA E+LDA+K    SL   +  L   K+ L+  ++  +  + E+ ++++
Sbjct: 1277 DLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLK 1336

Query: 1254 EHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKE 1313
            +  +   V+  L+ EL+  +  +K IE  L ET  SS +L   L EE+ SLK +++ LK 
Sbjct: 1337 QKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKN 1396

Query: 1314 ASS--AEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEK 1371
             +   +   G+   S  +  ++++FE EK   +  T+   E +   E  K K   E  ++
Sbjct: 1397 QNGVISVADGSAINSETIAHLKESFEVEKTELI--TTLKEEFKKQLEEEKKKLLEEKEKE 1454

Query: 1372 EKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKM 1431
              DS    K   G          S+  DIE ++ +WE            EK ++++  ++
Sbjct: 1455 YYDS----KPTGG----------SEPIDIEKMKSEWE------------EKQEEIIMQRI 1488

Query: 1432 DELEEQFQNRVR-NKEKELN-------------------------------ALKDEIEEK 1459
             + EE  + R+R   E+++N                                L+ E+E +
Sbjct: 1489 ADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIEEELRKEVERE 1548

Query: 1460 CKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGS----------- 1508
             +   ++ L  VKK+AF EGKQQ+ MK ++LERK++KLE+++  +++             
Sbjct: 1549 LRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEG 1608

Query: 1509 ----------------DMSVSEDAPRFVTPNNNKVQQANQPFL-ATAGSGFSVQSSESNP 1551
                             MS ++D+     P   KV Q N+  L  + GS        SNP
Sbjct: 1609 ATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGS--------SNP 1660

Query: 1552 FTTPVSRGAAH---TNASSQSKFAPTFLLNSQP 1581
            FT P     A    +N  SQ+K      +N  P
Sbjct: 1661 FTLPTQNKPAFLFASNNHSQTKKQDGLPINKSP 1693

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 229/467 (49%), Gaps = 38/467 (8%)

Query: 304 LSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHL---EHVTKDKETIFQ 360
           L ++KLE  +H    ELE  AP + +      Q D +I++L+L L   ++ ++  +T  +
Sbjct: 314 LLQEKLEYLIH----ELENHAPELNN------QYD-KINELELLLSKEKNTSEHFKTTIK 362

Query: 361 EVEQYKKQLEQIS----GQDKI--LRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFSY 413
           E+E  KK +  IS      DKI  LR E  DL  Q+Q++L+ N    D    LT +E  +
Sbjct: 363 EIENEKKNI--ISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKF 420

Query: 414 IKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK 473
           IK +     E       +SQ IIS R+++F+S++ LQQ+N+ L+  +R ++ + +  E +
Sbjct: 421 IKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHE 480

Query: 474 LES---GDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFG---- 526
           L +    ++ + +NEAK+ +L +   +  L+ K+  L  +L AN   +   +G       
Sbjct: 481 LRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLAE 540

Query: 527 NSDLSDGNNI--QALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHL 584
           N   ++G+ +    LKN       ++S  I   + Q+ +L     +L  +      S+ +
Sbjct: 541 NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDI 600

Query: 585 IEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQ 644
            + +L + QD  D     N  L+  ++     ++ ++   + TI  ++DC A L  +   
Sbjct: 601 TQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTND 660

Query: 645 LENTLVEKD---ILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSL 701
           + + + + D    L++ QS I N+L     ER   +  +  ++ +Q   D +  + + S+
Sbjct: 661 MNSLMTKYDELKYLKDQQSRITNELKM---EREQLKMELLNIKTVQIQSDLESAEYKASV 717

Query: 702 QNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLS 748
            +KI+DLE+ N+ L   + TKE      ++    EL+WYQ KFD  S
Sbjct: 718 ASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIFS 764

 Score = 38.5 bits (88), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 1197 DRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQ 1253
            DRF RLK+QA  RL +SK   N+L + + +L KD   +Q  +E     + EL  +I+
Sbjct: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQIK 1045

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 127/217 (58%), Gaps = 22/217 (10%)

Query: 298 RLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKET 357
           +L +E   K  L++QV  F+ ELEQ  P+I SFK+++   + ++ ++   LE   K+++ 
Sbjct: 373 QLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDI 432

Query: 358 IFQEVEQYKKQL---EQISGQDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSSEFSYI 414
             +E+   +K++   EQ + +   L R+R DLA Q+QYLLL     D+  P T  E + +
Sbjct: 433 KDRELTNLQKKISNNEQFNDE---LLRQRSDLAHQVQYLLL---CIDNKSPFTEKEATLV 486

Query: 415 KEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK- 473
           K+I++ +  E +   TDS  IISKR+L F+++ ELQQ+N+ LL   R L    +TLER+ 
Sbjct: 487 KKIVSNENTEND---TDSHKIISKRLLHFQNVKELQQKNMELLRTTRQL---VQTLERQE 540

Query: 474 ------LESGDSIEAINEAKQTLLDLQQYNSSLEAKV 504
                 L   D+ + +  AK T +DL+++  +LE+K+
Sbjct: 541 QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 577

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 128/496 (25%), Positives = 247/496 (49%), Gaps = 57/496 (11%)

Query: 1080 EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDM 1139
            E+  +L +L+ESN  L  EV+     N  + ++L +++ K + +E +++E +  ++ K+ 
Sbjct: 1064 ENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQ 1123

Query: 1140 KLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRF 1199
             L   Q E  R K  S  + Q G        + +L+  + TL EQ++ ++  N +L DRF
Sbjct: 1124 HLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEK-IKTLEEQLETVRTENAQLTDRF 1182

Query: 1200 GRLKRQARERLDASKVTINSLRDNVETLTKDKT----ALQDVIERSKDELNELRAKIQEH 1255
             RLK+QA E+LDA+K    +L   +  L + K     +LQ  IE++    N    + +E 
Sbjct: 1183 DRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEI 1242

Query: 1256 IETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEAS 1315
            I        L+ EL    + + ++E ++ +  K  N        EIESLK E+Q +K   
Sbjct: 1243 IR-------LRAELEKSNNFSNELEKKVEDAKKFKN--------EIESLKSELQSVKAYE 1287

Query: 1316 SAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEER----GKLKREMEALEK 1371
            ++        S +++ ++++F+ EK   ++   ++ + +L +E+     + K  + A  +
Sbjct: 1288 NSTVN-----SKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQ 1342

Query: 1372 EKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKM 1431
            E  ++   K +  EE  AL+  R           + E + K+R+ L  +EK + ++  + 
Sbjct: 1343 ESANIEELKKKWEEEQEALILKRIT---------EAEENLKKRMRLPSEEKINAVIEKRR 1393

Query: 1432 DELEEQFQNRVRNKEKELNA--------LKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQA 1483
              LE++F+ ++R  E  LNA         + +IE++ +      L  +KK+AFEEGKQQ+
Sbjct: 1394 KVLEQEFETKLR--ELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQS 1451

Query: 1484 TMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPF------LAT 1537
             MK ++LERK++KLE+++ +    +D + ++  P  +  +N  +  ++ P       L  
Sbjct: 1452 MMKSTLLERKLSKLESQTLSPTKNNDSNETQ-VPSKINLSN--INSSSPPLGEKVLQLNY 1508

Query: 1538 AGSGFSVQSSESNPFT 1553
              +  +   ++ NPFT
Sbjct: 1509 GANVVAETDNDDNPFT 1524

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 122/207 (58%), Gaps = 16/207 (7%)

Query: 299 LKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDA-QIHKLQLHLEHVTKDKET 357
           L +E   K  LEK+ + F+ ++E   P +++   ++E ++  +I + ++  EH     ++
Sbjct: 290 LIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHEH-----DS 344

Query: 358 IFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL--NGFVKDSDDPLTSSEFSYIK 415
           +  E +  K +L       K L ++R DL  Q+ YLL+  +   +D++  LT +E ++I+
Sbjct: 345 LKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIR 404

Query: 416 EILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK-- 473
            ++    +  NT ST++Q IIS+R+LKF ++ +L  +NI L+S VR L+++ E++E++  
Sbjct: 405 NLV---AQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNS 461

Query: 474 LESGD---SIEAINEAKQTLLDLQQYN 497
            + GD     ++I+EAKQ ++ L++ N
Sbjct: 462 QKFGDLEMDFKSIDEAKQRMIVLKEEN 488

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 156/641 (24%), Positives = 258/641 (40%), Gaps = 158/641 (24%)

Query: 1001 KASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNM-- 1058
            K S+LVD           + L    K+ ESK    + E N ++++L K  SE        
Sbjct: 603  KISELVDLKAK------CKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTFKSTR 656

Query: 1059 ----NYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELN 1114
                ++ Q K  +    N      +E +  ++SL   N SL  ++KL Q  + +I+ E  
Sbjct: 657  GTIDSFNQNKNSIGINENTNKQLLKEELNTVKSL---NKSLEAKIKL-QENDIKILIE-- 710

Query: 1115 ELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGAL 1174
            + K++ K  + ++DE    +  K           S L +++       NK+   EL   +
Sbjct: 711  KYKSQIKWYQDKIDEMNTTMEVK----------ISNLASSAESAAMLKNKNEIDELKKQI 760

Query: 1175 QSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKT-- 1232
            ++    LTE +D           RF RLK+QA+++L+  K T N LR++   L K K   
Sbjct: 761  ETKSKELTESLD-----------RFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNEL 809

Query: 1233 ------------ALQDVIERSKDEL----NEL--RAKIQEHIETSAVMKELKTELAAVMS 1274
                        +LQ+ I + KDEL    NEL    + QE +       E + +L  +  
Sbjct: 810  EQRLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQRSQEELRNEY---EKQNKLYKI-- 864

Query: 1275 KNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRK 1334
            K +++E+ LN+     NQ  +AL  ++ESL  +V                M  + E ++K
Sbjct: 865  KEEELESALNQLMLKENQ-NSAL--DLESLPDDV----------------MLKLKEMVKK 905

Query: 1335 AFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKAR 1394
              E E    +KA              KLK              +EK    + NT  ++  
Sbjct: 906  DIEIENDIILKA--------------KLKE-------------IEKNSAKDVNTDSIELS 938

Query: 1395 SDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL----- 1449
             D  +I T+++ WE   +  L +  ++  +Q M     ELE++++ R+  + ++L     
Sbjct: 939  DD--NISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEKEYEERLSKESEKLSDQYN 996

Query: 1450 NALKD---------------EIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKI 1494
            N LKD               E+E K K   +++     K+ F++       K  IL +KI
Sbjct: 997  NKLKDDLSEELLKIDKKYAMELETKLKNETDES-----KKEFQDALGTEQTKNKILSKKI 1051

Query: 1495 AKLEAESK-----ATKSGSD-MSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSE 1548
              LE + K      TK  S+ M   E  P     + N     N PF++ A     +    
Sbjct: 1052 EFLETQIKELKDEQTKHHSNPMKSDEKIPSTTNLSTNFAFGQN-PFVSNASQNAYM---- 1106

Query: 1549 SNPFT--TPVSRGAA-----HT---NASSQSKFAPTFLLNS 1579
            SN F   +P SR A      H+   N +S     PT   N+
Sbjct: 1107 SNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQPTLTFNT 1147

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 137/551 (24%), Positives = 239/551 (43%), Gaps = 135/551 (24%)

Query: 1049 TESEIAVLNMNYEQAKK--EVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRN 1106
            T+++ AVL    +  KK  E  + +N  +   +   A+L S++ESN  L +E +  +M N
Sbjct: 503  TDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAKLVSIQESNDLLADENQKIKMEN 562

Query: 1107 GEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRL-----------KATS 1155
              + + LN++ T   S+ ++L +    L SK+  ++EL+TE ++L           K T+
Sbjct: 563  SNLSSLLNKINTDKNSISNELSD----LHSKE--ILELETEKTKLLEQLEEGERKLKETN 616

Query: 1156 ----------HDMPQNGNKDSS-SELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKR 1204
                       +   N N++++ ++   AL++    L +  +       E  D+F RLKR
Sbjct: 617  EKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEEKSKEVEEANDKFSRLKR 676

Query: 1205 QARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKE 1264
            QA ERL+ASK T   L DNV++L              +DE    R   +EHI        
Sbjct: 677  QANERLNASKTTQKELSDNVKSL--------------EDE----RTNFKEHIS------- 711

Query: 1265 LKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEE 1324
             K E+      N  +EAE              L+EE  +LK+E               E 
Sbjct: 712  -KLEVDINNLNNALVEAE------------KKLSEE--NLKYET--------------ER 742

Query: 1325 MSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLG 1384
             +G   ++R   +D  +   +   ++    L E    LK +++ +E  +D L M K  + 
Sbjct: 743  QTG--STLRLKIDD--LQLNEDNLKEKVKNLEENESTLKDKIKMIEGNEDDL-MGKISVL 797

Query: 1385 EENTALMKAR-----------SDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDE 1433
            + N  L+K +           S++ D+E L+K WE           KE S  ++  +++ 
Sbjct: 798  QSNEILLKDKLNDLNSKSSNNSELVDVEGLKKDWE-----------KEYS-HIIEKRIEY 845

Query: 1434 LEEQFQNRVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERK 1493
             E Q + R          LK E+E +     +D +  V+ + FE GK  +   +++LE K
Sbjct: 846  AEMQLEKR----------LKSEMEREM----DDKMKVVEMKGFESGKASSEKTLNLLEHK 891

Query: 1494 IAKLEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAGSGFSVQSSESNPFT 1553
            ++ LE ++   KS    ++ E      + NNNK Q+ N PF  ++     + +  SN   
Sbjct: 892  LSLLEKQNNE-KSNKINTLIE------SENNNKTQKIN-PFTFSSVEP-KISNLVSNDTI 942

Query: 1554 TPVSRGAAHTN 1564
               S+  A +N
Sbjct: 943  IEFSKAPAVSN 953

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 91/384 (23%), Positives = 179/384 (46%), Gaps = 52/384 (13%)

Query: 961  ELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLAD-----EKASDLVDAGVSPEYT 1015
            EL+ R K L    EL+K+ + + SD ++ L E++  + +     +K +D++    +  Y 
Sbjct: 291  ELDQRTKQL---TELEKKHVNEISDLQAQLTEKLTTINNLEENLKKNNDVIKNFNTENYK 347

Query: 1016 ------DLVRK---LSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKE 1066
                  D + +   L D+KK+L   L  S+ + N+ R ++ +   E+   N   E+  + 
Sbjct: 348  HDNQVKDFISQIEELHDDKKSLTRDLQISKEKFNKYRGEMERKVFELKTSN---ERTTEN 404

Query: 1067 VAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQ 1126
             A +++      E+ + +L+S    N SL  E+   Q +   + ++L+EL+TK+     Q
Sbjct: 405  DAEQLDQIKKLYEDRVNKLQS---KNNSLLKEIAQLQTKESNVKSKLSELETKYSKNTKQ 461

Query: 1127 LDEARNVLSSKDM--KLMELQTECSRLKATSHDM--PQNGNKDSSSELVGALQSSVATLT 1182
            L + RN    +++  K+ ELQ   + L      +   ++ N   +SEL    Q  ++ L+
Sbjct: 462  LTKDRNEAKDRELLAKMEELQKNGAELNKVEKKLQETESENNKLNSELFQKSQE-ISKLS 520

Query: 1183 EQVDNLKHANTELEDRFGRLKRQARER------LDASKVTINSLRDNV-ETLTKDKTALQ 1235
            +++D L   N+EL +    LK   R++      L  S+  I  L + +  + +K    + 
Sbjct: 521  KELDGLSGVNSELLEENKSLKTSVRDKIALKKELKKSQSEIKELHEKIISSASKKSQEIL 580

Query: 1236 DVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTT 1295
             +IE   +E+ +L  KI+++ +                SK  DI+   N+   + N+  T
Sbjct: 581  QIIENKDEEIRKLERKIRDYDQK--------------FSKESDIKDLQNKLKATENEKLT 626

Query: 1296 ALN---EEIESLKHEVQYLKEASS 1316
             L    +E+E  +HE+  L+E +S
Sbjct: 627  LLERHEKEVEEWRHELDKLQEDAS 650

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 40.4 bits (93), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 97/404 (24%), Positives = 181/404 (44%), Gaps = 66/404 (16%)

Query: 1036 QSEKNRLREQLTKTESEIAVLNMNYEQAKKE----------VAAEVNNESGRAEEHIAQL 1085
            Q E   L+E++ +  +EI  LN N  + K +          ++ E+     R + H   +
Sbjct: 898  QKEAKLLKEEIARKTTEIKSLNENLGKTKTQHDDLLKEKEHISKELVECKLRFQSHDILV 957

Query: 1086 ESLKESNMSLTNEVKLAQMRNGEIIAELNELK----TKFKSVESQLD----EARNVLSSK 1137
              L E   SL N  +  Q  +  +IA + E+K     +  ++ES+ D    E  +  S +
Sbjct: 958  AKLTEKLKSLANNYRDLQATHESLIASMEEIKKENTMQMSNLESKFDSLSQEKESFQSER 1017

Query: 1138 DM---KLMELQTECSRLKATSHDMPQ--NGNKDSSSELVGALQSSVATLT----EQVDNL 1188
            ++    + +L+   S L+ T  +     N +K+     +G L+  + T+     E V+ +
Sbjct: 1018 ELLEENIRKLKETISTLELTKEEAITKFNSSKEDYESQIGLLKEQLETVATENGESVNKI 1077

Query: 1189 KHANTELEDRFGRLKRQAR------ERLDASKVTINSLRDNVETLTKDKTALQDVIERSK 1242
               +  ++D  G L+ Q         +L+ASK  +   + N + L ++K  L+  I + K
Sbjct: 1078 SELSHNIDDLKGELETQKNFKDDLEAKLEASKKVLKETQANEQHLKEEKLQLEGEITKIK 1137

Query: 1243 DELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIE 1302
            ++L+ LR  ++      ++ KE K  +A V    K I    ++  K  N   + LN EI 
Sbjct: 1138 EQLDNLRDNLK------SLEKENKESVAQVEEYKKQI----SDKEKEYNGKLSELNNEIN 1187

Query: 1303 SLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDE------KIAFMKATSED------ 1350
            S++ + + +        Q NE++ G +E + KA ED+      KI  + A  E+      
Sbjct: 1188 SVQQKNETI-------CQNNEKLKGEIEEIEKASEDQSNLKGSKIEALNAQIEELEESKQ 1240

Query: 1351 -SEARLAEERGKLKREMEA---LEKEKDSLVMEKTRLGEENTAL 1390
             +E +L +    +K EME    L+KE D+ +++   L E+  AL
Sbjct: 1241 ITETKLLDSVKNMKTEMEKMRELQKESDAKMVKINELEEKQEAL 1284

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 39.7 bits (91), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 74/325 (22%), Positives = 150/325 (46%), Gaps = 26/325 (8%)

Query: 1036 QSEKNRLREQLTKTESEIAVLNMNYEQAK----------KEVAAEVNNESGRAEEHIAQL 1085
            Q E   L+E +    +EI  +N N E+ K          + ++ E+     R + H   +
Sbjct: 898  QKETKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEHISKELVEYKSRFQSHDNLV 957

Query: 1086 ESLKESNMSLTNEVKLAQMRNGEIIAEL----NELKTKFKSVESQLDEARNVLSSKDMKL 1141
              L E   SL N  K  Q  N  +I  +    NE   +  ++++++D       +  ++ 
Sbjct: 958  AKLTEKLKSLANNYKDMQAENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIER 1017

Query: 1142 MELQTECSRLKATSHDMPQN-----GNKDSSSELVGALQSSVATLTEQVDNLKHANTELE 1196
              ++    +LK T  D+ Q         DSS +     +S ++ L E+++    AN E  
Sbjct: 1018 GSIEKNIEQLKKTISDLEQTKEEIISKSDSSKD---EYESQISLLKEKLETATTANDENV 1074

Query: 1197 DRFGRLKRQARERLDASKVTINSLRDNVET-LTKDKTALQDVIERSKDELNELRAKIQ-E 1254
            ++   L +  RE L+A      +L++ +ET L   + AL++V E +++ L E + +++ E
Sbjct: 1075 NKISELTK-TREELEAELAAYKNLKNELETKLETSEKALKEVKE-NEEHLKEEKIQLEKE 1132

Query: 1255 HIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEA 1314
              ET   +  L+  L ++  +++D+ A+L +  +         NEEI  L  E+   ++ 
Sbjct: 1133 ATETKQQLNSLRANLESLEKEHEDLAAQLKKYEEQIANKERQYNEEISQLNDEITSTQQE 1192

Query: 1315 SSAEPQGNEEMSGVVESMRKAFEDE 1339
            + +  + N+E+ G V++M+   E++
Sbjct: 1193 NESIKKKNDELEGEVKAMKSTSEEQ 1217

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
           plaque spindle pole body (SPB) component, ortholog of
           human kendrin; involved in connecting nuclear
           microtubules to SPB; interacts with Tub4p-complex and
           calmodulin; phosphorylated by Mps1p in cell
           cycle-dependent manner
          Length = 944

 Score = 38.1 bits (87), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 128/289 (44%), Gaps = 53/289 (18%)

Query: 614 SQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKER 673
           SQ LKE+EV   Q  K+  D         R LE+ L+ K  +  A S I NK        
Sbjct: 116 SQPLKEQEVREHQMKKERFD---------RALESKLLGKRHITYANSDISNKELYI---- 162

Query: 674 NNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDT--KETSPSSALT 731
           N  + L  +++ L+K +++ L        N  D LE E  +L+N++    KE    + + 
Sbjct: 163 NEIKSLKHEIKELRKEKNDTL--------NNYDTLEEETDDLKNRLQALEKELDAKNKIV 214

Query: 732 NPKAELEWYQTKFDSLSGS---NDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKL 788
           N +        K D  SG     + +  K+ E    ++T  VK Q L++   E NS  + 
Sbjct: 215 NSR--------KVDDHSGCIEEREQMERKLAELERKLKT--VKDQVLEL---ENNSDVQS 261

Query: 789 LEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSEL- 847
           L+ R   D++  L      EL   ++   +   +LE   N +R+  +E+  L  +  E+ 
Sbjct: 262 LKLRSKEDELKNLMN----ELNELKSNAEEKDTQLEFKKNELRKRTNELNELKIKSDEMD 317

Query: 848 ------ENENKHLRDEIAILRDELTHNGGEF---EREKEALMKKLSNLE 887
                 +NE+K L+DE+  L  + + NG +    E E + L  K++ LE
Sbjct: 318 LQLKQKQNESKRLKDELNELETKFSENGSQSSAKENELKMLKNKIAELE 366

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 88/177 (49%), Gaps = 11/177 (6%)

Query: 801 LTGALETELATSRTRLTDTS-RELEISSNTIRQYQSEIKVLNERQSELEN---ENKHLRD 856
           L G + T + +   R++ ++   L+  S+    Y+ ++K LN+ Q+ L N   E   LRD
Sbjct: 100 LDGKISTGIQSILNRVSGSNITSLKSHSHLASFYKQQVKELNDLQTTLYNRKMELDELRD 159

Query: 857 EIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAM 916
            + + +D+L        RE  +   K   L +RQ EL+KL+ED  A  +K  LD  K  +
Sbjct: 160 NLEVRKDQLKEQKYAVGRESGSKNTKEQQLRLRQTELSKLKEDLEAR-KKFLLDGFKLHL 218

Query: 917 LGKEIKLAHDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQI 973
              E+      E +  +N+    YR++LE V+  + K   +++ +L   + +L E+I
Sbjct: 219 KQMEV------ENQTKKNKLAIEYRDKLEAVKRVKIKKMEDEKDQLAKEVDVLREKI 269

>KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {ON}
            similar to uniprot|Q12234 YOR216C Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 462

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 92/192 (47%), Gaps = 39/192 (20%)

Query: 1116 LKTKFKSVESQLDEARNVLSSKDMKLMELQ-------TECSRLKATSHDMPQNGNKDSSS 1168
            LK K KS +S++ E +  +S  + +++ L         ECS  K+   ++    N+ S+ 
Sbjct: 160  LKQKLKSADSEIQEDKQTISILNDEIVNLNKECENLSNECSEFKSKIKELESKLNEASNE 219

Query: 1169 E--LVGALQSSVATLTEQVDNLK-------HANTELEDRFGRLKRQARERLDASKVTINS 1219
            E  +   L+S V +L  Q+DNL+           +LE++    K+Q  E+ D +K  +++
Sbjct: 220  ESNITSCLKSEVKSLKSQIDNLEIIINNEAQDKRDLEEQIADYKQQL-EQSDETKKQLDN 278

Query: 1220 LRDN-----------VETLTKDKTA-----LQDVIERSKD------ELNELRAKIQEHIE 1257
            +  N           +ETLTK +T       +++ + +K+      E+N LRAK+    E
Sbjct: 279  IMSNLEKQINDNNTTIETLTKQRTTEVNQFTEEIAQLTKNNEEKATEINSLRAKVASMSE 338

Query: 1258 TSAVMKELKTEL 1269
              A+ ++ + E+
Sbjct: 339  DVALKEKFEREV 350

>Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON}
            (64396..65769) [1374 nt, 458 aa]
          Length = 457

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 20/176 (11%)

Query: 1098 EVKLAQMRNGEIIAELNELKTKFKSVESQLDEAR------NVLSSKDMKLMELQTECSRL 1151
            EV+ A   N  +   L + K     VES LDE         + S+KD+K+ ELQ     L
Sbjct: 24   EVETASEENNTVDGSLQDPKASDPVVESGLDEGAVVEEELGIDSAKDLKIKELQEMIENL 83

Query: 1152 KATSHDMPQNG-----NKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQA 1206
            K    D   NG     + DSSSEL  +L++      +Q ++L    + ++  F ++K   
Sbjct: 84   KVKLEDNSTNGSSNGNDGDSSSEL-ESLRNERDHFEKQYNSLLERISSMKSLFSKMKENQ 142

Query: 1207 RERLDASKVTIN-------SLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEH 1255
            +E L++++  +N        L+  V++L K+K  L+  I     E + L  +++E+
Sbjct: 143  KE-LESTQEQLNEYESQNLKLKTKVDSLNKEKVELESTIVTLNQEYSSLEKELEEY 197

>CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P40414 Saccharomyces
           cerevisiae YIL138c TPM2 tropomyosin
          Length = 161

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 17/115 (14%)

Query: 730 LTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANS-KNKL 788
           LTN K E E +Q K++ L      L +  I+  + I++LTVK Q LD   QE    ++++
Sbjct: 8   LTNLKLEAESWQEKYEELKEQMKQLEQDNIQKENEIKSLTVKNQQLD---QEVEKLEDQI 64

Query: 789 LEARETVDD----------VNKLTGALETELATSRTRLTDTS---RELEISSNTI 830
            E +E  ++           NK    LE EL  +  +L +TS   +E+E++S T+
Sbjct: 65  KETKELAEESTTLKSHNENFNKKNQMLEEELEETDRKLKETSDRLKEIELNSETL 119

>YJL071W Chr10 (306132..307856) [1725 bp, 574 aa] {ON}
            ARG2Acetylglutamate synthase (glutamate
            N-acetyltransferase), mitochondrial enzyme that catalyzes
            the first step in the biosynthesis of the arginine
            precursor ornithine; forms a complex with Arg5,6p
          Length = 574

 Score = 36.2 bits (82), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 25/132 (18%)

Query: 1159 PQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKR----QARERLDASK 1214
            P   N++++SE +         + + +D L   N    D+F  L       + ER D + 
Sbjct: 153  PYVYNEETASEFM------TKDVVKFMDCLCQGNIPHIDKFFILNNAGGIPSGERNDNAH 206

Query: 1215 VTIN----------SLRDNVETLTKDKTALQDVIER-----SKDELNELRAKIQEHIETS 1259
            V IN          SL  N+ TLTK +   Q+++ R      KDE++ L  +  +H+E  
Sbjct: 207  VFINLSQELEHLSSSLSHNISTLTKREPRSQNLLHRMEVYVKKDEISSLECEYHDHLENL 266

Query: 1260 AVMKELKTELAA 1271
             +M ++ + LAA
Sbjct: 267  LLMDKVLSNLAA 278

>KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON} Anc_3.438
            YPR115W
          Length = 1103

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 1205 QARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIE 1257
            QA ++   SK  +NSL  N+E L KD   LQ  I+  KD  N+ R  I  HI+
Sbjct: 267  QANQQFKVSKEIVNSLIPNLENLRKD---LQFKIKDIKDLHNDFRTNINAHIK 316

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 84/166 (50%), Gaps = 19/166 (11%)

Query: 754  LNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSR 813
            L EK+   A+  + L +K  +L   L EA S + L        ++  L   +ET L   +
Sbjct: 915  LTEKLKSLATNCKELEIKNNSLKKQLDEARSTSSL--------EIASLKSEIET-LVAEK 965

Query: 814  TRLTDTSRELEISSNTIRQYQSEIKV-LNERQSELENENKHLRDEIAILRDELTHNGGEF 872
            + L   S  LE+    I++     KV + + +++L +EN  L + +  L+D+L+    E 
Sbjct: 966  SILDQKSNNLEVQLGKIQRELELAKVEVEDSKTKLSDENSRLHENLKNLKDQLSSITSER 1025

Query: 873  EREK---EALMKKLSNLEIRQAELTKLEEDYTAEIEKLKL---DLD 912
            +++K   E+L   L+ +    AE+ KL+ DY + I+KLK+   DLD
Sbjct: 1026 DQQKLKSESLAGDLTKV---SAEIKKLQNDYESLIKKLKVTNSDLD 1068

>ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly
            similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 708

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 1166 SSSELVGALQSSVATLTEQVDNLKH-ANTELEDRFGRL------KRQARERLDASKVTIN 1218
            S +E++ +  S+V     Q+D+L+    ++LEDR   +          +ER + ++  ++
Sbjct: 219  SINEVISSCDSTVGKYRRQIDSLRQDYESKLEDRMSEMASVIQESNTYKERFNIARRRVS 278

Query: 1219 SLRDNVETLTKDKTALQDVIERSKDELNELRAKIQE 1254
              RD ++ + ++++ L++  E +  EL E R K+ E
Sbjct: 279  ETRDEIKMINQNQSILRNKYEGATAELEECRRKLNE 314

>NCAS0G00440 Chr7 complement(75305..77404) [2100 bp, 699 aa] {ON}
           Anc_5.670 YKR078W
          Length = 699

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 706 DDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSND---ALNE--KMIE 760
           DDL +   +L N++ + E  P+S  TNP  E   Y       SG N    A N+  KM E
Sbjct: 115 DDLNISKADLMNELASSEVDPASGWTNPSIEPTTYNINAPLFSGDNSLPLAFNDTGKMDE 174

Query: 761 CASTI 765
             ST+
Sbjct: 175 LQSTL 179

>TDEL0A03830 Chr1 (678643..681060) [2418 bp, 805 aa] {ON} Anc_5.519
            YDR416W
          Length = 805

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 88/180 (48%), Gaps = 25/180 (13%)

Query: 1008 AGVSPE-YTDLVRKLSDEKKNLESKLFASQSEK--NRLREQLTKTES--EIAVLN---MN 1059
            AGV PE + +L  K++  K  ++S    +Q +K  + L + L +T+S  E +VL    +N
Sbjct: 269  AGVFPENWVEL--KVTLVKFYIKS----AQHDKIVHVLEDSLARTQSVQEFSVLYSTYLN 322

Query: 1060 YEQAKKEVAAE--------VNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIA 1111
            YE+A  ++  +        + +   + E H+++L+ L ES     N++K+   RN  +++
Sbjct: 323  YEKAFIDIVLQELKNNSQVIGDWEQQVESHLSRLQGLIESYEIRLNDIKIR--RNPNLVS 380

Query: 1112 ELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDM-PQNGNKDSSSEL 1170
              +E  T F +   + D   + + + D   + +     +L     ++  + G+ DS+ E+
Sbjct: 381  NWSERATLFPAAAGKCDVYSHAILTIDPYRVNIPGSLGKLWCAYAELYWEAGDFDSAREV 440

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 138/525 (26%), Positives = 231/525 (44%), Gaps = 99/525 (18%)

Query: 1056 LNMNYEQAKK-EVAAEVNNESGRAEEHI-AQLESLKESNMSLTNEVKLAQMRNGEIIAEL 1113
            +N + E+ K+ EV    N E  +  EHI  +LE + E   +L +     +++   I  EL
Sbjct: 201  VNTDQEKTKEPEVIPIDNPEYIKEREHILEELERVTEDFKNLRDRYNDLEIKFLSIQNEL 260

Query: 1114 NELKTKFKSVESQLDEARNVLSS----KDMKLMELQTECSRLK---ATSHDMPQNGNKDS 1166
            +E K +F+S  ++L+E  + L S    KD  + E + +    +   A+  D  QNGN++ 
Sbjct: 261  DEKKQEFESSTARLNEEIHTLKSTIDDKDATISEFKRKLGNAEDQLASIDD--QNGNQNQ 318

Query: 1167 S-----SELVGALQSSVATLTEQVDNLKHANTELEDR--------------------FGR 1201
                   E   A+      + E+ + + H   E++D+                    F R
Sbjct: 319  KLLHDLKEREDAIDGLKEDIIEKENAIVHYKEEIQDKQNQLKESESKYAEVQKEFEDFKR 378

Query: 1202 -LKRQARERLDASKVTINSLRD-NVET--LTKDKTALQDVIER-------SKDELNELRA 1250
             LK+Q  E  D  K T   L++ +VE   L K    L+  IE+       ++ E + LR 
Sbjct: 379  ELKKQTFEFEDGKKSTSRQLQELSVEKIQLEKQVCNLRGQIEKLEQQHRLTQSENDGLRT 438

Query: 1251 KIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQY 1310
            K++ HIE+     +LK E +    K KD+ ++L +  K+   L  A N  I+ L HE+  
Sbjct: 439  KLK-HIES-----DLKNEKSRTEVKIKDLTSDLEDARKN---LGEA-NNTIKELHHEI-- 486

Query: 1311 LKEASSAEPQGNEE----------MSGVVESMRKAFEDEKIAFMKATSE---DSEARLAE 1357
            +K A+ ++ Q +EE          +   V+ + +     +    KAT     D E  +  
Sbjct: 487  IKNATKSKDQLSEEVVEKDKEIDQLKHRVQRLDEELRTSQAELDKATKNREVDHELEIRR 546

Query: 1358 ERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVL 1417
             + K + E E+L++E   +  EK RL + +           DIET ++Q EA  KE   L
Sbjct: 547  LQNKHEIEQESLKRELAHMTDEKERLVDLHRL---------DIETWERQIEALRKENENL 597

Query: 1418 LYKE-------------KSDQMMRAKMD--ELEEQFQNRVRNKEKELNALKDEIEEKCKT 1462
            + +E             K+ Q+ R + D  +L E+ +N + NK + L   KD  + + K 
Sbjct: 598  ISREHKESNNIEITLQDKNIQIRRLEADIVQLNEE-RNDILNKLRSLEQAKDRYKSEMKD 656

Query: 1463 GHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSG 1507
              E   I+  +   E  K     K S++ERK  KL+ E K  K G
Sbjct: 657  ALE--TISRLRVDLENNKSLKDSKDSLIERKYEKLKDEFKLMKKG 699

>YNL079C Chr14 complement(478566..479165) [600 bp, 199 aa] {ON}
           TPM1Major isoform of tropomyosin; binds to and
           stabilizes actin cables and filaments, which direct
           polarized cell growth and the distribution of several
           organelles; acetylated by the NatB complex and
           acetylated form binds actin most efficiently
          Length = 199

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 730 LTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLL 789
           L+N K E E +Q K++ L   N  L ++ +E  + I++LTVK Q L+             
Sbjct: 8   LSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKNQQLE------------- 54

Query: 790 EARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQ 834
                 D++ KL   L     + +T   +  +E +I S T++ +Q
Sbjct: 55  ------DEIEKLEAGLSD---SKQTEQDNVEKENQIKSLTVKNHQ 90

>TDEL0B04430 Chr2 complement(779080..782397) [3318 bp, 1105 aa] {ON}
            Anc_8.168 YBL022C
          Length = 1105

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 10/94 (10%)

Query: 1306 HEVQYLKEASSAEPQ-----GNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERG 1360
            HEV    + +SA P      G E M+ ++   R+   DE I   K  SE+ EA ++E+  
Sbjct: 240  HEVGVFAQITSAFPSKDEKSGTETMTALLYPHRRIKIDELILPAKPISEEQEAEISEDV- 298

Query: 1361 KLKREMEALEKEKDS----LVMEKTRLGEENTAL 1390
            + K+E E +EKE  S    +  EKT   +E TAL
Sbjct: 299  EAKQESEQVEKETQSDEAAINTEKTVATKEETAL 332

>Kpol_1032.30 s1032 complement(69806..71029) [1224 bp, 407 aa] {ON}
           complement(69806..71029) [1224 nt, 408 aa]
          Length = 407

 Score = 33.9 bits (76), Expect = 3.6,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 688 KNQDEQLKDIQVSLQNKIDDLEL-ENTELRNKIDTKETSPSSA 729
           K   E  +D Q++L NKID+LE  EN E+ N+++   T P S+
Sbjct: 341 KKAKELTEDQQMALLNKIDNLEFDENGEIINELNNAVTMPGSS 383

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
            similar to uniprot|P40416 Saccharomyces cerevisiae
            YMR301C ATM1 Mitochondrial inner membrane transporter
            exports mitochondrially synthesized precursors of iron-
            sulfur (Fe/S) clusters to the cytosol member of the ATP-
            binding cassette (ABC) transporter family
          Length = 694

 Score = 34.3 bits (77), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 1327 GVVESMRKAFED---EKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRL 1383
            GVV      F D   E + F K ++ D E RLA E+ +L+  ++ L K +D++V E+  +
Sbjct: 512  GVVPQDTPLFNDSIWENVRFGKISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLM 571

Query: 1384 --GEENTALMKAR 1394
              G E   L  AR
Sbjct: 572  ISGGEKQRLAIAR 584

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
            some similarities with uniprot|Q22X91 Tetrahymena
            thermophila SB210 TTHERM_00561660 Viral A-type inclusion
            protein repeat containing protein
          Length = 698

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 1137 KDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELE 1196
            KD+K ++LQ +  ++  T ++  +N        LV  L+    TL E   NLK  ++ L+
Sbjct: 465  KDIKDLQLQLKQDKVTFTKYEKLENEKTACDKALVH-LRQEYRTLQESFQNLKEVHSNLD 523

Query: 1197 DRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHI 1256
            D+   L +  +   DA    +  L + V  L      LQD     + ++N+L  ++++HI
Sbjct: 524  DQNKELSQYRKAAHDA----LCELNEEVGKLEDMNAVLQDGKRIDQIQINDLNCQVKKHI 579

Query: 1257 ET 1258
            ET
Sbjct: 580  ET 581

>KAFR0B04670 Chr2 (972408..973442) [1035 bp, 344 aa] {ON} Anc_2.315
            YGL153W
          Length = 344

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 1181 LTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIER 1240
            +  Q D +      +E   G ++   +E+LD    TI  L+  +E  T  +  ++D    
Sbjct: 134  INSQFDKVDKVLNAIEQGAGFIQGGRKEKLDELDATIVQLKAALEQTTTGRKKVEDDFRL 193

Query: 1241 SKDELNELRAKIQEHIETSAVMKELKT---ELAAVMSKNKDIEAELNETSKS 1289
             K E+N L+  IQE +  +  +KE+     E++++ S   + E  +N ++K+
Sbjct: 194  LKSEMNNLQHSIQEFVSKNGAIKEINKISEEVSSLKSLMNNTENSVNSSNKA 245

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score = 33.9 bits (76), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 131/284 (46%), Gaps = 38/284 (13%)

Query: 993  QVKLLADE-KASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTES 1051
            +VK L D  K   L ++ +  E   L + + D  KN  +KL   ++E + L EQ+   ES
Sbjct: 753  EVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQIKDLES 812

Query: 1052 EIAVLNMNYEQAKKE---VAAEVNNES-----------GRAEEHIAQLESLKESN---MS 1094
            E   LN  YE+ K E   +A E++ ++            + EE I   + LK S    MS
Sbjct: 813  ESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKINKMLKTSEEELMS 872

Query: 1095 LTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKAT 1154
            + N++ + + R   I  EL EL+   K    Q +E++N   + +++L +L  + S+ K +
Sbjct: 873  VQNDLNVERKRISNIDDELEELERTIK----QKEESKN---TYELELKQLHHDLSKYKNS 925

Query: 1155 SHDMPQNGNKDSSSELVGALQSSVATLTEQ-----VDNLKHANTELEDRFGRLKRQARER 1209
            +  + +  N           +  V ++ EQ     V+  +H   +L+  F  L+R+    
Sbjct: 926  TDGIEKALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRMEQLQKNFDELRRKVNPN 985

Query: 1210 ----LDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELR 1249
                +++ +    +L+  + T+ KDK  ++D I +    LNE +
Sbjct: 986  IMNMIESVEKKGEALKTMIRTIEKDKKKIEDTISK----LNEYK 1025

>YHR045W Chr8 (195551..197233) [1683 bp, 560 aa] {ON} Putative
           protein of unknown function; possible role in iron
           metabolism and/or amino acid and carbohydrate
           metabolism; green fluorescent protein (GFP)-fusion
           protein localizes to the endoplasmic reticulum
          Length = 560

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 698 QVSLQNKIDDLELENTELRNKIDTKET-SPSSALTNPKAELEWYQTKFDSL--SGSNDAL 754
           Q+ L + I +  ++   L N++++ E  + S+ L N  A L+ +   F  L   GS   +
Sbjct: 267 QICLVSNIAEF-IKGFPLGNELNSNEYLTISTKLANSSASLQIWGKLFAVLLHGGSASFI 325

Query: 755 NEKMIECASTIETLTVKTQTLDIL-LQEANSKNKLLEARETVDDVNKLTGALETELA 810
           N   I+C S  ET  + T+T D++ L ++NS++ LL         N L+  + T++A
Sbjct: 326 NPTTIDCESLQETTLLFTETKDVVKLIDSNSRSGLLNKIYLSWATNLLSEGIFTKIA 382

>Kwal_YGOB_33.14727 s33 (792991..793587,793589..795508) [2517 bp,
           838 aa] {ON} ANNOTATED BY YGOB -
          Length = 838

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 503 KVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQIN 562
           K+ S  + + ANE +       F   D  +         KY ++ A     IG  +    
Sbjct: 383 KIPSFISPVTANEVYVIGKTYLFLEKDCKEIQWAHDCNQKYSAIYASLKGNIGEKFQAAV 442

Query: 563 NLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREV 622
           +L  +  ++   C +++ +K+ + D LKI +D+L + K +   +   IKN+S  L+    
Sbjct: 443 HLHYN--EITSYCSNVLENKYKLSDVLKILKDVLLMGKGD--FIDQMIKNSSDFLQ---- 494

Query: 623 ETSQTIKKY 631
           E+S T+  Y
Sbjct: 495 ESSATLPSY 503

>Smik_14.247 Chr14 complement(458876..459475) [600 bp, 199 aa] {ON}
           YNL079C (REAL)
          Length = 199

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 22/105 (20%)

Query: 730 LTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLL 789
           L+N K E E +Q K++ L   N  L +  +E  + I++LTVK Q L+             
Sbjct: 8   LSNLKLEAESWQEKYEELKEKNKDLEQDNVEKENQIKSLTVKNQQLE------------- 54

Query: 790 EARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQ 834
                 D++ KL   L     + +T   +  +E +I S T++ +Q
Sbjct: 55  ------DEIEKLEAGLSD---SKQTEQDNVEKENQIKSLTVKNHQ 90

>KLTH0E08206g Chr5 (752883..753542) [660 bp, 219 aa] {ON} similar to
           uniprot|Q05359 Saccharomyces cerevisiae YAR002C-A ERP1
           Protein that forms a heterotrimeric complex with Erp2p
           Emp24p and Erv25p member along with Emp24p and Erv25p of
           the p24 family involved in ER to Golgi transport and
           localized to COPII-coated vesicles
          Length = 219

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 828 NTIRQYQSEIKVLNERQSELENENKHLRDEIAILRD 863
           NT++  QS+IKVLN+R  E+  E + +R+  A+ RD
Sbjct: 143 NTMQSLQSKIKVLNDRVEEIRREQELVREREAMFRD 178

>ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YBL047C (EDE1)
          Length = 1226

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 128/273 (46%), Gaps = 48/273 (17%)

Query: 791  ARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSELENE 850
            A++ +  +N+L  +LE +L T  +     ++++E     + + ++E +VL ++    E+ 
Sbjct: 538  AQQELSRINELKASLEAKLTTLHSSYQQETQQMEEVEQLLTKARAETEVLTQQLQNTEST 597

Query: 851  NKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLK-- 908
                + E+  L+ EL     E E+    L +K+SN       +  L++D   + +++K  
Sbjct: 598  CHSTQSELTNLQLELQ----ECEKTNTQLKEKISNYNNL---ILSLQQDLAGKQQQVKQQ 650

Query: 909  ---LDLDKQ---------AMLGKEIKLAHDEEVREVQNRN-TETYRNELELVEIRQTK-- 953
               +D++ Q         A L +EIK   D   + ++ R   + Y+  +E    RQ K  
Sbjct: 651  RALVDVNTQQADLNATTGAGLEEEIKGLDDRLAKLIEKRKELDDYQTNIE----RQHKDL 706

Query: 954  -----VFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLL----------- 997
                  FV + +ELE++    +++ +  +ER KQ  ++E +  EQV  L           
Sbjct: 707  EEKHLQFVSRSQELENKYLEFSQREKDLQERTKQIVEQEHVYNEQVSRLQQLFKDLNIQR 766

Query: 998  -ADEKA-SDLVDAGVSPEYTDLVRKLSDEKKNL 1028
             A EKA  DL +  V  EYT  V+KLSD++  L
Sbjct: 767  AAFEKAEQDLQECRV--EYTQQVQKLSDKQLKL 797

>Skud_14.251 Chr14 complement(468833..469432) [600 bp, 199 aa] {ON}
           YNL079C (REAL)
          Length = 199

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 730 LTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLD 776
           L+N K E E +Q K++ L   N  L +  +E  + I++LTVK Q L+
Sbjct: 8   LSNLKLEAESWQEKYEELKEKNKDLGQDDVEKENQIKSLTVKNQQLE 54

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 33.1 bits (74), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 167/380 (43%), Gaps = 67/380 (17%)

Query: 1112 ELNELKTKFKSVESQLDEARNV---LSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSS 1168
            ++++L  K   +++QLDEA +    LS+K   L   + +C + K  SH+           
Sbjct: 748  QVSDLDEKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLK-KLASHE----------- 795

Query: 1169 ELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLT 1228
                           QV++LK+  T+LE +   +  Q       ++  IN +   +  LT
Sbjct: 796  --------------GQVNSLKNRTTQLEKQLATVSEQK----STAEAGINKMNRELFNLT 837

Query: 1229 KDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSK 1288
            K+K +L  V+ + + E  +   K+QE  +    + +L ++      +++DIE   NE   
Sbjct: 838  KEKDSLTAVMNKLQKEGEK---KLQEAEKEKVRITQLLSQ------RDRDIENLRNELQD 888

Query: 1289 SSNQLTTALNEEIESLKHEVQYLKEASSAE----PQGNEEMSGVVESMR-----KAFEDE 1339
               Q    L +E   L  E+  LK   +++    P+  E++  + ES++      A   +
Sbjct: 889  QGTQ-KKKLEDEHAGLLKEIADLKSQCASQDSLIPKLKEKLKTLAESLKDTQNEHATLQK 947

Query: 1340 KIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPD 1399
            ++  ++ATS     +L  E  KLK E   L   KD L  E  +L  +  A  K  SD+  
Sbjct: 948  QVGNIQATSHAEITQLNAELQKLKDENVILISRKDELTQELEKLQAQTAAGEKQTSDIAL 1007

Query: 1400 IETLQKQWEA--SNKERLVLLYKEKSDQM------MRAKMDELEEQFQ---NRVRNKEKE 1448
            + T + +  A  S  E+ ++  K K++ +      ++ K++  E+Q Q    ++ N + E
Sbjct: 1008 LNTQKSELSAKLSRAEKELVNQKAKAEGLFQERAELKDKLNTSEKQLQESSQKLSNAQSE 1067

Query: 1449 LNALKDEIEEKCKTGHEDTL 1468
            LN    EI  + K    D +
Sbjct: 1068 LN----EIRSRLKANEHDLI 1083

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
           YBL047C (REAL)
          Length = 1380

 Score = 33.1 bits (74), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 115/256 (44%), Gaps = 36/256 (14%)

Query: 713 TELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKT 772
           TE++N I TK  +  S       + E  + +   ++  N+ L +++    +       K 
Sbjct: 636 TEMKNSIQTKLNNLRSNHDQNVTQTEQLEAQLSQINNENETLTQQLAVSEANYHAAESKL 695

Query: 773 QTLDILLQEANSKNKLLEARETVDDVNKLTGALETEL-------ATSRTRLTDTSRELEI 825
             L   LQE+ +KN   E +E + ++N +T +L+++L          R+ +   S++LE+
Sbjct: 696 NELTTDLQESQTKNA--ELKEQITNLNSMTASLQSQLNEKQQHVKQERSMIDVNSKQLEL 753

Query: 826 SSNTIRQYQSEIKVLNE-------RQSELENENKHLRDEIAILRD---ELTHNGGEF-ER 874
           +  T+   Q EI  L E       +Q EL +  K + ++ A L+    +L++   +  +R
Sbjct: 754 NQITVVNLQKEIDGLGEKIGVYLTKQKELNDYQKTVEEQHAQLQSKYQDLSNKDNDLADR 813

Query: 875 EKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLG--KEIKLAHDEEVREV 932
           EK+        LE R  ++ + E  Y   + KL      QAM     + K   D+  +E+
Sbjct: 814 EKQ--------LEERNKQIEEQENLYHQHVSKL------QAMFDDLSQRKATFDKADQEL 859

Query: 933 QNRNTETYRNELELVE 948
           + RN E   N  EL E
Sbjct: 860 KERNIEYANNVRELSE 875

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 33.1 bits (74), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 41/71 (57%)

Query: 796  DDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSELENENKHLR 855
            D++NK    L T+L    ++L +    +E++ N +   +S++  L  + SEL+ ENK ++
Sbjct: 1049 DELNKSIANLNTQLKQKDSKLIELEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVK 1108

Query: 856  DEIAILRDELT 866
             E+  L +E+T
Sbjct: 1109 LEVEKLENEIT 1119

>YAL047C Chr1 complement(54989..56857) [1869 bp, 622 aa] {ON}
           SPC72Component of the cytoplasmic Tub4p (gamma-tubulin)
           complex, binds spindle pole bodies and links them to
           microtubules; has roles in astral microtubule formation
           and stabilization
          Length = 622

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 120/254 (47%), Gaps = 65/254 (25%)

Query: 522 DGEFGNSDLSDGNN---------------IQALKNKY----DSLMAESSETIGHLYSQIN 562
           DG + N ++ D NN               I A+++++    D+ +    E +   Y Q  
Sbjct: 252 DGGYQNDEIHDSNNHIDTENVMANSTSLPISAVESRFEKTLDTQLEIVIENLHKEYDQFI 311

Query: 563 NLQQSKSDLAKECESLINSK-----HLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQAL 617
           N  + K + +++ E +I SK     HL+        D L+L +N +S +  +    SQ L
Sbjct: 312 NSIRLKFEKSQKLEKIIASKLNEQSHLL--------DSLELEENSSSVIEKQDHLISQ-L 362

Query: 618 KEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQ 677
           KE+ +E+   +   L+ + K D+I+ +    ++ K++        + K+N+ LKE NN+ 
Sbjct: 363 KEK-IESQSVLINNLEKL-KEDIIKMKQNEKVLTKEL------ETQTKINK-LKE-NNWD 412

Query: 678 GLIPQLRALQKNQDEQLKDIQVS-------LQNKIDDLELENTELRNKIDTKETSPSSAL 730
             I  L       ++Q+ D+Q+        +QN++D L+LEN +L+N+++T        L
Sbjct: 413 SYINDL-------EKQINDLQIDKSEEFHVIQNQLDKLDLENYQLKNQLNT--------L 457

Query: 731 TNPKAELEWYQTKF 744
            N K  L  Y++ F
Sbjct: 458 DNQKLILSQYESNF 471

>Kwal_33.14730 s33 (793745..795508) [1764 bp, 587 aa] {OFF} YNL126W
           (SPC98) - spindle pole body component, associates in a
           complex with Spc97p and Tub4p perhaps as part of the
           microtubule attachment site of the SBP [contig 101] FULL
          Length = 587

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 503 KVESLTNKLKANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQIN 562
           K+ S  + + ANE +       F   D  +         KY ++ A     IG  +    
Sbjct: 132 KIPSFISPVTANEVYVIGKTYLFLEKDCKEIQWAHDCNQKYSAIYASLKGNIGEKFQAAV 191

Query: 563 NLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREV 622
           +L  +  ++   C +++ +K+ + D LKI +D+L + K +   +   IKN+S  L+    
Sbjct: 192 HLHYN--EITSYCSNVLENKYKLSDVLKILKDVLLMGKGD--FIDQMIKNSSDFLQ---- 243

Query: 623 ETSQTIKKY 631
           E+S T+  Y
Sbjct: 244 ESSATLPSY 252

>NDAI0D03050 Chr4 complement(718700..721393) [2694 bp, 897 aa] {ON}
           Anc_4.327 YLR442C
          Length = 897

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 327 IKSFKQKSEQSDAQIHKLQLHLEHVTKDK--ETIFQEVEQYKKQLEQISGQDKILRRERF 384
           + SFK+ S++SD   H L+  L+     K  ETIF +V   K+QL    G+++I++ + F
Sbjct: 394 VSSFKESSDKSDLAHHNLEDKLKTSNGHKVVETIFSKV---KRQLYSSHGKEEIVKSKNF 450

Query: 385 D 385
           D
Sbjct: 451 D 451

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 169/728 (23%), Positives = 313/728 (42%), Gaps = 134/728 (18%)

Query: 614  SQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKER 673
            SQ LKE+EV   Q          K D  +R LE+ L+ K  +  AQS + NK        
Sbjct: 116  SQPLKEQEVREHQ---------LKKDRFERALESKLLGKRHITYAQSDLSNKELYI---- 162

Query: 674  NNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDT--KETSPSSALT 731
            N  + L  +++ L+K +++ L        N  D+LE E  +LRNK+    K+ +  + L 
Sbjct: 163  NEIKTLRHEIKELRKEKNDSL--------NNYDNLEQEMDDLRNKLQELEKDLAAKNKLV 214

Query: 732  NPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEA 791
            + + E +       +     + +  K+ +  S ++T+  +   L+     AN K+ LLE+
Sbjct: 215  DSRKEED-----HSACIEERERIERKLNDSESKLKTMKGQVHELE---NSANRKSSLLES 266

Query: 792  RET--------VDDVNKLTGALETELATSRT---RLTDTSRELEISSN----TIRQYQSE 836
            +E         + ++     A  ++L + +    +LTD   ELE  +N     ++  +SE
Sbjct: 267  KENELRKVKDQLKELENKADATCSQLDSKKNELRKLTDQLNELENQANEKDSQLKSKESE 326

Query: 837  IKVLNERQSELEN--------------ENKHLRDEIAILRDELTHNGGEF---EREKEAL 879
            +K L  + +ELEN              E K  + +I  L +++     +    E E + L
Sbjct: 327  LKKLTNQLNELENKVNQNGSQSSAKESELKKSKIQITELEEKINEKNSQLTAKENELKTL 386

Query: 880  MKKLSNLEIRQ----AELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNR 935
            + +L+ LEI+     ++L   EE+  A  EKL  D+     + ++   + D+ + ++Q +
Sbjct: 387  VAQLNQLEIKMNQKDSQLGSKEEELKAINEKLNADI----KIARQQTASRDQRISDLQTK 442

Query: 936  NTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVK 995
              +   N+L  +E            ELE+++K++ + +E+D +                 
Sbjct: 443  -VQDLENDLSRMEKTHNDTKSVANIELETKVKMI-KTLEIDLK----------------- 483

Query: 996  LLADEKASDLVDAGVSPE--YTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEI 1053
             LA EK S++       E  Y      L DE   L  K+    +E ++L+ +L    + I
Sbjct: 484  -LAKEKCSNIERELNEKEDKYRFSKSSLGDENIKLNEKISILTTENSQLKSKLNDESTAI 542

Query: 1054 AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLT-NEVKLAQMRNGEIIAE 1112
            + L  NYE     +  EV      AE+  +++E L+   + +T N  K+++ R+ E+   
Sbjct: 543  SHLKENYETRLSSMRNEVEEYKTSAEKSESEVEELR---IRITENSAKVSEKRSMEL--- 596

Query: 1113 LNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVG 1172
                    K  E Q++E  N        L E + E + LK       ++ N+  +     
Sbjct: 597  --------KQKEQQINELNN-------NLKEQKDEINLLKHIIEKYKKDFNQSKTE---- 637

Query: 1173 ALQSSVAT-LTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDK 1231
              QS++   L  Q+ NL+    E ED    L+   R  ++  K   N L    + L  ++
Sbjct: 638  --QSNIQRDLNSQILNLESKLIESEDELRSLRDSQRTEIENWKRKYNDLSLENDRLLAER 695

Query: 1232 TALQD------VIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNE 1285
            T+  D      ++ R  DEL++ +  +QE  E      + K EL  +++ N  +  E  E
Sbjct: 696  TSASDKEHEVSILNRKLDELDKEKWNLQESKE------KYKRELQKLITANDRLRREKEE 749

Query: 1286 TSKSSNQL 1293
             +++SN +
Sbjct: 750  LNENSNNI 757

>TDEL0B06480 Chr2 (1144036..1147833) [3798 bp, 1265 aa] {ON} Anc_2.559
            YMR012W
          Length = 1265

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%)

Query: 545  SLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENS 604
            SL  E S   G+L S+I NL  + +DL    E +  ++ +    L +  ++   SK  N 
Sbjct: 1129 SLDGEKSLAYGYLESRIGNLYATINDLPHALEHISVTQEIFVKELGMNHELSAQSKQWNE 1188

Query: 605  TLRNRIKNTSQ 615
             L N IKN  Q
Sbjct: 1189 GLTNLIKNKQQ 1199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.310 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 158,286,575
Number of extensions: 7225644
Number of successful extensions: 59833
Number of sequences better than 10.0: 3525
Number of HSP's gapped: 50452
Number of HSP's successfully gapped: 7571
Length of query: 1651
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1528
Effective length of database: 39,377,481
Effective search space: 60168790968
Effective search space used: 60168790968
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 73 (32.7 bits)