Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C065805.701ON1491497831e-108
AFR285C5.701ON1281256424e-87
KNAG0L021205.701ON1281256424e-87
Ecym_40195.701ON1281256391e-86
KLLA0A00616g5.701ON1281256391e-86
TPHA0E002405.701ON1281256391e-86
TPHA0D046005.701ON1281256391e-86
TBLA0E021105.701ON1281256391e-86
CAGL0G02475g5.701ON1281256391e-86
Kpol_1043.695.701ON1281256382e-86
SAKL0E14894g5.701ON1281256363e-86
KAFR0D022305.701ON1281256363e-86
KAFR0H002205.701ON1281256363e-86
Suva_11.3305.701ON1281256363e-86
Skud_11.3335.701ON1281256363e-86
YIL148W (RPL40A)5.701ON1281256363e-86
YKR094C (RPL40B)5.701ON1281256363e-86
Kwal_YGOB_Anc_5.7015.701ON1281256355e-86
TDEL0B022005.701ON1281256355e-86
ZYRO0G06622g5.701ON1281256355e-86
KLTH0E01078g5.701ON1281256321e-85
NDAI0E050305.701ON1281256321e-85
NCAS0A032105.701ON1281256321e-85
NCAS0G002405.701ON1281256321e-85
Skud_9.205.701ON1251226224e-84
Smik_11.3575.701ON1251226224e-84
Suva_9.405.701ON1441226227e-84
Smik_9.215.701ON1241216163e-83
NDAI0F003005.701ON1871226181e-82
NDAI0H002704.16ON77773799e-48
TDEL0G017504.16ON77763763e-47
KNAG0A027308.386ON150763799e-47
AGL128W8.386ON152763799e-47
Kpol_1030.58.386ON152763799e-47
Kpol_1024.168.386ON152763799e-47
Suva_10.34singletonON151773772e-46
Ecym_84084.16ON153773772e-46
TPHA0K022504.16ON153773772e-46
KNAG0J028804.16ON153773772e-46
Kwal_23.33118.386ON150763762e-46
KLTH0F08734g8.386ON150763762e-46
KLLA0D18304g8.386ON150763762e-46
TDEL0F051008.386ON150763762e-46
TPHA0C023908.386ON150763762e-46
Ecym_41818.386ON152763763e-46
ZYRO0C04026g8.386ON152763763e-46
TBLA0H031808.386ON152763763e-46
NDAI0G022808.386ON152763763e-46
NCAS0C029408.386ON152763763e-46
KAFR0H020008.386ON152763763e-46
CAGL0G08173g8.386ON152763763e-46
Suva_10.2668.386ON152763763e-46
Skud_12.2348.386ON152763763e-46
Smik_12.2298.386ON152763763e-46
YLR167W (RPS31)8.386ON152763763e-46
SAKL0H13926g8.386ON154763763e-46
TBLA0G006704.16ON229773772e-45
NDAI0D049304.16ON229773772e-45
KAFR0I014704.16ON229773772e-45
Kwal_55.206074.16ON231773772e-45
Suva_10.33singletonON254773774e-45
SAKL0H25784g4.16ON305773771e-44
KLLA0E00749g4.16ON381773803e-44
Suva_10.304.16ON381773777e-44
Skud_12.294.16ON381773777e-44
YLL039C (UBI4)4.16ON381773777e-44
ACL062C4.16ON382773777e-44
NCAS0C058504.16ON388773778e-44
Smik_12.184.16ON460893801e-43
KLTH0E05852g4.16ON409773771e-43
ZYRO0G07854g4.16ON460773773e-43
Kpol_1070.64.16ON533773779e-43
CAGL0D05082g4.16ON533773779e-43
Suva_10.32singletonON62623023e-36
Suva_10.31singletonON64502442e-27
KLLA0F17974g8.311ON77762243e-24
TPHA0C008908.311ON77762165e-23
SAKL0H15818g8.311ON77762088e-22
YDR139C (RUB1)8.311ON77762062e-21
Kpol_1036.628.311ON77762052e-21
NCAS0B035208.311ON77762043e-21
KLTH0G12540g8.311ON77762027e-21
ZYRO0D05962g8.311ON77761983e-20
NDAI0J010708.311ON77761974e-20
TDEL0F043808.311ON77761931e-19
CAGL0B01589g8.311ON77761843e-18
Smik_4.3838.311ON1001001708e-16
Skud_4.3988.311ON94931611e-14
Suva_2.3008.311ON86541559e-14
KAFR0B056708.311ON57501485e-13
Ecym_42448.311ON50501451e-12
Kwal_56.238838.311ON52501433e-12
AGL185W8.311ON50501363e-11
TBLA0H013108.311ON71501349e-11
KLLA0D01859g8.837ON371701254e-08
TBLA0D032308.837ON375711202e-07
CAGL0M02937g8.837ON373561141e-06
TBLA0B032408.837ON284491113e-06
Kpol_1068.118.837ON381881104e-06
SAKL0D01540g8.837ON365561087e-06
Suva_13.4648.837ON366701071e-05
ZYRO0G14124g8.837ON369541071e-05
TPHA0I002208.837ON377711071e-05
Kwal_27.101521.480ON381891071e-05
Smik_13.4898.837ON372561052e-05
KLTH0C03938g8.837ON376541052e-05
Ecym_46088.837ON406671052e-05
ABL129W8.837ON345561042e-05
Kwal_27.102758.837ON379711042e-05
KAFR0B039008.837ON379511033e-05
KNAG0J002908.837ON367491024e-05
YMR276W (DSK2)8.837ON373561024e-05
KLTH0C03410g1.480ON391611008e-05
KAFR0E005301.480ON37971972e-04
Kwal_55.19706singletonOFF6821902e-04
NDAI0K004408.837ON40456963e-04
TDEL0B006008.837ON36977945e-04
Skud_13.4488.837ON36449937e-04
KNAG0I009508.311ON110109880.001
NCAS0C004308.837ON36956910.001
NDAI0G003301.480ON42763900.002
CAGL0L01309g1.480ON39262890.002
Smik_5.561.480ON39757880.003
SAKL0D11814g1.480ON40057870.004
NCAS0G041201.480ON39262860.006
Suva_5.321.480ON40957860.006
Skud_5.531.480ON39757850.008
YEL037C (RAD23)1.480ON39857820.020
CAGL0M10912g6.343ON7369760.026
ZYRO0F05192g1.480ON38462810.027
TBLA0B021601.480ON40481810.027
Suva_14.3876.343ON7369750.035
Skud_14.3646.343ON7369750.035
KLLA0E22133g1.480ON38363800.036
Ecym_25016.343ON7369740.049
ZYRO0D08140g6.343ON7369720.094
Smik_14.3626.343ON7369720.094
Kwal_23.63386.343ON7369710.13
KLTH0A06820g6.343ON7369710.13
NDAI0K022306.343ON7369710.13
KAFR0C046106.343ON7369700.18
SAKL0A01210g6.343ON7369690.25
TDEL0C025901.480ON36862720.40
TPHA0O004401.480ON36956710.53
KNAG0G005101.480ON37572700.72
AFR358W1.480ON41354700.74
Ecym_35721.480ON44351671.8
KAFR0I027801.480ON21488652.7
AEL200C3.65ON20353643.6
Kwal_26.81612.559ON122938645.0
SAKL0H04378g8.759ON33545635.6
KLTH0D05698g2.485ON70386628.5
SAKL0G14256gsingletonON74753628.6
TPHA0K008407.256ON87790628.8
TBLA0E012804.139ON23344619.3
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KNAG0C06580
         (450 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...   306   e-108
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...   251   4e-87
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...   251   4e-87
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...   250   1e-86
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...   250   1e-86
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...   250   1e-86
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...   250   1e-86
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...   250   1e-86
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...   250   1e-86
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...   250   2e-86
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...   249   3e-86
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...   249   3e-86
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...   249   3e-86
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...   249   3e-86
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...   249   3e-86
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...   249   3e-86
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...   249   3e-86
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...   249   5e-86
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...   249   5e-86
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...   249   5e-86
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...   248   1e-85
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...   248   1e-85
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...   248   1e-85
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...   248   1e-85
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)    244   4e-84
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...   244   4e-84
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)    244   7e-84
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)    241   3e-83
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701       242   1e-82
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...   150   9e-48
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...   149   3e-47
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...   150   9e-47
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...   150   9e-47
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...   150   9e-47
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...   150   9e-47
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...   149   2e-46
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...   149   2e-46
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...   149   2e-46
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...   149   2e-46
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...   149   2e-46
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...   149   2e-46
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...   149   2e-46
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...   149   2e-46
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...   149   2e-46
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...   149   3e-46
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...   149   3e-46
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...   149   3e-46
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...   149   3e-46
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...   149   3e-46
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...   149   3e-46
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...   149   3e-46
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...   149   3e-46
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...   149   3e-46
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...   149   3e-46
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...   149   3e-46
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...   149   3e-46
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...   149   2e-45
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}             149   2e-45
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...   149   2e-45
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...   149   2e-45
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...   149   4e-45
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...   149   1e-44
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...   150   3e-44
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...   149   7e-44
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...   149   7e-44
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...   149   7e-44
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...   149   7e-44
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}            149   8e-44
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...   150   1e-43
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...   149   1e-43
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...   149   3e-43
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...   149   9e-43
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...   149   9e-43
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...   120   3e-36
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    99   2e-27
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    91   3e-24
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    88   5e-23
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    85   8e-22
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    84   2e-21
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    84   2e-21
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    83   3e-21
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    82   7e-21
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    81   3e-20
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    80   4e-20
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    79   1e-19
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    75   3e-18
Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 b...    70   8e-16
Skud_4.398 Chr4 complement(705294..705386,705390..705431,705435....    67   1e-14
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    64   9e-14
KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694) [...    62   5e-13
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    60   1e-12
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    60   3e-12
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    57   3e-11
TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311...    56   9e-11
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...    53   4e-08
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...    51   2e-07
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...    49   1e-06
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    47   3e-06
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...    47   4e-06
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...    46   7e-06
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...    46   1e-05
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...    46   1e-05
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...    46   1e-05
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    46   1e-05
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...    45   2e-05
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...    45   2e-05
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...    45   2e-05
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...    45   2e-05
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...    45   2e-05
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...    44   3e-05
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...    44   4e-05
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...    44   4e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    43   8e-05
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    42   2e-04
Kwal_55.19706 s55 complement(89022..89228) [207 bp, 68 aa] {OFF}...    39   2e-04
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...    42   3e-04
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...    41   5e-04
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...    40   7e-04
KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.31...    39   0.001
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...    40   0.001
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    39   0.002
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    39   0.002
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    39   0.003
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    38   0.004
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    38   0.006
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    38   0.006
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    37   0.008
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    36   0.020
CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa] ...    34   0.026
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    36   0.027
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    36   0.027
Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON...    33   0.035
Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON...    33   0.035
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    35   0.036
Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON} s...    33   0.049
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    32   0.094
Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON...    32   0.094
Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa] {O...    32   0.13 
KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON...    32   0.13 
NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON...    32   0.13 
KAFR0C04610 Chr3 complement(923893..924114) [222 bp, 73 aa] {ON}...    32   0.18 
SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar ...    31   0.25 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    32   0.40 
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    32   0.53 
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    32   0.72 
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    32   0.74 
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    30   1.8  
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    30   2.7  
AEL200C Chr5 complement(259714..260325) [612 bp, 203 aa] {ON} Sy...    29   3.6  
Kwal_26.8161 s26 (672977..676666) [3690 bp, 1229 aa] {ON} YMR012...    29   5.0  
SAKL0H04378g Chr8 (403363..404370) [1008 bp, 335 aa] {ON} simila...    29   5.6  
KLTH0D05698g Chr4 (508215..510326) [2112 bp, 703 aa] {ON} some s...    28   8.5  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    28   8.6  
TPHA0K00840 Chr11 complement(176032..178665) [2634 bp, 877 aa] {...    28   8.8  
TBLA0E01280 Chr5 (281380..282081) [702 bp, 233 aa] {ON} Anc_4.13...    28   9.3  

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [450
           bp, 149 aa] {ON} 
          Length = 149

 Score =  306 bits (783), Expect = e-108
 Identities = 149/149 (100%), Positives = 149/149 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRELKLICFWFSRRLCIPVISYVLYIC 447
           LRPRELKLICFWFSRRLCIPVISYVLYIC
Sbjct: 121 LRPRELKLICFWFSRRLCIPVISYVLYIC 149

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, 128
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YKR094C (RPL40B) and YIL148W (RPL40A); 1-intron
          Length = 128

 Score =  251 bits (642), Expect = 4e-87
 Identities = 123/125 (98%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
           bp, 128 aa] {ON} 
          Length = 128

 Score =  251 bits (642), Expect = 4e-87
 Identities = 123/125 (98%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
           similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YKR094C RPL40B Fusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {ON}
           Anc_5.701 YIL148W
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [387
           bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 bp,
           128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
           bp, 128 aa] {ON} highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score =  250 bits (639), Expect = 1e-86
 Identities = 122/125 (97%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {ON}
           complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score =  250 bits (638), Expect = 2e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKS+CRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
           [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
           Saccharomyces cerevisiae YLR167W RPS31 and highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YIL148W and highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094C and highly similar to
           uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
           proteins that are cleaved to yield a ribosomal protein
           of the small (40S) subunit and ubiquitin
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEK+VCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
           {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {ON} 
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
           RPL40AFusion protein, identical to Rpl40Bp, that is
           cleaved to yield ubiquitin and a ribosomal protein of
           the large (60S) ribosomal subunit with similarity to rat
           L40; ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
           128 aa] {ON}  RPL40BFusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score =  249 bits (636), Expect = 3e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
           aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score =  249 bits (635), Expect = 5e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASK+NCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
           {ON} 
          Length = 128

 Score =  249 bits (635), Expect = 5e-86
 Identities = 121/125 (96%), Positives = 124/125 (99%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLK LASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P14796 Saccharomyces
           cerevisiae YKR094C RPL40B
          Length = 128

 Score =  249 bits (635), Expect = 5e-86
 Identities = 121/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCR+CYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P61864 Saccharomyces
           cerevisiae YKR094c RPL40B and highly similar to
           uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score =  248 bits (632), Expect = 1e-85
 Identities = 120/125 (96%), Positives = 125/125 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLKALASK+NCEKSVCRKCYARLPP+ATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [387
           bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score =  248 bits (632), Expect = 1e-85
 Identities = 120/125 (96%), Positives = 124/125 (99%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
           {ON} Anc_5.701
          Length = 128

 Score =  248 bits (632), Expect = 1e-85
 Identities = 120/125 (96%), Positives = 124/125 (99%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {ON}
           Anc_5.701
          Length = 128

 Score =  248 bits (632), Expect = 1e-85
 Identities = 120/125 (96%), Positives = 124/125 (99%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 361 LRPRE 375
           LRP++
Sbjct: 121 LRPKK 125

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)
          Length = 125

 Score =  244 bits (622), Expect = 4e-84
 Identities = 118/122 (96%), Positives = 122/122 (100%)
 Frame = +1

Query: 10  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 189
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 1   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 60

Query: 190 ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 369
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 61  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 120

Query: 370 RE 375
           ++
Sbjct: 121 KK 122

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {ON}
           YKR094C (REAL)
          Length = 125

 Score =  244 bits (622), Expect = 4e-84
 Identities = 118/122 (96%), Positives = 122/122 (100%)
 Frame = +1

Query: 10  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 189
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 1   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 60

Query: 190 ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 369
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 61  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 120

Query: 370 RE 375
           ++
Sbjct: 121 KK 122

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)
          Length = 144

 Score =  244 bits (622), Expect = 7e-84
 Identities = 118/122 (96%), Positives = 122/122 (100%)
 Frame = +1

Query: 10  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 189
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 20  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 79

Query: 190 ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 369
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 80  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 139

Query: 370 RE 375
           ++
Sbjct: 140 KK 141

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)
          Length = 124

 Score =  241 bits (616), Expect = 3e-83
 Identities = 117/121 (96%), Positives = 121/121 (100%)
 Frame = +1

Query: 13  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 192
           VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE
Sbjct: 1   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 60

Query: 193 STLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRPR 372
           STLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP+
Sbjct: 61  STLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPK 120

Query: 373 E 375
           +
Sbjct: 121 K 121

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score =  242 bits (618), Expect = 1e-82
 Identities = 117/122 (95%), Positives = 121/122 (99%)
 Frame = +1

Query: 10  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 189
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 63  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 122

Query: 190 ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 369
           ESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 123 ESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 182

Query: 370 RE 375
           ++
Sbjct: 183 KK 184

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
           Anc_4.16
          Length = 77

 Score =  150 bits (379), Expect = 9e-48
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGV 77

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
           YLL039C
          Length = 77

 Score =  149 bits (376), Expect = 3e-47
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
           Anc_8.386 YLR167W
          Length = 150

 Score =  150 bits (379), Expect = 9e-47
 Identities = 76/76 (100%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score =  150 bits (379), Expect = 9e-47
 Identities = 76/76 (100%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
           complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score =  150 bits (379), Expect = 9e-47
 Identities = 76/76 (100%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
           complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score =  150 bits (379), Expect = 9e-47
 Identities = 76/76 (100%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
           YALI0E18986g (REAL)
          Length = 151

 Score =  149 bits (377), Expect = 2e-46
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  139 bits (350), Expect = 2e-42
 Identities = 70/71 (98%), Positives = 71/71 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVL 213
           IQKESTLHLVL
Sbjct: 137 IQKESTLHLVL 147

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
           Ashbya gossypii ACL062C
          Length = 153

 Score =  149 bits (377), Expect = 2e-46
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score =  149 bits (377), Expect = 2e-46
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score =  149 bits (377), Expect = 2e-46
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
           YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
           [contig 251] FULL
          Length = 150

 Score =  149 bits (376), Expect = 2e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {ON}
           similar to uniprot|P61864 Saccharomyces cerevisiae
           YLR167W RPS31 Fusion protein that is cleaved to yield a
           ribosomal protein of the small (40S) subunit and
           ubiquitin
          Length = 150

 Score =  149 bits (376), Expect = 2e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} similar
           to uniprot|P04838 Saccharomyces cerevisiae YLR167W RPS31
           Fusion protein that is cleaved to yield a ribosomal
           protein of the small (40S) subunit and ubiquitin;
           ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes; interacts genetically with
           translation factor eIF2B
          Length = 150

 Score =  149 bits (376), Expect = 2e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
           YLR167W
          Length = 150

 Score =  149 bits (376), Expect = 2e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
           Anc_8.386 YLR167W
          Length = 150

 Score =  149 bits (376), Expect = 2e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
           similar to Ashbya gossypii AGL128W
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar to
           uniprot|P05759 Saccharomyces cerevisiae YLR167W RPS31
           Fusion protein that is cleaved to yield a ribosomal
           protein of the small (40S) subunit and ubiquitin
           ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes interacts genetically with
           translation factor eIF2B
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
           YLR167W
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
           Anc_8.386
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
           Anc_8.386
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
           Anc_8.386 YLR167W
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
           similar to uniprot|P61864 Saccharomyces cerevisiae
           YLR167w UBI3 Fusion protein that is cleaved to yield a
           ribosomal protein of the small (40S) subunit and
           ubiquitin
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
           (REAL)
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
           (REAL)
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
           (REAL)
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
           protein that is cleaved to yield a ribosomal protein of
           the small (40S) subunit and ubiquitin; ubiquitin may
           facilitate assembly of the ribosomal protein into
           ribosomes; interacts genetically with translation factor
           eIF2B
          Length = 152

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
           {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
           YLR167W RPS31 and similar to uniprot|P04838
           Saccharomyces cerevisiae YIL148W and similar to
           uniprot|P04838 Saccharomyces cerevisiae YKR094C and
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YLL039C Fusion proteins that are cleaved to yield a
           ribosomal protein of the small (40S) subunit and
           ubiquitin
          Length = 154

 Score =  149 bits (376), Expect = 3e-46
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 61  IQKESTLHLVLRLRGG 76

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
           YLL039C
          Length = 229

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
           YIL148W
          Length = 229

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {ON}
           YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 2e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (376), Expect = 3e-45
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 213 IQKESTLHLVLRLRGG 228

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
           YLL039C (REAL)
          Length = 254

 Score =  149 bits (377), Expect = 4e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 4e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 4e-45
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score = 43.1 bits (100), Expect = 7e-05
 Identities = 21/21 (100%), Positives = 21/21 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSD 63
           MQIFVKTLTGKTITLEVESSD
Sbjct: 229 MQIFVKTLTGKTITLEVESSD 249

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YLL039c UBI4 ubiquitin
          Length = 305

 Score =  149 bits (377), Expect = 1e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 1e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 1e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (376), Expect = 2e-44
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 289 IQKESTLHLVLRLRGG 304

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score =  150 bits (380), Expect = 3e-44
 Identities = 76/77 (98%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGGI
Sbjct: 365 IQKESTLHLVLRLRGGI 381

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

>Suva_10.30 Chr10
           complement(67747..67841,68061..68288,68558..69013,
           69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  146 bits (368), Expect = 2e-42
 Identities = 74/76 (97%), Positives = 75/76 (98%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFA KQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
           381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (376), Expect = 1e-43
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
           UBI4Ubiquitin, becomes conjugated to proteins, marking
           them for selective degradation via the ubiquitin-26S
           proteasome system; essential for the cellular stress
           response; encoded as a polyubiquitin precursor comprised
           of 5 head-to-tail repeats
          Length = 381

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (376), Expect = 1e-43
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL039C
           (UBI4)
          Length = 382

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (377), Expect = 7e-44
 Identities = 75/78 (96%), Positives = 77/78 (98%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGII 234
           IQKESTLHLVLRLRGG +
Sbjct: 365 IQKESTLHLVLRLRGGAL 382

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score =  149 bits (377), Expect = 8e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 8e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 8e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 8e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (377), Expect = 8e-44
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score =  150 bits (380), Expect = 1e-43
 Identities = 78/89 (87%), Positives = 83/89 (93%), Gaps = 1/89 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLR-GGIIEPSLKALASK 264
           IQKESTLHLVLRLR GG+++  +K L  K
Sbjct: 137 IQKESTLHLVLRLRGGGVMQIFVKTLTGK 165

 Score =  150 bits (380), Expect = 1e-43
 Identities = 78/89 (87%), Positives = 83/89 (93%), Gaps = 1/89 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 231 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 290

Query: 181 IQKESTLHLVLRLR-GGIIEPSLKALASK 264
           IQKESTLHLVLRLR GG+++  +K L  K
Sbjct: 291 IQKESTLHLVLRLRGGGVMQIFVKTLTGK 319

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 155 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 214

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 215 IQKESTLHLVLRLRGGM 231

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 309 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 368

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 369 IQKESTLHLVLRLRGGM 385

 Score =  149 bits (376), Expect = 4e-43
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 385 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 444

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 445 IQKESTLHLVLRLRGG 460

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score =  149 bits (377), Expect = 1e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 105 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 164

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 165 IQKESTLHLVLRLRGGM 181

 Score =  149 bits (377), Expect = 1e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 181 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 240

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 241 IQKESTLHLVLRLRGGM 257

 Score =  149 bits (377), Expect = 1e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 257 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 316

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 317 IQKESTLHLVLRLRGGM 333

 Score =  149 bits (376), Expect = 2e-43
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 333 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 392

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 393 IQKESTLHLVLRLRGG 408

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (377), Expect = 3e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  149 bits (376), Expect = 4e-43
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 441 IQKESTLHLVLRLRGG 456

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
           complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 441 IQKESTLHLVLRLRGGM 457

 Score =  149 bits (376), Expect = 1e-42
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 517 IQKESTLHLVLRLRGG 532

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
           to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
           ubiquitin
          Length = 533

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 61  IQKESTLHLVLRLRGGM 77

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  149 bits (377), Expect = 9e-43
 Identities = 75/77 (97%), Positives = 77/77 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 181 IQKESTLHLVLRLRGGI 231
           IQKESTLHLVLRLRGG+
Sbjct: 441 IQKESTLHLVLRLRGGM 457

 Score =  149 bits (376), Expect = 1e-42
 Identities = 75/76 (98%), Positives = 76/76 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 181 IQKESTLHLVLRLRGG 228
           IQKESTLHLVLRLRGG
Sbjct: 517 IQKESTLHLVLRLRGG 532

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
           YLL039C (REAL)
          Length = 62

 Score =  120 bits (302), Expect = 3e-36
 Identities = 60/62 (96%), Positives = 61/62 (98%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 222
           LEVE SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
Sbjct: 1   LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 60

Query: 223 GG 228
           GG
Sbjct: 61  GG 62

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
           YLR167W (REAL)
          Length = 64

 Score = 98.6 bits (244), Expect = 2e-27
 Identities = 49/50 (98%), Positives = 50/50 (100%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQL
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL 50

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
           aa] {ON} similar to uniprot|Q03919 Saccharomyces
           cerevisiae YDR139C RUB1 Ubiquitin-like protein with
           similarity to mammalian NEDD8
          Length = 77

 Score = 90.9 bits (224), Expect = 3e-24
 Identities = 42/76 (55%), Positives = 60/76 (78%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQ+ VKTLTGK I+++V+SS+T+ ++K  +++KEGIPP QQ+LIF GKQ++D  T+   +
Sbjct: 1   MQLKVKTLTGKEISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSAD 60

Query: 181 IQKESTLHLVLRLRGG 228
           +Q  S LHLVL LRGG
Sbjct: 61  LQDGSLLHLVLTLRGG 76

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
           {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 87.8 bits (216), Expect = 5e-23
 Identities = 43/76 (56%), Positives = 56/76 (73%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           MQI VKTLTGK I +EV+ SD + ++K  +++KEGIPP QQRLIF GKQ++D +T+   N
Sbjct: 1   MQIKVKTLTGKEIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESAN 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LIDGMQLHLVLTLRGG 76

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
           aa] {ON} similar to uniprot|Q03919 Saccharomyces
           cerevisiae YDR139C RUB1 Ubiquitin-like protein with
           similarity to mammalian NEDD8
          Length = 77

 Score = 84.7 bits (208), Expect = 8e-22
 Identities = 40/76 (52%), Positives = 54/76 (71%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M++ VKTLTGK I + +ES + +  +K  +++KEGIPP QQRLIF GKQ+ED +T+   N
Sbjct: 1   MELKVKTLTGKEIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSAN 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LSSGMQLHLVLTLRGG 76

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, 77
           aa] {ON}  RUB1Ubiquitin-like protein with similarity to
           mammalian NEDD8; conjugation (neddylation) substrates
           include the cullins Cdc53p, Rtt101p, and Cul3p;
           activated by Ula1p and Uba3p (E1 enzyme pair);
           conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 84.0 bits (206), Expect = 2e-21
 Identities = 40/76 (52%), Positives = 58/76 (76%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ++D  T++D +
Sbjct: 1   MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH 60

Query: 181 IQKESTLHLVLRLRGG 228
           + +   LHLVL LRGG
Sbjct: 61  LVEGMQLHLVLTLRGG 76

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
           bp, 77 aa] {ON}
           complement(173662..173746,173844..173992) [234 nt, 78
           aa]
          Length = 77

 Score = 83.6 bits (205), Expect = 2e-21
 Identities = 39/76 (51%), Positives = 55/76 (72%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ++D +T+    
Sbjct: 1   MYVKVKTLTGKEISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAK 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LTDGMQLHLVLTLRGG 76

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 bp,
           77 aa] {ON}
          Length = 77

 Score = 83.2 bits (204), Expect = 3e-21
 Identities = 40/76 (52%), Positives = 55/76 (72%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I VKTLTGK I ++++ +D +  +K  +++KEGIPP QQRLIF GKQ++D +T+S  N
Sbjct: 1   MIIKVKTLTGKEIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSAN 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LIDGMQLHLVLTLRGG 76

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
           aa] {ON} similar to uniprot|Q03919 Saccharomyces
           cerevisiae YDR139C RUB1 Ubiquitin-like protein with
           similarity to mammalian NEDD8
          Length = 77

 Score = 82.4 bits (202), Expect = 7e-21
 Identities = 39/76 (51%), Positives = 54/76 (71%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M++ VKTLTGK I + V+  D +  +K  +++KEGIPP QQRLIF GKQ++D +++S  N
Sbjct: 1   MKLTVKTLTGKEIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSAN 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LSSGMQLHLVLTLRGG 76

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
           {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
           YDR139C RUB1 Ubiquitin-like protein with similarity to
           mammalian NEDD8
          Length = 77

 Score = 80.9 bits (198), Expect = 3e-20
 Identities = 41/76 (53%), Positives = 52/76 (68%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I VKTLTGK I +E+   D I  +K  +++KEGIPP QQRLIF GKQ++D +T+S   
Sbjct: 1   MIIKVKTLTGKEIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAK 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LVDGMQLHLVLTLRGG 76

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
           {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 80.5 bits (197), Expect = 4e-20
 Identities = 39/76 (51%), Positives = 54/76 (71%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I VKTLTGK I +E+  ++ +  +K  +++KEGIPP QQRLIF GKQ++D +++S  N
Sbjct: 1   MIIKVKTLTGKEIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSAN 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LVDGMQLHLVLTLRGG 76

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 bp,
           77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 79.0 bits (193), Expect = 1e-19
 Identities = 41/76 (53%), Positives = 52/76 (68%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I VKTLTGK I +E++S   I  +K  +++KEGIPP QQRLIF GKQ++D +TL    
Sbjct: 1   MIIKVKTLTGKEIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAK 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LVDGMVLHLVLTLRGG 76

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
           {ON} highly similar to uniprot|Q03919 Saccharomyces
           cerevisiae YDR139c RUB1
          Length = 77

 Score = 75.5 bits (184), Expect = 3e-18
 Identities = 39/76 (51%), Positives = 50/76 (65%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I VKTLTGK I +EV   D + ++K  +++KEGIP  QQRLIF GKQ+ +  T+S   
Sbjct: 1   MIIKVKTLTGKEIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAK 60

Query: 181 IQKESTLHLVLRLRGG 228
           +     LHLVL LRGG
Sbjct: 61  LSDGMQLHLVLTLRGG 76

>Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 bp,
           100 aa] {ON} YDR139C (REAL)
          Length = 100

 Score = 70.1 bits (170), Expect = 8e-16
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 24/100 (24%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL---------- 150
           M + VKTLTGK I++E+  SD + ++K  +++KEGIPP QQRLIF GKQ+          
Sbjct: 1   MIVKVKTLTGKEISVELRESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKFTSSIVS 60

Query: 151 --------------EDGRTLSDYNIQKESTLHLVLRLRGG 228
                         +D  T++D ++ +   LHLVL LRGG
Sbjct: 61  KFSTFSDLTNDQDSDDKLTVTDAHLVEGMQLHLVLTLRGG 100

>Skud_4.398 Chr4
           complement(705294..705386,705390..705431,705435..705581)
           [282 bp, 94 aa] {ON} YDR139C (REAL)
          Length = 94

 Score = 66.6 bits (161), Expect = 1e-14
 Identities = 37/93 (39%), Positives = 54/93 (58%), Gaps = 23/93 (24%)
 Frame = +1

Query: 19  TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL---------------- 150
           TLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ+                
Sbjct: 1   TLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKLAWLITFQACLYL 60

Query: 151 -------EDGRTLSDYNIQKESTLHLVLRLRGG 228
                  +D  T++D ++ +   LHLVL LRGG
Sbjct: 61  RFYRLRSDDKLTVTDAHLVEGMQLHLVLTLRGG 93

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 bp,
           86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 64.3 bits (155), Expect = 9e-14
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR 162
           M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ+ D +
Sbjct: 1   MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVDAK 54

>KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694) [174
           bp, 57 aa] {ON} Anc_8.311 YDR139C
          Length = 57

 Score = 61.6 bits (148), Expect = 5e-13
 Identities = 29/50 (58%), Positives = 39/50 (78%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           M I VKTLTGK I +E++ +D I ++K  +++KEGIPP QQRLIF GKQ+
Sbjct: 1   MFIKVKTLTGKEIAVELDENDRIYHIKELLEEKEGIPPSQQRLIFQGKQI 50

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
           similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 60.5 bits (145), Expect = 1e-12
 Identities = 28/50 (56%), Positives = 38/50 (76%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           M + VKTLTGK I ++VE  D + ++K  +++KEGIPP QQRLIF GKQ+
Sbjct: 1   MLLKVKTLTGKEIPIDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGKQM 50

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
           YDR139C (RUB1) - ubiquitin-like protein [contig 171]
           FULL
          Length = 52

 Score = 59.7 bits (143), Expect = 3e-12
 Identities = 27/50 (54%), Positives = 38/50 (76%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           M++ VKTLTGK I + V+ SD +  +K  +++KEGIPP QQ+LIF GKQ+
Sbjct: 1   MKLTVKTLTGKEIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGKQM 50

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 57.0 bits (136), Expect = 3e-11
 Identities = 26/50 (52%), Positives = 36/50 (72%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           M + VKTLTGK I ++V   D +  +K  ++++EGIPP QQRLIF GKQ+
Sbjct: 1   MLLKVKTLTGKEIQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGKQM 50

>TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311
           YDR139C
          Length = 71

 Score = 56.2 bits (134), Expect = 9e-11
 Identities = 28/50 (56%), Positives = 35/50 (70%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 150
           M I VKTLTGK I +EV   D + ++K  ++ KEGIPP Q RLIF GKQ+
Sbjct: 1   MFIKVKTLTGKEIPIEVLPEDKVFHIKELLEQKEGIPPSQLRLIFQGKQM 50

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score = 52.8 bits (125), Expect = 4e-08
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query: 4   QIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 3   QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62

Query: 181 IQKESTLHLV 210
           IQ   ++H+V
Sbjct: 63  IQDGHSVHMV 72

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score = 50.8 bits (120), Expect = 2e-07
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 177
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 178 NIQKESTLHLV 210
            IQ   ++H+V
Sbjct: 61  KIQDGHSIHMV 71

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score = 48.5 bits (114), Expect = 1e-06
 Identities = 22/56 (39%), Positives = 36/56 (64%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + ++ S TI N+K +I     IP   QRLI++GK L+D +T+  YNI+ +  +H+V
Sbjct: 16  VSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYNIKDDHAIHMV 71

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 47.4 bits (111), Expect = 3e-06
 Identities = 21/49 (42%), Positives = 33/49 (67%)
 Frame = +1

Query: 40  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14  TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score = 47.0 bits (110), Expect = 4e-06
 Identities = 30/88 (34%), Positives = 47/88 (53%)
 Frame = +1

Query: 49  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 228
           V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV    GG
Sbjct: 18  VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV--KSGG 75

Query: 229 IIEPSLKALASKYNCEKSVCRKCYARLP 312
             + +  A A+  +   +      A LP
Sbjct: 76  ASKTNTSASAAAASTSTATNSDSNAPLP 103

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score = 46.2 bits (108), Expect = 7e-06
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 16  VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score = 45.8 bits (107), Expect = 1e-05
 Identities = 25/70 (35%), Positives = 40/70 (57%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + ++VK+   K   + V    T+   K  I +  GIP   QRLI++GK L+D +T+  Y+
Sbjct: 3   LNVYVKSGQDKW-EVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESYH 61

Query: 181 IQKESTLHLV 210
           IQ   ++HLV
Sbjct: 62  IQDGHSVHLV 71

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score = 45.8 bits (107), Expect = 1e-05
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = +1

Query: 49  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           V+   T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 19  VDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score = 45.8 bits (107), Expect = 1e-05
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 177
           M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 178 NIQKESTLHLV 210
            IQ   ++HLV
Sbjct: 61  KIQDGHSIHLV 71

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {ON}
           YEL037C (RAD23) - ubiquitin-like protein [contig 41]
           FULL
          Length = 381

 Score = 45.8 bits (107), Expect = 1e-05
 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           ++I  K    + + LE+E S T++  K K+ + +     Q +LI++GK L+D RT+ DY 
Sbjct: 2   VKINFKDFKKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYK 61

Query: 181 IQK-ESTLHLVLRLRGGIIEPSLKALASK 264
           ++  +  + ++ + +  + + +L A   K
Sbjct: 62  LKDGDQVIFMISKKKSTVTKTTLPAEEQK 90

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score = 45.1 bits (105), Expect = 2e-05
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 16  VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score = 45.1 bits (105), Expect = 2e-05
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = +1

Query: 49  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 18  IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score = 45.1 bits (105), Expect = 2e-05
 Identities = 24/67 (35%), Positives = 39/67 (58%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 222
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV R  
Sbjct: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV-RSG 74

Query: 223 GGIIEPS 243
           GG +  S
Sbjct: 75  GGKVSGS 81

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score = 44.7 bits (104), Expect = 2e-05
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 16  VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score = 44.7 bits (104), Expect = 2e-05
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 177
           M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 178 NIQKESTLHLV 210
            I     +HLV
Sbjct: 61  KILDGHAVHLV 71

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score = 44.3 bits (103), Expect = 3e-05
 Identities = 21/51 (41%), Positives = 33/51 (64%)
 Frame = +1

Query: 58  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score = 43.9 bits (102), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 64  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score = 43.9 bits (102), Expect = 4e-05
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {ON}
           similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037C RAD23
          Length = 391

 Score = 43.1 bits (100), Expect = 8e-05
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           ++I  K    + + LE++S  TI   K ++ + +     Q +LI++GK L+D RT++DY 
Sbjct: 2   VKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYK 61

Query: 181 I 183
           +
Sbjct: 62  L 62

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {ON}
           Anc_1.480 YEL037C
          Length = 379

 Score = 42.0 bits (97), Expect = 2e-04
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I  K    + I +E+ESS TI + K K+   +    DQ +LIF+GK L+D +T+S   
Sbjct: 1   MNIIFKDFKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCG 60

Query: 181 IQKESTLHLVL 213
           ++    + +++
Sbjct: 61  LKDNDQVIMMI 71

>Kwal_55.19706 s55 complement(89022..89228) [207 bp, 68 aa] {OFF}
          [contig 159] FULL
          Length = 68

 Score = 39.3 bits (90), Expect = 2e-04
 Identities = 19/21 (90%), Positives = 20/21 (95%)
 Frame = -2

Query: 68 MVSEDSTSNVMVLPVKVLTKI 6
          MVSEDSTS VMVLPVKVLTK+
Sbjct: 1  MVSEDSTSKVMVLPVKVLTKL 21

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score = 41.6 bits (96), Expect = 3e-04
 Identities = 20/56 (35%), Positives = 35/56 (62%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 40.8 bits (94), Expect = 5e-04
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 177
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 178 NIQKESTLHLVLRLRGG 228
            IQ    +HLV    GG
Sbjct: 61  KIQDGHAIHLVKSGGGG 77

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score = 40.4 bits (93), Expect = 7e-04
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +1

Query: 64  TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 23  TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71

>KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.311
           YDR139C
          Length = 110

 Score = 38.5 bits (88), Expect = 0.001
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 33/109 (30%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP--------PDQQ----------- 123
           M + VKTLTGK I +E+E+SD +  VK  +++K   P        P +            
Sbjct: 1   MIVKVKTLTGKEIPVELEASDKVYRVKELLEEKRRDPTIAAETDIPGETNVCVKWVPVGL 60

Query: 124 -----------RLIFAGKQL---EDGRTLSDYNIQKESTLHLVLRLRGG 228
                      R+ +  K +   +D +T+S   +     LHLVL LRGG
Sbjct: 61  TCLTRSLFFLLRISYTNKLISHSDDEQTISSAKLVDGMQLHLVLTLRGG 109

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 39.7 bits (91), Expect = 0.001
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +1

Query: 43  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V
Sbjct: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
           Anc_1.480 YEL037C
          Length = 427

 Score = 39.3 bits (90), Expect = 0.002
 Identities = 17/63 (26%), Positives = 39/63 (61%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + +  K    + I L++E S+TI +VK+++   +     Q ++I++GK L+DG+T+ +  
Sbjct: 2   VNVIFKDFKKEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQ 61

Query: 181 IQK 189
           +++
Sbjct: 62  LKE 64

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
           {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 38.9 bits (89), Expect = 0.002
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + +  K    +   L++ESS +I  VK  + +K    P Q +LIF+GK L+DG ++   N
Sbjct: 2   VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 181 IQ 186
            +
Sbjct: 62  FK 63

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
           YEL037C (REAL)
          Length = 397

 Score = 38.5 bits (88), Expect = 0.003
 Identities = 18/57 (31%), Positives = 34/57 (59%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           K    + + L++E S+TI  VK+K+         Q +LI++GK L+D +T+S+  ++
Sbjct: 7   KNFKKEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLK 63

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
           to uniprot|P32628 Saccharomyces cerevisiae YEL037C RAD23
          Length = 400

 Score = 38.1 bits (87), Expect = 0.004
 Identities = 17/57 (29%), Positives = 33/57 (57%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           K    + + LE++ + T+   K ++   +    DQ +LIF+GK L+DG+TL +  ++
Sbjct: 7   KDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLK 63

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.480
           YEL037C
          Length = 392

 Score = 37.7 bits (86), Expect = 0.006
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + I  K    + I L +ES++T+ + K ++   +     Q +LI++GK L+D +TL D  
Sbjct: 2   INITFKDFKKEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCG 61

Query: 181 IQ 186
           ++
Sbjct: 62  LK 63

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
           YEL037C (REAL)
          Length = 409

 Score = 37.7 bits (86), Expect = 0.006
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           K    + + L++E S+TI   K K+         Q +LI++GK L+D +T+S+  ++
Sbjct: 7   KNFKKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLK 63

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
           YEL037C (REAL)
          Length = 397

 Score = 37.4 bits (85), Expect = 0.008
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           K    + + L++E S+TI   K K+         Q +LI++GK L+D +T+S+  ++
Sbjct: 7   KNFKKEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLK 63

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
           RAD23Protein with ubiquitin-like N terminus, subunit of
           Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
           binds damaged DNA; enhances protein deglycosylation
           activity of Png1p; also involved, with Rad4p, in
           ubiquitylated protein turnover
          Length = 398

 Score = 36.2 bits (82), Expect = 0.020
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 186
           K    + + L++E S+TI   K K+         Q +LI++GK L+D +T+S+  ++
Sbjct: 7   KNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLK 63

>CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa]
           {ON} highly similar to uniprot|Q6Q546 Saccharomyces
           cerevisiae YNR032ca HUB1
          Length = 73

 Score = 33.9 bits (76), Expect = 0.026
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK I ++    DT+ + K  +  + G+ P +  L   G  L+D  TL DY 
Sbjct: 2   IEVLVNDRLGKKIRVKCLEDDTVGDFKKVLSVQLGMQPSKIVLQKGGSVLKDHITLYDYE 61

Query: 181 IQKESTLHL 207
           +   + L L
Sbjct: 62  VHDNTNLEL 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
           to uniprot|P32628 Saccharomyces cerevisiae YEL037C RAD23
          Length = 384

 Score = 35.8 bits (81), Expect = 0.027
 Identities = 15/62 (24%), Positives = 35/62 (56%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + I  K    + I+LE++ S ++ + K ++  ++     Q +LI++GK L+D + L +  
Sbjct: 2   INIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESG 61

Query: 181 IQ 186
           ++
Sbjct: 62  LK 63

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {ON}
           Anc_1.480 YEL037C
          Length = 404

 Score = 35.8 bits (81), Expect = 0.027
 Identities = 18/81 (22%), Positives = 43/81 (53%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + +  K    + I LE+++  TI++ K +I  ++    DQ +LI++GK L++  T+ +  
Sbjct: 2   VSLIFKDFKKEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSG 61

Query: 181 IQKESTLHLVLRLRGGIIEPS 243
           ++    +  ++  +    EP+
Sbjct: 62  LKDNDHIIFMISKKKKKTEPA 82

>Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON}
           YNR032C-A (REAL)
          Length = 73

 Score = 33.5 bits (75), Expect = 0.035
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2   IEVVVNDRLGKRVKVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 181 IQKESTLHL 207
           +  E+ L L
Sbjct: 62  VHDETNLEL 70

>Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON}
           YNR032C-A (REAL)
          Length = 73

 Score = 33.5 bits (75), Expect = 0.035
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2   IEVVVNDRLGKKVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 181 IQKESTLHL 207
           +  E+ L L
Sbjct: 62  VHDETNLEL 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
           {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037C RAD23
          Length = 383

 Score = 35.4 bits (80), Expect = 0.036
 Identities = 19/63 (30%), Positives = 35/63 (55%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           M I  K    + + +E+    TI + K  I +++     Q +LI+AGK L+D +T+S  N
Sbjct: 1   MLINFKDFKKEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCN 60

Query: 181 IQK 189
           +++
Sbjct: 61  LKE 63

>Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON}
           similar to Ashbya gossypii AER266C
          Length = 73

 Score = 33.1 bits (74), Expect = 0.049
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK +T++   +DTI + K  +  + G   ++  L   G  L+D  TL DY 
Sbjct: 2   IEVIVNDRLGKKVTIKCLPTDTIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDYE 61

Query: 181 IQKESTLHL 207
           I   + L L
Sbjct: 62  IHDGTNLEL 70

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar to
           uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A HUB1
          Length = 73

 Score = 32.3 bits (72), Expect = 0.094
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK I ++    D + + K  +  + G P  + +L+  G  L+D  +L DY 
Sbjct: 2   IEVVVNDRLGKKIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYE 61

Query: 181 IQKESTLHL 207
           I   + L L
Sbjct: 62  IHDNTFLEL 70

>Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON}
           YNR032C-A (REAL)
          Length = 73

 Score = 32.3 bits (72), Expect = 0.094
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2   IEVVVNDRLGKKVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 181 IQKESTLHL 207
           +  ++ L L
Sbjct: 62  VHDQTNLEL 70

>Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa] {ON}
           YNR032C-A (HUB1) - ubiquitin-like modifier [contig 17]
           FULL
          Length = 73

 Score = 32.0 bits (71), Expect = 0.13
 Identities = 19/69 (27%), Positives = 35/69 (50%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK I ++ E+ DT+ + K  +  + GI   +  L   G  L+D  +L DY 
Sbjct: 2   IEVEVNDRLGKKIRVKCEAEDTVGDFKKVLALQMGISWTKIILQKGGSTLKDHISLDDYE 61

Query: 181 IQKESTLHL 207
           +  ++ L L
Sbjct: 62  VHDQTYLEL 70

>KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON}
           similar to uniprot|Q6Q546 Saccharomyces cerevisiae
           YNR032C-A HUB1
          Length = 73

 Score = 32.0 bits (71), Expect = 0.13
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK I ++ E  DT+ + K  +  + GI   +  L   G  L+D  TL DY 
Sbjct: 2   IEVEVNDRLGKKIRVKCEGEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDYE 61

Query: 181 IQKESTLHL 207
           +  ++ L L
Sbjct: 62  VHDQTYLEL 70

>NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON}
           Anc_6.343 YNR032C-A
          Length = 73

 Score = 32.0 bits (71), Expect = 0.13
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK + ++  + DTI + K  +  +    P++  L   G  L+D  TL DY 
Sbjct: 2   IEVLVNDRLGKKLKVKCLTEDTIGDFKKVLSLQLAAQPNKIVLQKGGNVLKDHITLGDYE 61

Query: 181 IQKESTLHL 207
           I   + L L
Sbjct: 62  IHDNTNLEL 70

>KAFR0C04610 Chr3 complement(923893..924114) [222 bp, 73 aa] {ON}
           Anc_6.343 YNR032C-A
          Length = 73

 Score = 31.6 bits (70), Expect = 0.18
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK   ++    DT+ ++K  +  + G  P +  L   G  L+D  TL DY 
Sbjct: 2   IEVIVSDRLGKKTKVKCLEDDTVGDLKKVLSVQIGSLPSKLVLQKGGTVLKDHITLGDYE 61

Query: 181 IQKESTLHL 207
           I   + L L
Sbjct: 62  IHSGTNLEL 70

>SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar to
           uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A HUB1
          Length = 73

 Score = 31.2 bits (69), Expect = 0.25
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           +++ V    GK I ++  S DT+ + K  +  + G    +  L   G  L+D  TL DY 
Sbjct: 2   IEVLVNDRLGKKIRVKCMSEDTVGDFKKVLSLQLGTQHTKIILQKGGSVLKDHITLDDYE 61

Query: 181 IQKESTLHL 207
           +   + L L
Sbjct: 62  VHNGTNLEL 70

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {ON}
           Anc_1.480 YEL037C
          Length = 368

 Score = 32.3 bits (72), Expect = 0.40
 Identities = 15/62 (24%), Positives = 35/62 (56%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           + I  K    + I L+++ S ++ + K ++  K+     Q +LI++GK L+D ++L +  
Sbjct: 2   VSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESG 61

Query: 181 IQ 186
           ++
Sbjct: 62  LK 63

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
           YEL037C
          Length = 369

 Score = 32.0 bits (71), Expect = 0.53
 Identities = 14/56 (25%), Positives = 33/56 (58%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 168
           + I  K    + I+L++ +S T+ + K ++ +++     Q +LI++GK L+D  ++
Sbjct: 2   VSILFKDFKKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSI 57

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
           Anc_1.480 YEL037C
          Length = 375

 Score = 31.6 bits (70), Expect = 0.72
 Identities = 17/72 (23%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +1

Query: 1   MQIFVKTLTGKTITLEVE-SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 177
           +Q+  K       TL+V+   +++ +VK K+        +Q +LIF+GK L+D +  ++ 
Sbjct: 2   VQVVFKDFKKNKETLDVDLEHESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAET 61

Query: 178 NIQKESTLHLVL 213
            +++    H+++
Sbjct: 62  GLKEND--HVIM 71

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 31.6 bits (70), Expect = 0.74
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +1

Query: 7   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 168
           I  K    + + L++  S TI   K  +   +     Q ++IF+GK L+DG TL
Sbjct: 5   IHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTL 58

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {ON}
           similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 30.4 bits (67), Expect = 1.8
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +1

Query: 16  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 168
           K    + + L++  + TI   K  +  ++     Q ++IF+GK L+DG TL
Sbjct: 8   KDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTL 58

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
           YEL037C
          Length = 214

 Score = 29.6 bits (65), Expect = 2.7
 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   MQIFVKT-LTGKTITLEVESSDTIDNVKAKIQDKEGIP--PDQQRLIFAGKQLEDGRTLS 171
           M++++K   T     L    +DT+ ++K  I     +    D+  LI++GK L+D  TL+
Sbjct: 1   MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 172 DYNIQKESTLHLVLRLRGGIIEPSLKAL 255
             +++  + + +++R R   I  + K +
Sbjct: 61  SLHLKDNAQIVMLIRRRPSPISDNDKKI 88

>AEL200C Chr5 complement(259714..260325) [612 bp, 203 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL111C
          Length = 203

 Score = 29.3 bits (64), Expect = 3.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 55  SSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 210
           ++D +  VK ++++ E  +     RL+  GK L DG  LSD    + + + LV
Sbjct: 85  ANDNVSQVKERLREIEPAVSTADLRLLLKGKVLNDGMILSDLKAPEAALMVLV 137

>Kwal_26.8161 s26 (672977..676666) [3690 bp, 1229 aa] {ON} YMR012W
           (CLU1) - translation initiation factor eIF3 subunit
           [contig 55] FULL
          Length = 1229

 Score = 29.3 bits (64), Expect = 5.0
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +1

Query: 160 RTLSDYNIQKESTLHLVLRLRGGIIEPSLKALA-SKYN 270
           RT+ D  + +  T++ VL+ R GII P L+ALA S YN
Sbjct: 157 RTVKD-TLNQGKTVNEVLKTRSGIITPCLRALALSGYN 193

>SAKL0H04378g Chr8 (403363..404370) [1008 bp, 335 aa] {ON} similar
           to uniprot|Q08743 Saccharomyces cerevisiae YOR292C
           Hypothetical ORF
          Length = 335

 Score = 28.9 bits (63), Expect = 5.6
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = -2

Query: 443 IYNTYEITG--IQSLRENQKQISFNSLGRNWLVWPHFLFLQLVAL 315
           +Y+ Y + G    S R+  +++  ++LG N+LVWP   F+  + +
Sbjct: 262 MYSNYIMEGGDADSFRKKIEKVYISTLGCNYLVWPVVQFINFLVM 306

>KLTH0D05698g Chr4 (508215..510326) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P28319 Saccharomyces
           cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to
           a beta-1 3- and beta-1 6-glucan heteropolymer through a
           phosphodiester bond involved in cell wall organization
          Length = 703

 Score = 28.5 bits (62), Expect = 8.5
 Identities = 19/86 (22%), Positives = 39/86 (45%)
 Frame = -2

Query: 284 TDFSQLYLEAKAFKDGSMIPPLNLRTKCRVDSFWIL*SDKVLPSSSCLPAKISLCWSGGI 105
           + FS     +      ++  P  + +   + S   + S   +PSSS +P+   +  S  I
Sbjct: 298 SSFSPSQSSSTVSSSSAVSSPTAIPSSSAIPSSSAIPSSPAIPSSSAIPSSSVISSSSAI 357

Query: 104 PSLSWILALTLSMVSEDSTSNVMVLP 27
           PS S +L+ ++ + S  + S+   +P
Sbjct: 358 PSSSVVLS-SIIVTSSTTASSSSAIP 382

>SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON}
           conserved hypothetical protein
          Length = 747

 Score = 28.5 bits (62), Expect = 8.6
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%)
 Frame = -3

Query: 337 SFYSWW-LLEAIWRNTYGKRTSHSCTWKPKLSKMVQ*-YHLSILGPNAEWTPF 185
           S   WW LL   W+ +    T H       +  M+   YHL+++  N E+ PF
Sbjct: 471 SLSEWWGLLPHYWKWSAANNTLHQTLGTENIFTMINCLYHLNVIYINREFLPF 523

>TPHA0K00840 Chr11 complement(176032..178665) [2634 bp, 877 aa] {ON}
           Anc_7.256 YER070W
          Length = 877

 Score = 28.5 bits (62), Expect = 8.8
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 3/90 (3%)
 Frame = +1

Query: 10  FVKTLTGKTITLEVESSDTIDNVKA---KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 180
           ++   TGK  +L   S D  DNV A   +I        D Q   F  K LE    L  + 
Sbjct: 104 YINPDTGKPASLV--SKDLFDNVMAHKDEINSAIFYDRDFQFNYFGFKTLERSYLLRMFG 161

Query: 181 IQKESTLHLVLRLRGGIIEPSLKALASKYN 270
              E   H+++R+  GI    +K+    YN
Sbjct: 162 KVAERPQHMIMRVSLGIHGSDIKSAIESYN 191

>TBLA0E01280 Chr5 (281380..282081) [702 bp, 233 aa] {ON} Anc_4.139
           YLR323C
          Length = 233

 Score = 28.1 bits (61), Expect = 9.3
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +1

Query: 229 IIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 360
           I    LK    K NC+   C  C+ +   ++TNC  + CG   Q
Sbjct: 182 ICNRELKKPIIKTNCDHYFCNDCFVKSIIKSTNC--KVCGKDTQ 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,550,052
Number of extensions: 1089416
Number of successful extensions: 3315
Number of sequences better than 10.0: 155
Number of HSP's gapped: 3311
Number of HSP's successfully gapped: 222
Length of query: 150
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 50
Effective length of database: 42,014,799
Effective search space: 2100739950
Effective search space used: 2100739950
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)