Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0C065805.701ON1491497861e-109
AFR285C5.701ON1281256502e-88
KNAG0L021205.701ON1281256502e-88
KLLA0A00616g5.701ON1281256468e-88
TPHA0E002405.701ON1281256468e-88
TPHA0D046005.701ON1281256468e-88
TBLA0E021105.701ON1281256468e-88
CAGL0G02475g5.701ON1281256468e-88
Ecym_40195.701ON1281256468e-88
Kpol_1043.695.701ON1281256441e-87
SAKL0E14894g5.701ON1281256442e-87
Kwal_YGOB_Anc_5.7015.701ON1281256432e-87
ZYRO0G06622g5.701ON1281256423e-87
KAFR0D022305.701ON1281256423e-87
KAFR0H002205.701ON1281256423e-87
Suva_11.3305.701ON1281256423e-87
Skud_11.3335.701ON1281256423e-87
YIL148W (RPL40A)5.701ON1281256423e-87
YKR094C (RPL40B)5.701ON1281256423e-87
TDEL0B022005.701ON1281256414e-87
KLTH0E01078g5.701ON1281256406e-87
NDAI0E050305.701ON1281256372e-86
NCAS0A032105.701ON1281256372e-86
NCAS0G002405.701ON1281256372e-86
Suva_9.405.701ON1441226288e-85
Skud_9.205.701ON1251226251e-84
Smik_11.3575.701ON1251226251e-84
Smik_9.215.701ON1241216181e-83
NDAI0F003005.701ON1871226223e-83
NDAI0H002704.16ON77773944e-50
TDEL0G017504.16ON77763884e-49
Ecym_84084.16ON153773945e-49
Kpol_1024.168.386ON152763945e-49
Kpol_1030.58.386ON152763935e-49
KNAG0J028804.16ON153773936e-49
Suva_10.34singletonON151773936e-49
KNAG0A027308.386ON150763927e-49
TPHA0K022504.16ON153773929e-49
AGL128W8.386ON152763911e-48
KAFR0H020008.386ON152763911e-48
NCAS0C029408.386ON152763901e-48
TDEL0F051008.386ON150763902e-48
NDAI0G022808.386ON152763902e-48
Kwal_23.33118.386ON150763892e-48
Suva_10.2668.386ON152763902e-48
Skud_12.2348.386ON152763902e-48
Smik_12.2298.386ON152763902e-48
YLR167W (RPS31)8.386ON152763902e-48
CAGL0G08173g8.386ON152763892e-48
TBLA0H031808.386ON152763892e-48
ZYRO0C04026g8.386ON152763892e-48
KLTH0F08734g8.386ON150763892e-48
TPHA0C023908.386ON150763893e-48
SAKL0H13926g8.386ON154763893e-48
Ecym_41818.386ON152763884e-48
TBLA0G006704.16ON229773944e-48
NDAI0D049304.16ON229773944e-48
KAFR0I014704.16ON229773944e-48
Kwal_55.206074.16ON231773944e-48
KLLA0D18304g8.386ON150763866e-48
Suva_10.33singletonON254773948e-48
SAKL0H25784g4.16ON305773943e-47
KLLA0E00749g4.16ON381773986e-47
Suva_10.304.16ON381773952e-46
Skud_12.294.16ON381773952e-46
YLL039C (UBI4)4.16ON381773952e-46
NCAS0C058504.16ON388773952e-46
ACL062C4.16ON382773952e-46
Smik_12.184.16ON460893965e-46
ZYRO0G07854g4.16ON460773956e-46
KLTH0E05852g4.16ON409773919e-46
Kpol_1070.64.16ON533773952e-45
CAGL0D05082g4.16ON533773952e-45
Suva_10.32singletonON62623111e-37
Suva_10.31singletonON64502511e-28
KLLA0F17974g8.311ON77762225e-24
TPHA0C008908.311ON77762148e-23
YDR139C (RUB1)8.311ON77762043e-21
SAKL0H15818g8.311ON77772043e-21
Kpol_1036.628.311ON77762018e-21
NCAS0B035208.311ON77762001e-20
KLTH0G12540g8.311ON77771982e-20
ZYRO0D05962g8.311ON77761941e-19
NDAI0J010708.311ON77761941e-19
TDEL0F043808.311ON77761904e-19
CAGL0B01589g8.311ON77761827e-18
Smik_4.3838.311ON1001001691e-15
Skud_4.3988.311ON94931645e-15
Suva_2.3008.311ON86541565e-14
KAFR0B056708.311ON57501461e-12
Ecym_42448.311ON50501423e-12
Kwal_56.238838.311ON52501415e-12
TBLA0H013108.311ON71501364e-11
AGL185W8.311ON50501338e-11
KLLA0D01859g8.837ON371701281e-08
TBLA0D032308.837ON375711174e-07
TBLA0B032408.837ON284491085e-06
TPHA0I002208.837ON377711087e-06
KLTH0C03938g8.837ON3761271079e-06
CAGL0M02937g8.837ON373561061e-05
Suva_13.4648.837ON366711052e-05
SAKL0D01540g8.837ON365561024e-05
ZYRO0G14124g8.837ON369581015e-05
Smik_13.4898.837ON372561015e-05
Kpol_1068.118.837ON381541007e-05
ABL129W8.837ON345711007e-05
Kwal_27.102758.837ON379711008e-05
YMR276W (DSK2)8.837ON37356991e-04
TDEL0B006008.837ON369107982e-04
Ecym_46088.837ON40656972e-04
KNAG0J002908.837ON36749962e-04
KAFR0B039008.837ON37951953e-04
NDAI0K004408.837ON40456936e-04
Skud_13.4488.837ON36449890.002
Kwal_27.101521.480ON38162880.003
KLTH0C03410g1.480ON39161870.003
NCAS0C004308.837ON369122860.005
KAFR0E005301.480ON37957850.007
KNAG0I009508.311ON110109800.010
CAGL0L01309g1.480ON392106770.085
NCAS0G041201.480ON39258760.11
NDAI0G003301.480ON42758740.20
CAGL0M10912g6.343ON7369680.30
NCAS0A053906.343ON7369680.31
SAKL0D11814g1.480ON40056720.32
Suva_14.3876.343ON7369670.37
Skud_14.3646.343ON7369670.37
Ecym_25016.343ON7369660.63
KLTH0A06820g6.343ON7369660.68
ZYRO0D08140g6.343ON7369650.70
Suva_5.321.480ON40953690.78
Kwal_23.63386.343ON7369650.80
NDAI0K022306.343ON7369650.83
Smik_5.561.480ON39753690.90
KNAG0D003706.343ON7369641.0
Smik_14.3626.343ON7369641.2
ZYRO0F05192g1.480ON38462681.2
TDEL0A075806.343ON7369631.4
Skud_5.531.480ON39753662.1
YNR032C-A (HUB1)6.343ON7369622.2
Kpol_1051.255.267ON196853653.0
TBLA0B021601.480ON40456644.0
KAFR0C046106.343ON7369604.5
Kwal_26.81612.559ON122938635.2
SAKL0A01210g6.343ON7369595.8
YEL037C (RAD23)1.480ON39846627.8
KLLA0E22133g1.480ON38363618.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0C06580
         (149 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...   307   e-109
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...   254   2e-88
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...   254   2e-88
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...   253   8e-88
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...   253   8e-88
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...   253   8e-88
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...   253   8e-88
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...   253   8e-88
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...   253   8e-88
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...   252   1e-87
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...   252   2e-87
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...   252   2e-87
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...   251   3e-87
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...   251   3e-87
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...   251   3e-87
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...   251   3e-87
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...   251   3e-87
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...   251   3e-87
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...   251   3e-87
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...   251   4e-87
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...   251   6e-87
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...   249   2e-86
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...   249   2e-86
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...   249   2e-86
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)    246   8e-85
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)    245   1e-84
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...   245   1e-84
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)    242   1e-83
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701       244   3e-83
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...   156   4e-50
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...   154   4e-49
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...   156   5e-49
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...   156   5e-49
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...   155   5e-49
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...   155   6e-49
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...   155   6e-49
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...   155   7e-49
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...   155   9e-49
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...   155   1e-48
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...   155   1e-48
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...   154   1e-48
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...   154   2e-48
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...   154   2e-48
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...   154   2e-48
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...   154   2e-48
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...   154   2e-48
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...   154   2e-48
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...   154   2e-48
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...   154   2e-48
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...   154   2e-48
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...   154   2e-48
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...   154   2e-48
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...   154   3e-48
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...   154   3e-48
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...   154   4e-48
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...   156   4e-48
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}             156   4e-48
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...   156   4e-48
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...   156   4e-48
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...   153   6e-48
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...   156   8e-48
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...   156   3e-47
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...   157   6e-47
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...   156   2e-46
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...   156   2e-46
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...   156   2e-46
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}            156   2e-46
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...   156   2e-46
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...   157   5e-46
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...   156   6e-46
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...   155   9e-46
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...   156   2e-45
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...   156   2e-45
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...   124   1e-37
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...   101   1e-28
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    90   5e-24
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    87   8e-23
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    83   3e-21
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    83   3e-21
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    82   8e-21
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    82   1e-20
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    81   2e-20
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    79   1e-19
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    79   1e-19
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    78   4e-19
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    75   7e-18
Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 b...    70   1e-15
Skud_4.398 Chr4 complement(705294..705386,705390..705431,705435....    68   5e-15
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    65   5e-14
KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694) [...    61   1e-12
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    59   3e-12
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    59   5e-12
TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311...    57   4e-11
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    56   8e-11
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...    54   1e-08
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...    50   4e-07
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    46   5e-06
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...    46   7e-06
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...    46   9e-06
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...    45   1e-05
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...    45   2e-05
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...    44   4e-05
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...    44   5e-05
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...    44   5e-05
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...    43   7e-05
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...    43   7e-05
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...    43   8e-05
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...    43   1e-04
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...    42   2e-04
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...    42   2e-04
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...    42   2e-04
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...    41   3e-04
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...    40   6e-04
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...    39   0.002
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    39   0.003
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    38   0.003
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...    38   0.005
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    37   0.007
KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.31...    35   0.010
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    34   0.085
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    34   0.11 
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    33   0.20 
CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa] ...    31   0.30 
NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa] {O...    31   0.31 
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    32   0.32 
Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON...    30   0.37 
Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON...    30   0.37 
Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON} s...    30   0.63 
KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON...    30   0.68 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    30   0.70 
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    31   0.78 
Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa] {O...    30   0.80 
NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON...    30   0.83 
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    31   0.90 
KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343 Y...    29   1.0  
Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON...    29   1.2  
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    31   1.2  
TDEL0A07580 Chr1 complement(1322688..1322909) [222 bp, 73 aa] {O...    29   1.4  
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    30   2.1  
YNR032C-A Chr14 complement(687243..687464) [222 bp, 73 aa] {ON} ...    28   2.2  
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    30   3.0  
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    29   4.0  
KAFR0C04610 Chr3 complement(923893..924114) [222 bp, 73 aa] {ON}...    28   4.5  
Kwal_26.8161 s26 (672977..676666) [3690 bp, 1229 aa] {ON} YMR012...    29   5.2  
SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar ...    27   5.8  
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    28   7.8  
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    28   8.3  

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [450
           bp, 149 aa] {ON} 
          Length = 149

 Score =  307 bits (786), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRELKLICFWFSRRLCIPVISYVLYIC 149
           LRPRELKLICFWFSRRLCIPVISYVLYIC
Sbjct: 121 LRPRELKLICFWFSRRLCIPVISYVLYIC 149

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, 128
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YKR094C (RPL40B) and YIL148W (RPL40A); 1-intron
          Length = 128

 Score =  254 bits (650), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
           bp, 128 aa] {ON} 
          Length = 128

 Score =  254 bits (650), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YKR094C RPL40B Fusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {ON}
           Anc_5.701 YIL148W
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [387
           bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 bp,
           128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
           bp, 128 aa] {ON} highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
           similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 122/125 (97%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {ON}
           complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score =  252 bits (644), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKS+CRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
           [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
           Saccharomyces cerevisiae YLR167W RPS31 and highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YIL148W and highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094C and highly similar to
           uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
           proteins that are cleaved to yield a ribosomal protein
           of the small (40S) subunit and ubiquitin
          Length = 128

 Score =  252 bits (644), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEK+VCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
           aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score =  252 bits (643), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASK+NCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P14796 Saccharomyces
           cerevisiae YKR094C RPL40B
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCR+CYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
           {ON} Anc_5.701 YIL148W
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {ON} 
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
           RPL40AFusion protein, identical to Rpl40Bp, that is
           cleaved to yield ubiquitin and a ribosomal protein of
           the large (60S) ribosomal subunit with similarity to rat
           L40; ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
           128 aa] {ON}  RPL40BFusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score =  251 bits (642), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
           {ON} 
          Length = 128

 Score =  251 bits (641), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 121/125 (96%), Positives = 124/125 (99%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLK LASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P61864 Saccharomyces
           cerevisiae YKR094c RPL40B and highly similar to
           uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score =  251 bits (640), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 125/125 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLKALASK+NCEKSVCRKCYARLPP+ATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [387
           bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score =  249 bits (637), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 124/125 (99%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
           {ON} Anc_5.701
          Length = 128

 Score =  249 bits (637), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 124/125 (99%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {ON}
           Anc_5.701
          Length = 128

 Score =  249 bits (637), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 124/125 (99%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61  IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
           IQKESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQ
Sbjct: 61  IQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ 120

Query: 121 LRPRE 125
           LRP++
Sbjct: 121 LRPKK 125

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)
          Length = 144

 Score =  246 bits (628), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 118/122 (96%), Positives = 122/122 (100%)

Query: 4   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 20  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 79

Query: 64  ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 123
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 80  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 139

Query: 124 RE 125
           ++
Sbjct: 140 KK 141

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)
          Length = 125

 Score =  245 bits (625), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 118/122 (96%), Positives = 122/122 (100%)

Query: 4   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 1   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 60

Query: 64  ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 123
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 61  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 120

Query: 124 RE 125
           ++
Sbjct: 121 KK 122

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {ON}
           YKR094C (REAL)
          Length = 125

 Score =  245 bits (625), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 118/122 (96%), Positives = 122/122 (100%)

Query: 4   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 1   FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 60

Query: 64  ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 123
           ESTLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 61  ESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 120

Query: 124 RE 125
           ++
Sbjct: 121 KK 122

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)
          Length = 124

 Score =  242 bits (618), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 117/121 (96%), Positives = 121/121 (100%)

Query: 5   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
           VKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE
Sbjct: 1   VKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 60

Query: 65  STLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRPR 124
           STLHLVLRLRGGIIEPSLKALASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP+
Sbjct: 61  STLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPK 120

Query: 125 E 125
           +
Sbjct: 121 K 121

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score =  244 bits (622), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 117/122 (95%), Positives = 121/122 (99%)

Query: 4   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63
           FVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 63  FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 122

Query: 64  ESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 123
           ESTLHLVLRLRGGIIEPSLK LASKYNC+KSVCRKCYARLPPRATNCRKRKCGHTNQLRP
Sbjct: 123 ESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRP 182

Query: 124 RE 125
           ++
Sbjct: 183 KK 184

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score =  156 bits (394), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGV 77

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score =  154 bits (388), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score =  156 bits (394), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  155 bits (392), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score =  156 bits (394), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score =  155 bits (393), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score =  155 bits (393), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  155 bits (392), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score =  155 bits (393), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  144 bits (363), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 70/71 (98%), Positives = 71/71 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVL 71
           IQKESTLHLVL
Sbjct: 137 IQKESTLHLVL 147

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score =  155 bits (392), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score =  155 bits (392), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 137 IQKESTLHLVLRLRGG 152

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score =  155 bits (391), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score =  155 bits (391), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score =  154 bits (390), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score =  154 bits (390), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score =  154 bits (389), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score =  154 bits (389), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score =  154 bits (388), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  155 bits (393), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 213 IQKESTLHLVLRLRGG 228

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score =  153 bits (386), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGG 76
          IQKESTLHLVLRLRGG
Sbjct: 61 IQKESTLHLVLRLRGG 76

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score =  156 bits (394), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (394), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSD 21
           MQIFVKTLTGKTITLEVESSD
Sbjct: 229 MQIFVKTLTGKTITLEVESSD 249

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  155 bits (393), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 289 IQKESTLHLVLRLRGG 304

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score =  157 bits (398), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 76/77 (98%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGGI
Sbjct: 365 IQKESTLHLVLRLRGGI 381

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  152 bits (384), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 75/76 (98%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFA KQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  155 bits (393), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  155 bits (393), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 365 IQKESTLHLVLRLRGG 380

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  155 bits (393), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/78 (96%), Positives = 77/78 (98%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGII 78
           IQKESTLHLVLRLRGG +
Sbjct: 365 IQKESTLHLVLRLRGGAL 382

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score =  157 bits (396), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/89 (87%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLR-GGIIEPSLKALASK 88
           IQKESTLHLVLRLR GG+++  +K L  K
Sbjct: 137 IQKESTLHLVLRLRGGGVMQIFVKTLTGK 165

 Score =  157 bits (396), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/89 (87%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 231 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 290

Query: 61  IQKESTLHLVLRLR-GGIIEPSLKALASK 88
           IQKESTLHLVLRLR GG+++  +K L  K
Sbjct: 291 IQKESTLHLVLRLRGGGVMQIFVKTLTGK 319

 Score =  156 bits (395), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 155 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 214

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 215 IQKESTLHLVLRLRGGM 231

 Score =  156 bits (395), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 309 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 368

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 369 IQKESTLHLVLRLRGGM 385

 Score =  155 bits (393), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 385 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 444

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 445 IQKESTLHLVLRLRGG 460

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score =  156 bits (395), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  156 bits (395), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  156 bits (394), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 441 IQKESTLHLVLRLRGG 456

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score =  155 bits (391), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 105 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 164

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 165 IQKESTLHLVLRLRGGM 181

 Score =  155 bits (391), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 181 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 240

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 241 IQKESTLHLVLRLRGGM 257

 Score =  155 bits (391), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 257 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 316

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 317 IQKESTLHLVLRLRGGM 333

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 333 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 392

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 393 IQKESTLHLVLRLRGG 408

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 441 IQKESTLHLVLRLRGGM 457

 Score =  155 bits (393), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 517 IQKESTLHLVLRLRGG 532

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          IQKESTLHLVLRLRGG+
Sbjct: 61 IQKESTLHLVLRLRGGM 77

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 137 IQKESTLHLVLRLRGGM 153

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 213 IQKESTLHLVLRLRGGM 229

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 289 IQKESTLHLVLRLRGGM 305

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 365 IQKESTLHLVLRLRGGM 381

 Score =  156 bits (395), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 61  IQKESTLHLVLRLRGGI 77
           IQKESTLHLVLRLRGG+
Sbjct: 441 IQKESTLHLVLRLRGGM 457

 Score =  155 bits (393), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
           MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 61  IQKESTLHLVLRLRGG 76
           IQKESTLHLVLRLRGG
Sbjct: 517 IQKESTLHLVLRLRGG 532

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score =  124 bits (311), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 60/62 (96%), Positives = 61/62 (98%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 74
          LEVE SDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 60

Query: 75 GG 76
          GG
Sbjct: 61 GG 62

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score =  101 bits (251), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 50/50 (100%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQL
Sbjct: 1  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL 50

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 90.1 bits (222), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 60/76 (78%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQ+ VKTLTGK I+++V+SS+T+ ++K  +++KEGIPP QQ+LIF GKQ++D  T+   +
Sbjct: 1  MQLKVKTLTGKEISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSAD 60

Query: 61 IQKESTLHLVLRLRGG 76
          +Q  S LHLVL LRGG
Sbjct: 61 LQDGSLLHLVLTLRGG 76

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 87.0 bits (214), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 56/76 (73%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          MQI VKTLTGK I +EV+ SD + ++K  +++KEGIPP QQRLIF GKQ++D +T+   N
Sbjct: 1  MQIKVKTLTGKEIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESAN 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LIDGMQLHLVLTLRGG 76

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 83.2 bits (204), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 58/76 (76%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ++D  T++D +
Sbjct: 1  MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH 60

Query: 61 IQKESTLHLVLRLRGG 76
          + +   LHLVL LRGG
Sbjct: 61 LVEGMQLHLVLTLRGG 76

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 83.2 bits (204), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 54/77 (70%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M++ VKTLTGK I + +ES + +  +K  +++KEGIPP QQRLIF GKQ+ED +T+   N
Sbjct: 1  MELKVKTLTGKEIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSAN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          +     LHLVL LRGG 
Sbjct: 61 LSSGMQLHLVLTLRGGF 77

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 82.0 bits (201), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ++D +T+    
Sbjct: 1  MYVKVKTLTGKEISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAK 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LTDGMQLHLVLTLRGG 76

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 81.6 bits (200), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 55/76 (72%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I VKTLTGK I ++++ +D +  +K  +++KEGIPP QQRLIF GKQ++D +T+S  N
Sbjct: 1  MIIKVKTLTGKEIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSAN 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LIDGMQLHLVLTLRGG 76

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 80.9 bits (198), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 54/77 (70%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M++ VKTLTGK I + V+  D +  +K  +++KEGIPP QQRLIF GKQ++D +++S  N
Sbjct: 1  MKLTVKTLTGKEIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSAN 60

Query: 61 IQKESTLHLVLRLRGGI 77
          +     LHLVL LRGG 
Sbjct: 61 LSSGMQLHLVLTLRGGF 77

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 79.3 bits (194), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 52/76 (68%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I VKTLTGK I +E+   D I  +K  +++KEGIPP QQRLIF GKQ++D +T+S   
Sbjct: 1  MIIKVKTLTGKEIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAK 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LVDGMQLHLVLTLRGG 76

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 79.3 bits (194), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I VKTLTGK I +E+  ++ +  +K  +++KEGIPP QQRLIF GKQ++D +++S  N
Sbjct: 1  MIIKVKTLTGKEIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSAN 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LVDGMQLHLVLTLRGG 76

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 77.8 bits (190), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 52/76 (68%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I VKTLTGK I +E++S   I  +K  +++KEGIPP QQRLIF GKQ++D +TL    
Sbjct: 1  MIIKVKTLTGKEIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAK 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LVDGMVLHLVLTLRGG 76

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 74.7 bits (182), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (65%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I VKTLTGK I +EV   D + ++K  +++KEGIP  QQRLIF GKQ+ +  T+S   
Sbjct: 1  MIIKVKTLTGKEIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAK 60

Query: 61 IQKESTLHLVLRLRGG 76
          +     LHLVL LRGG
Sbjct: 61 LSDGMQLHLVLTLRGG 76

>Smik_4.383 Chr4 complement(694349..694483,694487..694651) [300 bp,
           100 aa] {ON} YDR139C (REAL)
          Length = 100

 Score = 69.7 bits (169), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 24/100 (24%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL---------- 50
           M + VKTLTGK I++E+  SD + ++K  +++KEGIPP QQRLIF GKQ+          
Sbjct: 1   MIVKVKTLTGKEISVELRESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKFTSSIVS 60

Query: 51  --------------EDGRTLSDYNIQKESTLHLVLRLRGG 76
                         +D  T++D ++ +   LHLVL LRGG
Sbjct: 61  KFSTFSDLTNDQDSDDKLTVTDAHLVEGMQLHLVLTLRGG 100

>Skud_4.398 Chr4
          complement(705294..705386,705390..705431,
          705435..705581) [282 bp, 94 aa] {ON} YDR139C (REAL)
          Length = 94

 Score = 67.8 bits (164), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 54/93 (58%), Gaps = 23/93 (24%)

Query: 7  TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL---------------- 50
          TLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ+                
Sbjct: 1  TLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQMYVKLAWLITFQACLYL 60

Query: 51 -------EDGRTLSDYNIQKESTLHLVLRLRGG 76
                 +D  T++D ++ +   LHLVL LRGG
Sbjct: 61 RFYRLRSDDKLTVTDAHLVEGMQLHLVLTLRGG 93

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 64.7 bits (156), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 42/54 (77%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR 54
          M + VKTLTGK I++E++ SD + ++K  +++KEGIPP QQRLIF GKQ+ D +
Sbjct: 1  MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVDAK 54

>KAFR0B05670 Chr2 complement(1169417..1169441,1169546..1169694)
          [174 bp, 57 aa] {ON} Anc_8.311 YDR139C
          Length = 57

 Score = 60.8 bits (146), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          M I VKTLTGK I +E++ +D I ++K  +++KEGIPP QQRLIF GKQ+
Sbjct: 1  MFIKVKTLTGKEIAVELDENDRIYHIKELLEEKEGIPPSQQRLIFQGKQI 50

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          M + VKTLTGK I ++VE  D + ++K  +++KEGIPP QQRLIF GKQ+
Sbjct: 1  MLLKVKTLTGKEIPIDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGKQM 50

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 58.9 bits (141), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          M++ VKTLTGK I + V+ SD +  +K  +++KEGIPP QQ+LIF GKQ+
Sbjct: 1  MKLTVKTLTGKEIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGKQM 50

>TBLA0H01310 Chr8 (293921..294136) [216 bp, 71 aa] {ON} Anc_8.311
          YDR139C
          Length = 71

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          M I VKTLTGK I +EV   D + ++K  ++ KEGIPP Q RLIF GKQ+
Sbjct: 1  MFIKVKTLTGKEIPIEVLPEDKVFHIKELLEQKEGIPPSQLRLIFQGKQM 50

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 55.8 bits (133), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 50
          M + VKTLTGK I ++V   D +  +K  ++++EGIPP QQRLIF GKQ+
Sbjct: 1  MLLKVKTLTGKEIQIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGKQM 50

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
          to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
          Nuclear-enriched ubiquitin-like polyubiquitin- binding
          protein required for spindle pole body (SPB)
          duplication and for transit through the G2/M phase of
          the cell cycle involved in proteolysis interacts with
          the proteasome
          Length = 371

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 2  QIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          QI V   +G+   T+E+ES+ TI   K  I    G+P D QRLI++GK L+D  T+  Y 
Sbjct: 3  QISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYK 62

Query: 61 IQKESTLHLV 70
          IQ   ++H+V
Sbjct: 63 IQDGHSVHMV 72

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa]
          {ON} Anc_8.837 YMR276W
          Length = 375

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 60 NIQKESTLHLV 70
           IQ   ++H+V
Sbjct: 61 KIQDGHSIHMV 71

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
          YMR276W
          Length = 284

 Score = 46.2 bits (108), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
          YMR276W
          Length = 377

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
          M I V+  +G+    + VE S+TI   K  I     IP   QRLI++GK L+D  T+  Y
Sbjct: 1  MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 60 NIQKESTLHLV 70
           IQ   ++HLV
Sbjct: 61 KIQDGHSIHLV 71

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 55/127 (43%), Gaps = 8/127 (6%)

Query: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
           M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 60  NIQKESTLHLVLRLRGG---IIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCG 116
            I  + ++HLV    GG      P   A AS             A+  P+ +       G
Sbjct: 61  KILDDHSVHLV--KSGGSKKATSPGATAAASGDATATGATSTPAAQ--PQQSAPANLSTG 116

Query: 117 HTNQLRP 123
             N   P
Sbjct: 117 QGNGFNP 123

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
          similar to uniprot|P48510 Saccharomyces cerevisiae
          YMR276w DSK2
          Length = 373

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          + ++ S TI N+K +I     IP   QRLI++GK L+D +T+  YNI+ +  +H+V
Sbjct: 16 VSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYNIKDDHAIHMV 71

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
          (REAL)
          Length = 366

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
          + ++VK+   K  +++  ES  T+   K  I +  GIP   QRLI++GK L+D +T+  Y
Sbjct: 3  LNVYVKSGQDKWEVSVAPES--TVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 60 NIQKESTLHLV 70
          +IQ   ++HLV
Sbjct: 61 HIQDGHSVHLV 71

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa]
          {ON} similar to uniprot|P48510 Saccharomyces cerevisiae
          YMR276W DSK2 Nuclear-enriched ubiquitin-like
          polyubiquitin- binding protein required for spindle
          pole body (SPB) duplication and for transit through the
          G2/M phase of the cell cycle involved in proteolysis
          interacts with the proteasome
          Length = 365

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          + +E ++T+  +K  I     IPP  QRLI++GK L+D +T+  Y I  +  +HLV
Sbjct: 16 VSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKIADDHAVHLV 71

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON}
          similar to uniprot|P48510 Saccharomyces cerevisiae
          YMR276W DSK2 Nuclear-enriched ubiquitin-like
          polyubiquitin- binding protein required for spindle
          pole body (SPB) duplication and for transit through the
          G2/M phase of the cell cycle involved in proteolysis
          interacts with the proteasome
          Length = 369

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          +T++ ES  T+   K +I     IP   QRLI++GK L+D +TL  YN+Q   ++HLV
Sbjct: 17 VTVDPES--TVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNLQDGHSVHLV 72

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
          (REAL)
          Length = 372

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          + V    T+   K  I    G+P   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 16 VSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa]
          {ON} complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 60 NIQKESTLHLV 70
           I     +HLV
Sbjct: 61 KIADGHAIHLV 71

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa]
          {ON} YMR276W (DSK2) - ubiquitin-like protein [contig
          37] FULL
          Length = 379

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
          M I V   +G++   + V++  T+   K  I +   I P+ QRLI++GK L+D +TL  Y
Sbjct: 1  MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 60 NIQKESTLHLV 70
           I     +HLV
Sbjct: 61 KILDGHAVHLV 71

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
          DSK2Nuclear-enriched ubiquitin-like
          polyubiquitin-binding protein, required for spindle
          pole body (SPB) duplication and for transit through the
          G2/M phase of the cell cycle, involved in proteolysis,
          interacts with the proteasome
          Length = 373

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          + V    T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 16 VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 15  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 74
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75

Query: 75  GGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL 121
           GG    +  A AS  + E +      A +P   +N    + G  N L
Sbjct: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar
          to Ashbya gossypii ABL129W
          Length = 406

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
          Anc_8.837 YMR276W
          Length = 367

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON}
          Anc_8.837 YMR276W
          Length = 379

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa]
          {ON} Anc_8.837 YMR276W
          Length = 404

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
          (REAL)
          Length = 364

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
          T+   K  I     IP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 23 TVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHIQDGHSVHLV 71

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          ++I  K    + + LE+E S T++  K K+ + +     Q +LI++GK L+D RT+ DY 
Sbjct: 2  VKINFKDFKKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYK 61

Query: 61 IQ 62
          ++
Sbjct: 62 LK 63

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 36/61 (59%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          ++I  K    + + LE++S  TI   K ++ + +     Q +LI++GK L+D RT++DY 
Sbjct: 2  VKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYK 61

Query: 61 I 61
          +
Sbjct: 62 L 62

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MQIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108

Query: 120 QL 121
            L
Sbjct: 109 PL 110

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS 57
          M I  K    + I +E+ESS TI + K K+   +    DQ +LIF+GK L+D +T+S
Sbjct: 1  MNIIFKDFKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVS 57

>KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.311
           YDR139C
          Length = 110

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 33/109 (30%)

Query: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE---------GIPPDQQ---------- 41
           M + VKTLTGK I +E+E+SD +  VK  +++K           IP +            
Sbjct: 1   MIVKVKTLTGKEIPVELEASDKVYRVKELLEEKRRDPTIAAETDIPGETNVCVKWVPVGL 60

Query: 42  -----------RLIFAGKQL---EDGRTLSDYNIQKESTLHLVLRLRGG 76
                      R+ +  K +   +D +T+S   +     LHLVL LRGG
Sbjct: 61  TCLTRSLFFLLRISYTNKLISHSDDEQTISSAKLVDGMQLHLVLTLRGG 109

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
           {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 10/106 (9%)

Query: 15  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 74
           L++ESS +I  VK  + +K    P Q +LIF+GK L+DG ++   N +  + +  ++  +
Sbjct: 16  LDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIFMVSAK 75

Query: 75  GGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ 120
                   KA A+K   E S  +      P  +T     +   TNQ
Sbjct: 76  --------KATATKV-TESSAPKAQSEETPSESTPATSTQP-ETNQ 111

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          + I  K    + I L +ES++T+ + K ++   +     Q +LI++GK L+D +TL D
Sbjct: 2  INITFKDFKKEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLED 59

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 36/58 (62%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          + +  K    + I L++E S+TI +VK+++   +     Q ++I++GK L+DG+T+ +
Sbjct: 2  VNVIFKDFKKEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEE 59

>CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa]
          {ON} highly similar to uniprot|Q6Q546 Saccharomyces
          cerevisiae YNR032ca HUB1
          Length = 73

 Score = 30.8 bits (68), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++    DT+ + K  +  + G+ P +  L   G  L+D  TL DY 
Sbjct: 2  IEVLVNDRLGKKIRVKCLEDDTVGDFKKVLSVQLGMQPSKIVLQKGGSVLKDHITLYDYE 61

Query: 61 IQKESTLHL 69
          +   + L L
Sbjct: 62 VHDNTNLEL 70

>NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.8 bits (68), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++    D++ + K  +  + G  P++  L   G  L+D  TL DY 
Sbjct: 2  IEVLVNDRLGKKIKVKCLGEDSVGDFKKVLSIQLGTQPNKIVLQKGGNVLKDHITLEDYE 61

Query: 61 IQKESTLHL 69
          I   + L L
Sbjct: 62 IHDNTNLEL 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 32.3 bits (72), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 3  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          I  K    + + LE++ + T+   K ++   +    DQ +LIF+GK L+DG+TL +
Sbjct: 4  INFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEE 59

>Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 30.4 bits (67), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2  IEVVVNDRLGKRVKVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 61 IQKESTLHL 69
          +  E+ L L
Sbjct: 62 VHDETNLEL 70

>Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 30.4 bits (67), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2  IEVVVNDRLGKKVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 61 IQKESTLHL 69
          +  E+ L L
Sbjct: 62 VHDETNLEL 70

>Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON}
          similar to Ashbya gossypii AER266C
          Length = 73

 Score = 30.0 bits (66), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK +T++   +DTI + K  +  + G   ++  L   G  L+D  TL DY 
Sbjct: 2  IEVIVNDRLGKKVTIKCLPTDTIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDYE 61

Query: 61 IQKESTLHL 69
          I   + L L
Sbjct: 62 IHDGTNLEL 70

>KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON}
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1
          Length = 73

 Score = 30.0 bits (66), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++ E  DT+ + K  +  + GI   +  L   G  L+D  TL DY 
Sbjct: 2  IEVEVNDRLGKKIRVKCEGEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDYE 61

Query: 61 IQKESTLHL 69
          +  ++ L L
Sbjct: 62 VHDQTYLEL 70

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 29.6 bits (65), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++    D + + K  +  + G P  + +L+  G  L+D  +L DY 
Sbjct: 2  IEVVVNDRLGKKIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYE 61

Query: 61 IQKESTLHL 69
          I   + L L
Sbjct: 62 IHDNTFLEL 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 31.2 bits (69), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 6  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          K    + + L++E S+TI   K K+         Q +LI++GK L+D +T+S+
Sbjct: 7  KNFKKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSE 59

>Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa]
          {ON} YNR032C-A (HUB1) - ubiquitin-like modifier [contig
          17] FULL
          Length = 73

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++ E+ DT+ + K  +  + GI   +  L   G  L+D  +L DY 
Sbjct: 2  IEVEVNDRLGKKIRVKCEAEDTVGDFKKVLALQMGISWTKIILQKGGSTLKDHISLDDYE 61

Query: 61 IQKESTLHL 69
          +  ++ L L
Sbjct: 62 VHDQTYLEL 70

>NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON}
          Anc_6.343 YNR032C-A
          Length = 73

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++  + DTI + K  +  +    P++  L   G  L+D  TL DY 
Sbjct: 2  IEVLVNDRLGKKLKVKCLTEDTIGDFKKVLSLQLAAQPNKIVLQKGGNVLKDHITLGDYE 61

Query: 61 IQKESTLHL 69
          I   + L L
Sbjct: 62 IHDNTNLEL 70

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 31.2 bits (69), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 6  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          K    + + L++E S+TI  VK+K+         Q +LI++GK L+D +T+S+
Sbjct: 7  KNFKKEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSE 59

>KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343
          YNR032C-A
          Length = 73

 Score = 29.3 bits (64), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++    D++ + K  +  + G+ P +  L   G  L+D  TL DY 
Sbjct: 2  LEVLVNDRLGKKLRVKCLEEDSVGDFKKVVAVQLGVMPGKIVLQKGGVVLKDHITLMDYE 61

Query: 61 IQKESTLHL 69
          + + + L L
Sbjct: 62 VHEGTNLEL 70

>Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++    DT+ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2  IEVVVNDRLGKKVRVKCLGEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 61 IQKESTLHL 69
          +  ++ L L
Sbjct: 62 VHDQTNLEL 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 35/62 (56%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          + I  K    + I+LE++ S ++ + K ++  ++     Q +LI++GK L+D + L +  
Sbjct: 2  INIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESG 61

Query: 61 IQ 62
          ++
Sbjct: 62 LK 63

>TDEL0A07580 Chr1 complement(1322688..1322909) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 34/69 (49%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++    D++ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2  IEVLVNDRLGKKLRVKCLEDDSVGDFKKVLSVQLGCQPNKIVLQKGGSVLKDHISLGDYE 61

Query: 61 IQKESTLHL 69
          +  ++ L L
Sbjct: 62 VHNDTNLEL 70

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 6  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          K    + + L++E S+TI   K K+         Q +LI++GK L+D +T+S+
Sbjct: 7  KNFKKEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSE 59

>YNR032C-A Chr14 complement(687243..687464) [222 bp, 73 aa] {ON}
          HUB1Ubiquitin-like protein modifier; promotes
          alternative splicing of SRC1 pre-mRNA; binds
          non-covalently to the HIND domain of Snu66, may
          function in modification of Sph1p and Hbt1p,
          functionally complemented by the human or S. pombe
          ortholog; mechanism of Hub1p adduct formation not yet
          clear
          Length = 73

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK + ++  + D++ + K  +  + G  P++  L   G  L+D  +L DY 
Sbjct: 2  IEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYE 61

Query: 61 IQKESTLHL 69
          +  ++ L L
Sbjct: 62 VHDQTNLEL 70

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
            complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 29.6 bits (65), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 15   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 67
            L+ ++ + + NV+   + KE +  D Q+L+   K LED     + N++KE  L
Sbjct: 980  LKEDNGNLLKNVEDLTEQKESLSVDNQKLLNTVKDLEDNLKNKEINLRKEFKL 1032

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 56
          + +  K    + I LE+++  TI++ K +I  ++    DQ +LI++GK L++  T+
Sbjct: 2  VSLIFKDFKKEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATI 57

>KAFR0C04610 Chr3 complement(923893..924114) [222 bp, 73 aa] {ON}
          Anc_6.343 YNR032C-A
          Length = 73

 Score = 27.7 bits (60), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK   ++    DT+ ++K  +  + G  P +  L   G  L+D  TL DY 
Sbjct: 2  IEVIVSDRLGKKTKVKCLEDDTVGDLKKVLSVQIGSLPSKLVLQKGGTVLKDHITLGDYE 61

Query: 61 IQKESTLHL 69
          I   + L L
Sbjct: 62 IHSGTNLEL 70

>Kwal_26.8161 s26 (672977..676666) [3690 bp, 1229 aa] {ON} YMR012W
           (CLU1) - translation initiation factor eIF3 subunit
           [contig 55] FULL
          Length = 1229

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 54  RTLSDYNIQKESTLHLVLRLRGGIIEPSLKALA-SKYN 90
           RT+ D  + +  T++ VL+ R GII P L+ALA S YN
Sbjct: 157 RTVKD-TLNQGKTVNEVLKTRSGIITPCLRALALSGYN 193

>SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          +++ V    GK I ++  S DT+ + K  +  + G    +  L   G  L+D  TL DY 
Sbjct: 2  IEVLVNDRLGKKIRVKCMSEDTVGDFKKVLSLQLGTQHTKIILQKGGSVLKDHITLDDYE 61

Query: 61 IQKESTLHL 69
          +   + L L
Sbjct: 62 VHNGTNLEL 70

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 58
          + L++E S+TI   K K+         Q +LI++GK L+D +T+S+
Sbjct: 14 VPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSE 59

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60
          M I  K    + + +E+    TI + K  I +++     Q +LI+AGK L+D +T+S  N
Sbjct: 1  MLINFKDFKKEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCN 60

Query: 61 IQK 63
          +++
Sbjct: 61 LKE 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,571,288
Number of extensions: 538737
Number of successful extensions: 1700
Number of sequences better than 10.0: 162
Number of HSP's gapped: 1698
Number of HSP's successfully gapped: 229
Length of query: 149
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 50
Effective length of database: 42,129,465
Effective search space: 2106473250
Effective search space used: 2106473250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 60 (27.7 bits)